F410618

General Info

Members Datasets Scaffolds Average Seq Length
331 163 662 260

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0175892|Ga0466961_0175892_49_855
Length 268
Sequence VARIAVAATAPFGADVLERLAAEHDVVQLLTRPDKPRGRGRRLARPPAKEVAERLGIPVAQPERLDGSVELAADTVVVCAYGLLIPNELLERALWLNVHPSLLPRWRGAAPVERALLAGDDETGVTVHRTVEALDAGPVAAERAFPIGPDDDAGAVYAKAAELAAELLGDVLLQDEPRFVPQSEEGVTYAEKIRPEDRELDPDAPAQELVNRVRALSPHIGARLGLPDGGDLIVWRARVGEHGSFEPLEVQPAGGRRMAYDAYLRGRR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
161 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.37
Rhizosphere 90.63
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0175892 3300044693 Bacteria 1330
2 Ga0070658_10007864 3300005327 Bacteria 8588
3 Ga0070658_10018452 3300005327 Bacteria 5585
4 Ga0070658_10159376 3300005327 Bacteria 1893
5 Ga0070683_100050676 3300005329 Bacteria 3844
6 Ga0070683_100149029 3300005329 Bacteria 2218
7 Ga0070680_100025272 3300005336 Bacteria 4746
8 Ga0070660_100015225 3300005339 Bacteria 5548
9 Ga0070660_100059310 3300005339 Bacteria 2967
10 Ga0070661_100065434 3300005344 Bacteria 2671
11 Ga0070661_100080135 3300005344 Bacteria 2410
12 Ga0070659_100056413 3300005366 Bacteria 3097
13 Ga0070709_10152651 3300005434 Bacteria 1598
14 Ga0070709_10606063 3300005434 Bacteria 844
15 Ga0070714_100003803 3300005435 Bacteria 11336
16 Ga0070714_100008765 3300005435 Bacteria 7909
17 Ga0070714_100036022 3300005435 Bacteria 4148
18 Ga0070714_100079509 3300005435 Bacteria 2851
19 Ga0070714_100098576 3300005435 Bacteria 2571
20 Ga0070714_100136599 3300005435 Bacteria 2196
21 Ga0070713_100035985 3300005436 Bacteria 3991
22 Ga0070713_100119233 3300005436 Bacteria 2311
23 Ga0070713_100145436 3300005436 Bacteria 2104
24 Ga0070713_100622094 3300005436 Unclassified 1027
25 Ga0070710_10001497 3300005437 Bacteria 11004
26 Ga0070710_10013753 3300005437 Bacteria 4060
27 Ga0070710_10071955 3300005437 Bacteria 1995
28 Ga0070711_100009092 3300005439 Bacteria 6106
29 Ga0070711_100069110 3300005439 Bacteria 2484
30 Ga0070694_100007757 3300005444 Bacteria 6547
31 Ga0070708_100369711 3300005445 Bacteria 1352
32 Ga0070678_100246596 3300005456 Bacteria 1496
33 Ga0070681_10040312 3300005458 Bacteria 4679
34 Ga0070681_10050794 3300005458 Bacteria 4137
35 Ga0070681_10339577 3300005458 Bacteria 1412
36 Ga0070707_100326077 3300005468 Bacteria 1492
37 Ga0070679_100014662 3300005530 Bacteria 7532
38 Ga0070679_100195549 3300005530 Bacteria 1990
39 Ga0070684_100037292 3300005535 Bacteria 4169
40 Ga0070695_100000073 3300005545 Bacteria 40528
41 Ga0068855_100102018 3300005563 Bacteria 3302
42 Ga0068855_100121758 3300005563 Bacteria 2985
43 Ga0070664_100251798 3300005564 Bacteria 1588
44 Ga0068852_100143856 3300005616 Bacteria 2210
45 Ga0070717_10003164 3300006028 Bacteria 11756
46 Ga0070717_10169288 3300006028 Bacteria 1899
47 Ga0070717_10177921 3300006028 Bacteria 1853
48 Ga0070717_10260731 3300006028 Bacteria 1533
49 Ga0070715_10000860 3300006163 Bacteria 8365
50 Ga0070715_10010559 3300006163 Bacteria 3295
51 Ga0070716_100177047 3300006173 Bacteria 1397
52 Ga0070712_100054484 3300006175 Bacteria 2796
53 Ga0070712_100072343 3300006175 Bacteria 2469
54 Ga0070712_100569041 3300006175 Bacteria 956
55 Ga0075428_100048739 3300006844 Bacteria 4649
56 Ga0075434_100014406 3300006871 Bacteria 7557
57 Ga0075429_100102474 3300006880 Bacteria 2499
58 Ga0105240_10013664 3300009093 Bacteria 11135
59 Ga0105240_10602539 3300009093 Bacteria 1209
60 Ga0105237_10032892 3300009545 Bacteria 5251
61 Ga0105238_10270466 3300009551 Bacteria 1680
62 Ga0157371_10034855 3300013102 Bacteria 3609
63 Ga0157370_10050502 3300013104 Bacteria 3975
64 Ga0157370_10184916 3300013104 Bacteria 1935
65 Ga0157370_10784686 3300013104 Bacteria 867
66 Ga0157369_10009958 3300013105 Bacteria 10858
67 Ga0157369_10185395 3300013105 Bacteria 2188
68 Ga0157369_10321698 3300013105 Bacteria 1608
69 Ga0157374_10475396 3300013296 Bacteria 1252
70 Ga0163162_10187664 3300013306 Bacteria 2195
71 Ga0157372_10162813 3300013307 Bacteria 2579
72 Ga0182008_10059502 3300014497 Bacteria 1885
73 Ga0197907_11040237 3300020069 Bacteria 3677
74 Ga0206356_10938509 3300020070 Bacteria 3516
75 Ga0206354_10347447 3300020081 Bacteria 1038
76 Ga0206353_11934721 3300020082 Bacteria 2348
77 Ga0207685_10014949 3300025905 Unclassified 2445
78 Ga0207699_10028946 3300025906 Bacteria 3084
79 Ga0207699_10461502 3300025906 Bacteria 912
80 Ga0207705_10052074 3300025909 Bacteria 2946
81 Ga0207707_10073141 3300025912 Bacteria 2989
82 Ga0207707_10200001 3300025912 Bacteria 1742
83 Ga0207695_10104144 3300025913 Bacteria 2828
84 Ga0207693_10004798 3300025915 Bacteria 11372
85 Ga0207693_10005823 3300025915 Bacteria 10230
86 Ga0207693_10143086 3300025915 Bacteria 1880
87 Ga0207663_10098950 3300025916 Bacteria 1954
88 Ga0207663_10105052 3300025916 Bacteria 1905
89 Ga0207660_10337997 3300025917 Bacteria 1205
90 Ga0207657_10007697 3300025919 Bacteria 11008
91 Ga0207657_10016594 3300025919 Bacteria 7095
92 Ga0207657_10257341 3300025919 Bacteria 1390
93 Ga0207652_10062796 3300025921 Bacteria 3211
94 Ga0207646_10000268 3300025922 Bacteria 71093
95 Ga0207646_10331238 3300025922 Bacteria 1375
96 Ga0207687_10103320 3300025927 Bacteria 2101
97 Ga0207687_10112653 3300025927 Bacteria 2022
98 Ga0207700_10087985 3300025928 Bacteria 2444
99 Ga0207700_10604123 3300025928 Unclassified 976
100 Ga0207664_10004126 3300025929 Bacteria 9805
101 Ga0207664_10059743 3300025929 Bacteria 3037
102 Ga0207664_10074580 3300025929 Bacteria 2741
103 Ga0207664_10130219 3300025929 Bacteria 2117
104 Ga0207664_10400095 3300025929 Bacteria 1221
105 Ga0207664_10446187 3300025929 Bacteria 1154
106 Ga0207665_10000096 3300025939 Bacteria 57067
107 Ga0207667_10074053 3300025949 Bacteria 3537
108 Ga0207667_10126477 3300025949 Bacteria 2632
109 Ga0207702_10315558 3300026078 Bacteria 1487
110 Ga0207674_10506934 3300026116 Bacteria 1166
111 Ga0207683_10169724 3300026121 Bacteria 1975
112 Ga0265324_10020349 3300029957 Bacteria 2385
113 Ga0307416_100083471 3300032002 Bacteria 2711
114 Ga0373926_0010057 3300035083 Bacteria 3166
115 Ga0373923_0090614 3300035111 Bacteria 1337
116 Ga0373945_0008291 3300035116 Bacteria 3380
117 Ga0373953_0059162 3300035117 Bacteria 1564
118 Ga0373960_0101145 3300035121 Bacteria 934
119 Ga0373943_0004106 3300035170 Bacteria 6606
120 Ga0373943_0183172 3300035170 Bacteria 1152
121 Ga0373946_0019328 3300035171 Bacteria 2625
122 Ga0373931_0158644 3300035691 Bacteria 1324
123 Ga0373935_0019959 3300035692 Bacteria 4090
124 Ga0373933_0043171 3300035724 Bacteria 2667
125 Ga0373947_0000125 3300035725 Bacteria 38878
126 Ga0373937_0001555 3300036401 Bacteria 19280
127 Ga0373925_0001092 3300037068 Bacteria 24324
128 Ga0395900_0123679 3300037418 Bacteria 2653
129 Ga0395900_0410549 3300037418 Bacteria 1316
130 Ga0395900_0487266 3300037418 Bacteria 1185
131 Ga0395898_0218936 3300037466 Bacteria 1816
132 Ga0395898_0284557 3300037466 Unclassified 1577
133 Ga0395905_0198581 3300037471 Bacteria 1881
134 Ga0395905_0301854 3300037471 Bacteria 1489
135 Ga0395905_0611998 3300037471 Bacteria 991
136 Ga0395901_0012859 3300038443 Bacteria 8488
137 Ga0395901_0094502 3300038443 Bacteria 3132
138 Ga0395901_0183083 3300038443 Bacteria 2197
139 Ga0466969_0061203 3300044656 Bacteria 1829
140 Ga0466972_0137858 3300044658 Bacteria 1148
141 Ga0466965_0126527 3300044683 Bacteria 1322
142 Ga0466966_0014447 3300044684 Bacteria 5227
143 Ga0466966_0085386 3300044684 Bacteria 1962
144 Ga0466961_0004519 3300044693 Bacteria 8725
145 Ga0466961_0016097 3300044693 Bacteria 4802
146 Ga0466961_0046135 3300044693 Bacteria 2787
147 Ga0466963_0000135 3300044694 Bacteria 28446
148 Ga0466963_0002818 3300044694 Bacteria 9802
149 Ga0466963_0002935 3300044694 Bacteria 9635
150 Ga0466963_0008738 3300044694 Bacteria 6082
151 Ga0466963_0013599 3300044694 Bacteria 5000
152 Ga0466964_0004014 3300044706 Bacteria 5407
153 Ga0466964_0024889 3300044706 Bacteria 2334
154 Ga0466964_0026060 3300044706 Bacteria 2286
155 Ga0466971_0004224 3300044719 Bacteria 6191
156 Ga0466971_0014368 3300044719 Bacteria 3483
157 Ga0466968_0141965 3300044735 Bacteria 1099
158 Ga0466957_0000866 3300044842 Bacteria 15538
159 Ga0466957_0002686 3300044842 Bacteria 9613
160 Ga0466957_0015315 3300044842 Bacteria 4480
161 Ga0466957_0043455 3300044842 Bacteria 2721
162 Ga0466957_0046776 3300044842 Bacteria 2628
163 Ga0466960_0087316 3300044901 Bacteria 1583
164 Ga0466959_0001994 3300045049 Bacteria 12876
165 Ga0466959_0355868 3300045049 Bacteria 998
166 Ga0466958_0002010 3300045836 Bacteria 10017
167 Ga0466958_0003179 3300045836 Bacteria 8465
168 Ga0466958_0009502 3300045836 Bacteria 5421
169 Ga0466958_0015460 3300045836 Bacteria 4373
170 Ga0466958_0029620 3300045836 Bacteria 3248
171 Ga0466958_0046135 3300045836 Bacteria 2629
172 Ga0466958_0132353 3300045836 Bacteria 1567
173 Ga0466967_0000242 3300045976 Bacteria 23913
174 Ga0466967_0002567 3300045976 Bacteria 11396
175 Ga0466967_0017046 3300045976 Bacteria 5751
176 Ga0466967_0030548 3300045976 Bacteria 4523
177 Ga0466967_0037560 3300045976 Bacteria 4146
178 Ga0466967_0038854 3300045976 Bacteria 4085
179 Ga0466967_0084710 3300045976 Bacteria 2868
180 Ga0466967_0185093 3300045976 Bacteria 1966
181 Ga0466967_0473708 3300045976 Bacteria 1226
182 Ga0495592_0000125 3300046454 Bacteria 68045
183 Ga0495592_0002213 3300046454 Bacteria 13708
184 Ga0495592_0070269 3300046454 Bacteria 2551
185 Ga0495629_0016465 3300046459 Bacteria 5307
186 Ga0495629_0025364 3300046459 Bacteria 4214
187 Ga0495629_0052327 3300046459 Bacteria 2857
188 Ga0495629_0063429 3300046459 Bacteria 2581
189 Ga0495641_0003284 3300046461 Bacteria 12211
190 Ga0495651_0000011 3300046462 Bacteria 147193
191 Ga0495651_0008022 3300046462 Bacteria 8095
192 Ga0495651_0024073 3300046462 Bacteria 4737
193 Ga0495653_0001602 3300046463 Bacteria 17779
194 Ga0495653_0003016 3300046463 Bacteria 13497
195 Ga0495582_0009428 3300046473 Bacteria 5377
196 Ga0495582_0029641 3300046473 Bacteria 3003
197 Ga0495582_0129014 3300046473 Bacteria 1428
198 Ga0495639_0000801 3300046475 Bacteria 14368
199 Ga0495662_0007719 3300046476 Bacteria 5297
200 Ga0495664_0118635 3300046477 Bacteria 1599
201 Ga0495608_0001685 3300046511 Bacteria 15868
202 Ga0495608_0122586 3300046511 Unclassified 1666
203 Ga0495608_0214253 3300046511 Bacteria 1210
204 Ga0495618_0000900 3300046514 Bacteria 20427
205 Ga0495618_0005704 3300046514 Bacteria 7567
206 Ga0495618_0187970 3300046514 Bacteria 1311
207 Ga0495628_0000024 3300046516 Bacteria 130196
208 Ga0495628_0093029 3300046516 Bacteria 2332
209 Ga0495628_0107448 3300046516 Bacteria 2148
210 Ga0495628_0479929 3300046516 Bacteria 900
211 Ga0495630_0008688 3300046517 Bacteria 7294
212 Ga0495630_0031945 3300046517 Bacteria 3920
213 Ga0495630_0033829 3300046517 Bacteria 3812
214 Ga0495630_0171839 3300046517 Bacteria 1651
215 Ga0495666_0001109 3300046526 Bacteria 12886
216 Ga0495652_0000299 3300046529 Bacteria 58948
217 Ga0495652_0008407 3300046529 Bacteria 9424
218 Ga0495652_0012004 3300046529 Bacteria 7831
219 Ga0495652_0046917 3300046529 Bacteria 3707
220 Ga0495665_0003294 3300046531 Bacteria 8752
221 Ga0495640_0017548 3300046533 Bacteria 5331
222 Ga0495640_0025241 3300046533 Bacteria 4313
223 Ga0495640_0091050 3300046533 Bacteria 2012
224 Ga0495640_0351703 3300046533 Bacteria 909
225 Ga0495586_0013895 3300046535 Bacteria 4272
226 Ga0495587_0000204 3300046536 Bacteria 43619
227 Ga0495645_0000035 3300046543 Bacteria 102305
228 Ga0495645_0016365 3300046543 Bacteria 5293
229 Ga0495645_0044891 3300046543 Bacteria 3223
230 Ga0495667_0011031 3300046559 Bacteria 6110
231 Ga0495667_0012902 3300046559 Bacteria 5664
232 Ga0495667_0040761 3300046559 Bacteria 3082
233 Ga0495667_0216463 3300046559 Bacteria 1223
234 Ga0495656_0028403 3300046615 Bacteria 2244
235 Ga0495634_0009568 3300046642 Bacteria 7142
236 Ga0495634_0317706 3300046642 Unclassified 938
237 Ga0495635_0021142 3300046663 Bacteria 4535
238 Ga0495635_0033317 3300046663 Bacteria 3573
239 Ga0495635_0035993 3300046663 Bacteria 3432
240 Ga0495599_0000009 3300046678 Bacteria 217299
241 Ga0495599_0006316 3300046678 Bacteria 7143
242 Ga0495599_0096967 3300046678 Bacteria 1838
243 Ga0495623_0000039 3300046679 Bacteria 80360
244 Ga0495623_0027277 3300046679 Bacteria 3673
245 Ga0495646_0002081 3300046680 Bacteria 12130
246 Ga0495646_0013218 3300046680 Bacteria 5245
247 Ga0495646_0074272 3300046680 Bacteria 1996
248 Ga0495647_0005909 3300046681 Bacteria 4029
249 Ga0495658_0001305 3300046683 Bacteria 13049
250 Ga0495658_0124493 3300046683 Bacteria 1563
251 Ga0495613_0007204 3300046689 Bacteria 8285
252 Ga0495613_0015493 3300046689 Bacteria 5668
253 Ga0495613_0195073 3300046689 Bacteria 1430
254 Ga0495624_0003310 3300046690 Bacteria 12000
255 Ga0495624_0016713 3300046690 Bacteria 4939
256 Ga0495600_0135531 3300046809 Bacteria 1600
257 Ga0495581_0010859 3300047315 Bacteria 5264
258 Ga0495581_0256369 3300047315 Bacteria 1023
259 Ga0495604_0001424 3300047317 Bacteria 19635
260 Ga0495674_0026155 3300047319 Bacteria 5342
261 Ga0495674_0026399 3300047319 Bacteria 5314
262 Ga0495674_0334309 3300047319 Bacteria 1232
263 Ga0495674_0365043 3300047319 Bacteria 1170
264 Ga0495676_0035685 3300047321 Bacteria 4157
265 Ga0495676_0456719 3300047321 Bacteria 842
266 Ga0495680_0004978 3300047322 Bacteria 12558
267 Ga0495680_0010040 3300047322 Bacteria 8466
268 Ga0495680_0022467 3300047322 Bacteria 5255
269 Ga0495680_0277290 3300047322 Bacteria 1182
270 Ga0495675_0076224 3300047444 Bacteria 2114
271 Ga0495675_0246239 3300047444 Bacteria 1075
272 Ga0495684_0121006 3300047471 Bacteria 1971
273 Ga0495593_0012906 3300047673 Bacteria 4772
274 Ga0495602_0001454 3300048088 Bacteria 23500
275 Ga0495602_0033433 3300048088 Bacteria 4824
276 Ga0495602_0303800 3300048088 Bacteria 1167
277 Ga0495614_0000369 3300048089 Bacteria 18111
278 Ga0495614_0062424 3300048089 Bacteria 1601
279 Ga0495614_0157268 3300048089 Bacteria 1016
280 Ga0496101_0058595 3300048904 Bacteria 2790
281 Ga0496102_0007751 3300048905 Bacteria 9174
282 Ga0496102_0046035 3300048905 Bacteria 3961
283 Ga0496102_0304444 3300048905 Bacteria 1502
284 Ga0496103_0112387 3300048906 Bacteria 1731
285 Ga0496104_0005664 3300048907 Bacteria 10939
286 Ga0496105_0001697 3300048908 Bacteria 15707
287 Ga0496105_0031895 3300048908 Bacteria 4321
288 Ga0496105_0136536 3300048908 Unclassified 2020
289 Ga0496105_0192438 3300048908 Bacteria 1667
290 Ga0496107_0030530 3300048910 Unclassified 3841
291 Ga0496108_0006828 3300048911 Bacteria 9235
292 Ga0496108_0045269 3300048911 Bacteria 3675
293 Ga0496108_0152803 3300048911 Bacteria 1992
294 Ga0496108_0396413 3300048911 Unclassified 1205
295 Ga0496109_0002033 3300048912 Bacteria 16781
296 Ga0496109_0065859 3300048912 Bacteria 3317
297 Ga0496109_0239494 3300048912 Bacteria 1707
298 Ga0496109_0791045 3300048912 Unclassified 886
299 Ga0496110_0189488 3300048913 Bacteria 1868
300 Ga0496110_0295382 3300048913 Bacteria 1476
301 Ga0496111_0037287 3300048914 Bacteria 3479
302 Ga0496112_0063655 3300048915 Bacteria 3638
303 Ga0496113_0373984 3300048916 Bacteria 1144
304 Ga0496114_0090990 3300048917 Bacteria 2590
305 Ga0496114_0127487 3300048917 Bacteria 2195
306 Ga0496114_0298190 3300048917 Bacteria 1423
307 Ga0496114_0415788 3300048917 Bacteria 1191
308 Ga0496115_0024209 3300048918 Bacteria 4716
309 Ga0496115_0054511 3300048918 Bacteria 3210
310 Ga0496115_0500422 3300048918 Bacteria 976
311 Ga0501042_0184122 3300049578 Bacteria 1507
312 Ga0501067_0010317 3300049583 Bacteria 5170
313 Ga0501075_0257939 3300049591 Bacteria 1329
314 Ga0501045_0530297 3300049824 Bacteria 874
315 nmdc:mga05p37_187961_c1 3300050507 Bacteria 2510
316 nmdc:mga06r32_238259_c1 3300050510 Bacteria 1807
317 Ga0495601_0000224 3300053077 Bacteria 30389
318 Ga0495601_0002997 3300053077 Bacteria 9618
319 Ga0495601_0009180 3300053077 Bacteria 5844
320 Ga0495601_0012236 3300053077 Bacteria 5144
321 Ga0495601_0147642 3300053077 Bacteria 1535
322 Ga0495612_0002524 3300053078 Bacteria 7557
323 Ga0495612_0044154 3300053078 Bacteria 1823
324 Ga0495595_0003170 3300053084 Bacteria 6523
325 Ga0495619_0000712 3300053085 Bacteria 21673
326 Ga0495619_0006277 3300053085 Bacteria 7540
327 Ga0466962_0000592 3300061719 Bacteria 15989
328 Ga0466962_0021733 3300061719 Bacteria 3079
329 Ga0466962_0024174 3300061719 Bacteria 2919
330 Ga0466962_0027231 3300061719 Bacteria 2744
331 Ga0530510_0395016 3300061734 Bacteria 1042
332 Ga0466961_0175892
333 Ga0070658_10007864
334 Ga0070658_10018452
335 Ga0070658_10159376
336 Ga0070683_100050676
337 Ga0070683_100149029
338 Ga0070680_100025272
339 Ga0070660_100015225
340 Ga0070660_100059310
341 Ga0070661_100065434
342 Ga0070661_100080135
343 Ga0070659_100056413
344 Ga0070709_10152651
345 Ga0070709_10606063
346 Ga0070714_100003803
347 Ga0070714_100008765
348 Ga0070714_100036022
349 Ga0070714_100079509
350 Ga0070714_100098576
351 Ga0070714_100136599
352 Ga0070713_100035985
353 Ga0070713_100119233
354 Ga0070713_100145436
355 Ga0070713_100622094
356 Ga0070710_10001497
357 Ga0070710_10013753
358 Ga0070710_10071955
359 Ga0070711_100009092
360 Ga0070711_100069110
361 Ga0070694_100007757
362 Ga0070708_100369711
363 Ga0070678_100246596
364 Ga0070681_10040312
365 Ga0070681_10050794
366 Ga0070681_10339577
367 Ga0070707_100326077
368 Ga0070679_100014662
369 Ga0070679_100195549
370 Ga0070684_100037292
371 Ga0070695_100000073
372 Ga0068855_100102018
373 Ga0068855_100121758
374 Ga0070664_100251798
375 Ga0068852_100143856
376 Ga0070717_10003164
377 Ga0070717_10169288
378 Ga0070717_10177921
379 Ga0070717_10260731
380 Ga0070715_10000860
381 Ga0070715_10010559
382 Ga0070716_100177047
383 Ga0070712_100054484
384 Ga0070712_100072343
385 Ga0070712_100569041
386 Ga0075428_100048739
387 Ga0075434_100014406
388 Ga0075429_100102474
389 Ga0105240_10013664
390 Ga0105240_10602539
391 Ga0105237_10032892
392 Ga0105238_10270466
393 Ga0157371_10034855
394 Ga0157370_10050502
395 Ga0157370_10184916
396 Ga0157370_10784686
397 Ga0157369_10009958
398 Ga0157369_10185395
399 Ga0157369_10321698
400 Ga0157374_10475396
401 Ga0163162_10187664
402 Ga0157372_10162813
403 Ga0182008_10059502
404 Ga0197907_11040237
405 Ga0206356_10938509
406 Ga0206354_10347447
407 Ga0206353_11934721
408 Ga0207685_10014949
409 Ga0207699_10028946
410 Ga0207699_10461502
411 Ga0207705_10052074
412 Ga0207707_10073141
413 Ga0207707_10200001
414 Ga0207695_10104144
415 Ga0207693_10004798
416 Ga0207693_10005823
417 Ga0207693_10143086
418 Ga0207663_10098950
419 Ga0207663_10105052
420 Ga0207660_10337997
421 Ga0207657_10007697
422 Ga0207657_10016594
423 Ga0207657_10257341
424 Ga0207652_10062796
425 Ga0207646_10000268
426 Ga0207646_10331238
427 Ga0207687_10103320
428 Ga0207687_10112653
429 Ga0207700_10087985
430 Ga0207700_10604123
431 Ga0207664_10004126
432 Ga0207664_10059743
433 Ga0207664_10074580
434 Ga0207664_10130219
435 Ga0207664_10400095
436 Ga0207664_10446187
437 Ga0207665_10000096
438 Ga0207667_10074053
439 Ga0207667_10126477
440 Ga0207702_10315558
441 Ga0207674_10506934
442 Ga0207683_10169724
443 Ga0265324_10020349
444 Ga0307416_100083471
445 Ga0373926_0010057
446 Ga0373923_0090614
447 Ga0373945_0008291
448 Ga0373953_0059162
449 Ga0373960_0101145
450 Ga0373943_0004106
451 Ga0373943_0183172
452 Ga0373946_0019328
453 Ga0373931_0158644
454 Ga0373935_0019959
455 Ga0373933_0043171
456 Ga0373947_0000125
457 Ga0373937_0001555
458 Ga0373925_0001092
459 Ga0395900_0123679
460 Ga0395900_0410549
461 Ga0395900_0487266
462 Ga0395898_0218936
463 Ga0395898_0284557
464 Ga0395905_0198581
465 Ga0395905_0301854
466 Ga0395905_0611998
467 Ga0395901_0012859
468 Ga0395901_0094502
469 Ga0395901_0183083
470 Ga0466969_0061203
471 Ga0466972_0137858
472 Ga0466965_0126527
473 Ga0466966_0014447
474 Ga0466966_0085386
475 Ga0466961_0004519
476 Ga0466961_0016097
477 Ga0466961_0046135
478 Ga0466963_0000135
479 Ga0466963_0002818
480 Ga0466963_0002935
481 Ga0466963_0008738
482 Ga0466963_0013599
483 Ga0466964_0004014
484 Ga0466964_0024889
485 Ga0466964_0026060
486 Ga0466971_0004224
487 Ga0466971_0014368
488 Ga0466968_0141965
489 Ga0466957_0000866
490 Ga0466957_0002686
491 Ga0466957_0015315
492 Ga0466957_0043455
493 Ga0466957_0046776
494 Ga0466960_0087316
495 Ga0466959_0001994
496 Ga0466959_0355868
497 Ga0466958_0002010
498 Ga0466958_0003179
499 Ga0466958_0009502
500 Ga0466958_0015460
501 Ga0466958_0029620
502 Ga0466958_0046135
503 Ga0466958_0132353
504 Ga0466967_0000242
505 Ga0466967_0002567
506 Ga0466967_0017046
507 Ga0466967_0030548
508 Ga0466967_0037560
509 Ga0466967_0038854
510 Ga0466967_0084710
511 Ga0466967_0185093
512 Ga0466967_0473708
513 Ga0495592_0000125
514 Ga0495592_0002213
515 Ga0495592_0070269
516 Ga0495629_0016465
517 Ga0495629_0025364
518 Ga0495629_0052327
519 Ga0495629_0063429
520 Ga0495641_0003284
521 Ga0495651_0000011
522 Ga0495651_0008022
523 Ga0495651_0024073
524 Ga0495653_0001602
525 Ga0495653_0003016
526 Ga0495582_0009428
527 Ga0495582_0029641
528 Ga0495582_0129014
529 Ga0495639_0000801
530 Ga0495662_0007719
531 Ga0495664_0118635
532 Ga0495608_0001685
533 Ga0495608_0122586
534 Ga0495608_0214253
535 Ga0495618_0000900
536 Ga0495618_0005704
537 Ga0495618_0187970
538 Ga0495628_0000024
539 Ga0495628_0093029
540 Ga0495628_0107448
541 Ga0495628_0479929
542 Ga0495630_0008688
543 Ga0495630_0031945
544 Ga0495630_0033829
545 Ga0495630_0171839
546 Ga0495666_0001109
547 Ga0495652_0000299
548 Ga0495652_0008407
549 Ga0495652_0012004
550 Ga0495652_0046917
551 Ga0495665_0003294
552 Ga0495640_0017548
553 Ga0495640_0025241
554 Ga0495640_0091050
555 Ga0495640_0351703
556 Ga0495586_0013895
557 Ga0495587_0000204
558 Ga0495645_0000035
559 Ga0495645_0016365
560 Ga0495645_0044891
561 Ga0495667_0011031
562 Ga0495667_0012902
563 Ga0495667_0040761
564 Ga0495667_0216463
565 Ga0495656_0028403
566 Ga0495634_0009568
567 Ga0495634_0317706
568 Ga0495635_0021142
569 Ga0495635_0033317
570 Ga0495635_0035993
571 Ga0495599_0000009
572 Ga0495599_0006316
573 Ga0495599_0096967
574 Ga0495623_0000039
575 Ga0495623_0027277
576 Ga0495646_0002081
577 Ga0495646_0013218
578 Ga0495646_0074272
579 Ga0495647_0005909
580 Ga0495658_0001305
581 Ga0495658_0124493
582 Ga0495613_0007204
583 Ga0495613_0015493
584 Ga0495613_0195073
585 Ga0495624_0003310
586 Ga0495624_0016713
587 Ga0495600_0135531
588 Ga0495581_0010859
589 Ga0495581_0256369
590 Ga0495604_0001424
591 Ga0495674_0026155
592 Ga0495674_0026399
593 Ga0495674_0334309
594 Ga0495674_0365043
595 Ga0495676_0035685
596 Ga0495676_0456719
597 Ga0495680_0004978
598 Ga0495680_0010040
599 Ga0495680_0022467
600 Ga0495680_0277290
601 Ga0495675_0076224
602 Ga0495675_0246239
603 Ga0495684_0121006
604 Ga0495593_0012906
605 Ga0495602_0001454
606 Ga0495602_0033433
607 Ga0495602_0303800
608 Ga0495614_0000369
609 Ga0495614_0062424
610 Ga0495614_0157268
611 Ga0496101_0058595
612 Ga0496102_0007751
613 Ga0496102_0046035
614 Ga0496102_0304444
615 Ga0496103_0112387
616 Ga0496104_0005664
617 Ga0496105_0001697
618 Ga0496105_0031895
619 Ga0496105_0136536
620 Ga0496105_0192438
621 Ga0496107_0030530
622 Ga0496108_0006828
623 Ga0496108_0045269
624 Ga0496108_0152803
625 Ga0496108_0396413
626 Ga0496109_0002033
627 Ga0496109_0065859
628 Ga0496109_0239494
629 Ga0496109_0791045
630 Ga0496110_0189488
631 Ga0496110_0295382
632 Ga0496111_0037287
633 Ga0496112_0063655
634 Ga0496113_0373984
635 Ga0496114_0090990
636 Ga0496114_0127487
637 Ga0496114_0298190
638 Ga0496114_0415788
639 Ga0496115_0024209
640 Ga0496115_0054511
641 Ga0496115_0500422
642 Ga0501042_0184122
643 Ga0501067_0010317
644 Ga0501075_0257939
645 Ga0501045_0530297
646 nmdc:mga05p37_187961_c1
647 nmdc:mga06r32_238259_c1
648 Ga0495601_0000224
649 Ga0495601_0002997
650 Ga0495601_0009180
651 Ga0495601_0012236
652 Ga0495601_0147642
653 Ga0495612_0002524
654 Ga0495612_0044154
655 Ga0495595_0003170
656 Ga0495619_0000712
657 Ga0495619_0006277
658 Ga0466962_0000592
659 Ga0466962_0021733
660 Ga0466962_0024174
661 Ga0466962_0027231
662 Ga0530510_0395016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

192

247

0.93

PF00551

Formyl_trans_N

Formyl transferase

2

192

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f7v-assembly1.cif.gz_A crystal structure of lkce e64q mutant in complex with lc-ka05 0.8047 2 34
6f32-assembly1.cif.gz_A crystal structure of a dual function amine oxidase/cyclase in complex with substrate analogues 0.7898 2 35
5es8-assembly1.cif.gz_A crystal structure of the initiation module of lgra in the thiolation state 0.7218 1 186
3da8-assembly1.cif.gz_A crystal structure of purn from mycobacterium tuberculosis 0.7214 2 173
5es9-assembly1.cif.gz_A crystal structure of the lgra initiation module in the formylation state 0.7178 1 186
ID Description Score Start End Superfamily
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8631 2 187 3.40.50.170
af_Q5N7L5_250_360_3.10.25.10 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.8456 195 259 3.10.25.10
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8112 3 186 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8029 1 186 3.40.50.170
5uaiB02 Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain 0.8026 196 260 3.10.25.10
ID Description Score Start End GO Terms
AF-A0A7Z1N8K7-F1-model_v4 Methionyl-tRNA formyltransferase 0.9236 1 99 GO:0004479
GO:0005829
AF-A0A2V9PNB6-F1-model_v4 Methionyl-tRNA formyltransferase 0.9223 2 86 GO:0004479
GO:0005829
AF-A0A7Z7VXH2-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9136 1 92 GO:0004479
GO:0005829
AF-A0A352AZA6-F1-model_v4 Methionyl-tRNA formyltransferase 0.9123 1 115 GO:0004479
GO:0005829
AF-A0A383BPB4-F1-model_v4 Formyl transferase N-terminal domain-containing protein 0.9074 2 102 GO:0004479

Map