F410530

General Info

Members Datasets Scaffolds Average Seq Length
331 186 662 343

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10043609|Ga0207657_100436093
Length 379
Sequence VSVTKRDYYEVLGVVRDCDDQVLKASYRKLALAHHPDRNPGDKHAEEKFKEAAEAYSVLSDPQKRAAYDRFGHQGVSSAAGGGFDGGGMPDLSDILNEMFGFGDVFGSGSRQQRRSRPQRGEDVRYDLDITFEDSMRGLAVDIQVPRMEECGRCKGKGAEPEDGVVTCPTCRGRGEVIYQQAFLSVRRKECKGQAYLRRERKLKVNIPAGVDNGTQLRLSQEGQPGANGGPTGDLFVVLKVAEHPVFERHEFDLHCTVPVNIAQAALGCSVDVLTFDGLQSVKVPEGSQAGARLKLKGLGVPHLNSSGRGDLYDALVARGYYRKRPDRVRRRYLAAAVVMAVGLPSALVPLGDELWGTPALPIIGSSLLAAFVVGPDCM

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10043609 3300025919 Bacteria 3949
2 Ga0058862_11419192 3300004803 Bacteria 1625
3 Ga0070676_10000123 3300005328 Bacteria 28716
4 Ga0070683_100006355 3300005329 Bacteria 9908
5 Ga0070683_100019495 3300005329 Bacteria 6025
6 Ga0070683_100032521 3300005329 Bacteria 4750
7 Ga0070683_100036258 3300005329 Bacteria 4512
8 Ga0070683_100036458 3300005329 Unclassified 4500
9 Ga0070660_100014270 3300005339 Bacteria 5720
10 Ga0070660_100053078 3300005339 Bacteria 3126
11 Ga0070689_100049888 3300005340 Bacteria 3232
12 Ga0070691_10003569 3300005341 Bacteria 7017
13 Ga0070692_10094078 3300005345 Bacteria 1633
14 Ga0070668_100047981 3300005347 Bacteria 3284
15 Ga0070669_100009166 3300005353 Bacteria 7052
16 Ga0070669_100063548 3300005353 Bacteria 2717
17 Ga0070671_100095196 3300005355 Bacteria 2496
18 Ga0070674_100102805 3300005356 Bacteria 2085
19 Ga0070673_100016651 3300005364 Bacteria 5205
20 Ga0070688_100103838 3300005365 Bacteria 1878
21 Ga0070659_100240496 3300005366 Bacteria 1498
22 Ga0070709_10023318 3300005434 Bacteria 3631
23 Ga0070709_10154485 3300005434 Bacteria 1589
24 Ga0070714_100180787 3300005435 Bacteria 1919
25 Ga0070713_100129552 3300005436 Bacteria 2223
26 Ga0070701_10014793 3300005438 Bacteria 3586
27 Ga0070705_100001079 3300005440 Bacteria 15138
28 Ga0070700_100016592 3300005441 Bacteria 4198
29 Ga0070708_100025813 3300005445 Bacteria 5024
30 Ga0070663_100063852 3300005455 Bacteria 2660
31 Ga0070681_10000384 3300005458 Bacteria 35781
32 Ga0070681_10020476 3300005458 Bacteria 6630
33 Ga0070681_10253847 3300005458 Bacteria 1671
34 Ga0068867_100020060 3300005459 Bacteria 4764
35 Ga0068867_100282568 3300005459 Bacteria 1361
36 Ga0070685_10152572 3300005466 Bacteria 1465
37 Ga0070699_100002361 3300005518 Bacteria 16930
38 Ga0070679_100007490 3300005530 Bacteria 10208
39 Ga0070679_100365415 3300005530 Unclassified 1390
40 Ga0070684_100015798 3300005535 Bacteria 6160
41 Ga0070684_100191435 3300005535 Bacteria 1861
42 Ga0070697_100108071 3300005536 Unclassified 2315
43 Ga0070697_100147191 3300005536 Bacteria 1984
44 Ga0068853_100057289 3300005539 Bacteria 3363
45 Ga0068853_100148304 3300005539 Bacteria 2110
46 Ga0070696_100018224 3300005546 Bacteria 4742
47 Ga0070665_100014721 3300005548 Bacteria 7848
48 Ga0070665_100017847 3300005548 Bacteria 7124
49 Ga0070665_100217148 3300005548 Bacteria 1913
50 Ga0070704_100009357 3300005549 Bacteria 5916
51 Ga0068855_100012823 3300005563 Bacteria 10112
52 Ga0068855_100043248 3300005563 Bacteria 5337
53 Ga0068855_100182875 3300005563 Bacteria 2369
54 Ga0068855_100254189 3300005563 Bacteria 1959
55 Ga0068857_100007666 3300005577 Bacteria 9298
56 Ga0068857_100104412 3300005577 Bacteria 2544
57 Ga0068854_100030156 3300005578 Bacteria 3761
58 Ga0068856_100000895 3300005614 Bacteria 31901
59 Ga0068856_100061427 3300005614 Bacteria 3712
60 Ga0070702_100006565 3300005615 Bacteria 5516
61 Ga0068852_100183041 3300005616 Bacteria 1971
62 Ga0068852_100220376 3300005616 Bacteria 1804
63 Ga0068864_100445251 3300005618 Bacteria 1238
64 Ga0068861_100036227 3300005719 Bacteria 3660
65 Ga0068861_100081473 3300005719 Unclassified 2534
66 Ga0068851_10106897 3300005834 Unclassified 1490
67 Ga0068863_100229068 3300005841 Bacteria 1792
68 Ga0068858_100075030 3300005842 Bacteria 3141
69 Ga0068860_100036097 3300005843 Bacteria 4738
70 Ga0068862_100044513 3300005844 Bacteria 3786
71 Ga0081455_10150083 3300005937 Bacteria 1798
72 Ga0070717_10009038 3300006028 Bacteria 7479
73 Ga0070717_10017320 3300006028 Bacteria 5605
74 Ga0075364_10010194 3300006051 Bacteria 5667
75 Ga0097621_100010501 3300006237 Bacteria 6780
76 Ga0097621_100016250 3300006237 Bacteria 5621
77 Ga0097621_100017760 3300006237 Bacteria 5412
78 Ga0097621_100017978 3300006237 Bacteria 5387
79 Ga0097621_100078382 3300006237 Unclassified 2745
80 Ga0097621_100083185 3300006237 Bacteria 2667
81 Ga0068871_100003518 3300006358 Bacteria 10778
82 Ga0068871_100019215 3300006358 Bacteria 5215
83 Ga0068871_100020797 3300006358 Bacteria 5033
84 Ga0068871_100038704 3300006358 Bacteria 3810
85 Ga0068871_100043078 3300006358 Unclassified 3625
86 Ga0075430_100046834 3300006846 Bacteria 3651
87 Ga0075431_100002583 3300006847 Bacteria 17495
88 Ga0075431_100021085 3300006847 Bacteria 6660
89 Ga0075433_10023444 3300006852 Bacteria 5195
90 Ga0075434_100031224 3300006871 Bacteria 5251
91 Ga0075434_100255258 3300006871 Bacteria 1772
92 Ga0075429_100048738 3300006880 Bacteria 3683
93 Ga0068865_100003883 3300006881 Bacteria 8967
94 Ga0068865_100010064 3300006881 Bacteria 5883
95 Ga0068865_100065040 3300006881 Bacteria 2568
96 Ga0075436_100008769 3300006914 Bacteria 6915
97 Ga0075436_100026717 3300006914 Bacteria 3974
98 Ga0105240_10001076 3300009093 Bacteria 48242
99 Ga0105240_10004907 3300009093 Bacteria 20136
100 Ga0105240_10046167 3300009093 Bacteria 5522
101 Ga0105240_10120383 3300009093 Bacteria 3161
102 Ga0105240_10211962 3300009093 Bacteria 2263
103 Ga0105240_10290764 3300009093 Bacteria 1873
104 Ga0111539_10017492 3300009094 Bacteria 8875
105 Ga0105245_10001237 3300009098 Bacteria 23053
106 Ga0105245_10011154 3300009098 Bacteria 7822
107 Ga0105245_10133102 3300009098 Bacteria 2334
108 Ga0105245_10189253 3300009098 Bacteria 1970
109 Ga0114129_10008454 3300009147 Bacteria 14667
110 Ga0114129_10008520 3300009147 Bacteria 14616
111 Ga0114129_10009041 3300009147 Bacteria 14197
112 Ga0114129_10009110 3300009147 Bacteria 14147
113 Ga0114129_10023603 3300009147 Bacteria 8717
114 Ga0114129_10027772 3300009147 Bacteria 8013
115 Ga0105243_10047632 3300009148 Bacteria 3376
116 Ga0105243_10081118 3300009148 Bacteria 2648
117 Ga0105243_10099789 3300009148 Bacteria 2408
118 Ga0105241_10108675 3300009174 Unclassified 2217
119 Ga0105242_10045687 3300009176 Bacteria 3550
120 Ga0105248_10008820 3300009177 Bacteria 11076
121 Ga0105248_10017615 3300009177 Bacteria 7880
122 Ga0105248_10059912 3300009177 Bacteria 4275
123 Ga0105248_10140581 3300009177 Bacteria 2723
124 Ga0105248_10227668 3300009177 Bacteria 2099
125 Ga0105237_10005295 3300009545 Bacteria 14589
126 Ga0105237_10007797 3300009545 Bacteria 11673
127 Ga0105237_10070889 3300009545 Bacteria 3481
128 Ga0105238_10003566 3300009551 Bacteria 15513
129 Ga0105238_10017871 3300009551 Bacteria 7209
130 Ga0105238_10019925 3300009551 Bacteria 6826
131 Ga0105238_10063283 3300009551 Bacteria 3699
132 Ga0105238_10064246 3300009551 Bacteria 3671
133 Ga0105239_10002596 3300010375 Bacteria 22859
134 Ga0105239_10040540 3300010375 Bacteria 5102
135 Ga0105239_10234850 3300010375 Bacteria 2058
136 Ga0157370_10003781 3300013104 Bacteria 17667
137 Ga0157370_10016716 3300013104 Bacteria 7425
138 Ga0157370_10284566 3300013104 Bacteria 1527
139 Ga0157369_10007427 3300013105 Bacteria 12624
140 Ga0157369_10050534 3300013105 Bacteria 4502
141 Ga0157369_10302815 3300013105 Bacteria 1663
142 Ga0157378_10333131 3300013297 Bacteria 1478
143 Ga0163162_10100725 3300013306 Bacteria 2980
144 Ga0163162_10479608 3300013306 Unclassified 1375
145 Ga0157372_10024476 3300013307 Bacteria 6559
146 Ga0157372_10024656 3300013307 Bacteria 6537
147 Ga0157372_10037414 3300013307 Bacteria 5353
148 Ga0157375_10260147 3300013308 Bacteria 1897
149 Ga0157375_10306139 3300013308 Bacteria 1753
150 Ga0157375_10320689 3300013308 Bacteria 1714
151 Ga0163163_10027160 3300014325 Bacteria 5480
152 Ga0163163_10049979 3300014325 Unclassified 4117
153 Ga0163163_10101563 3300014325 Bacteria 2898
154 Ga0163163_10387592 3300014325 Unclassified 1455
155 Ga0157380_10177193 3300014326 Bacteria 1869
156 Ga0157379_10047899 3300014968 Bacteria 3815
157 Ga0157376_10008847 3300014969 Bacteria 7286
158 Ga0157376_10102643 3300014969 Bacteria 2502
159 Ga0163161_10169365 3300017792 Bacteria 1669
160 Ga0213875_10000689 3300021388 Bacteria 26175
161 Ga0207647_10003331 3300025904 Bacteria 12066
162 Ga0207699_10072887 3300025906 Bacteria 2105
163 Ga0207645_10001932 3300025907 Bacteria 16728
164 Ga0207684_10294052 3300025910 Bacteria 1400
165 Ga0207707_10000998 3300025912 Bacteria 27123
166 Ga0207707_10059576 3300025912 Unclassified 3322
167 Ga0207707_10241184 3300025912 Bacteria 1571
168 Ga0207695_10004446 3300025913 Bacteria 19106
169 Ga0207695_10009172 3300025913 Bacteria 12274
170 Ga0207695_10086279 3300025913 Bacteria 3166
171 Ga0207671_10043076 3300025914 Bacteria 3338
172 Ga0207671_10083094 3300025914 Unclassified 2404
173 Ga0207660_10089815 3300025917 Bacteria 2275
174 Ga0207657_10033015 3300025919 Bacteria 4669
175 Ga0207652_10022881 3300025921 Bacteria 5176
176 Ga0207652_10050367 3300025921 Bacteria 3568
177 Ga0207652_10060557 3300025921 Bacteria 3266
178 Ga0207681_10302888 3300025923 Bacteria 1265
179 Ga0207694_10031223 3300025924 Unclassified 4067
180 Ga0207694_10098737 3300025924 Bacteria 2312
181 Ga0207694_10222942 3300025924 Bacteria 1538
182 Ga0207687_10001836 3300025927 Bacteria 14610
183 Ga0207687_10002801 3300025927 Bacteria 11821
184 Ga0207687_10006714 3300025927 Bacteria 7591
185 Ga0207687_10010055 3300025927 Bacteria 6190
186 Ga0207644_10073387 3300025931 Bacteria 2509
187 Ga0207706_10148530 3300025933 Bacteria 2062
188 Ga0207686_10010546 3300025934 Bacteria 5034
189 Ga0207686_10016297 3300025934 Bacteria 4170
190 Ga0207686_10066778 3300025934 Bacteria 2298
191 Ga0207709_10121248 3300025935 Bacteria 1766
192 Ga0207669_10042270 3300025937 Bacteria 2659
193 Ga0207704_10001994 3300025938 Bacteria 9154
194 Ga0207704_10012540 3300025938 Bacteria 4209
195 Ga0207711_10009709 3300025941 Bacteria 8014
196 Ga0207711_10042304 3300025941 Bacteria 3882
197 Ga0207711_10118835 3300025941 Bacteria 2358
198 Ga0207711_10196823 3300025941 Bacteria 1838
199 Ga0207689_10099254 3300025942 Unclassified 2393
200 Ga0207689_10105113 3300025942 Bacteria 2320
201 Ga0207661_10012280 3300025944 Bacteria 6221
202 Ga0207661_10031196 3300025944 Bacteria 4113
203 Ga0207661_10043716 3300025944 Bacteria 3537
204 Ga0207667_10000776 3300025949 Bacteria 41369
205 Ga0207667_10001792 3300025949 Bacteria 27028
206 Ga0207667_10018117 3300025949 Bacteria 7905
207 Ga0207667_10096659 3300025949 Bacteria 3048
208 Ga0207667_10238570 3300025949 Bacteria 1861
209 Ga0207651_10235614 3300025960 Bacteria 1489
210 Ga0207651_10381293 3300025960 Bacteria 1195
211 Ga0207703_10075068 3300026035 Bacteria 2801
212 Ga0207703_10220005 3300026035 Bacteria 1697
213 Ga0207708_10000478 3300026075 Bacteria 30880
214 Ga0207708_10219413 3300026075 Bacteria 1523
215 Ga0207702_10028019 3300026078 Bacteria 4680
216 Ga0207641_10228249 3300026088 Bacteria 1729
217 Ga0207641_10314870 3300026088 Bacteria 1482
218 Ga0207648_10014310 3300026089 Bacteria 7332
219 Ga0207648_10018933 3300026089 Bacteria 6219
220 Ga0207648_10039178 3300026089 Bacteria 4167
221 Ga0207648_10233840 3300026089 Unclassified 1635
222 Ga0207676_10186555 3300026095 Bacteria 1821
223 Ga0207674_10000329 3300026116 Bacteria 60602
224 Ga0207674_10008683 3300026116 Bacteria 11699
225 Ga0207675_100000955 3300026118 Bacteria 28819
226 Ga0207675_100103356 3300026118 Unclassified 2685
227 Ga0207683_10032470 3300026121 Bacteria 4535
228 Ga0207698_10022142 3300026142 Bacteria 4409
229 Ga0207428_10231439 3300027907 Bacteria 1383
230 Ga0268266_10012450 3300028379 Bacteria 7352
231 Ga0268265_10028816 3300028380 Bacteria 3979
232 Ga0268264_10037230 3300028381 Bacteria 4011
233 Ga0268264_10096747 3300028381 Bacteria 2558
234 Ga0265332_10013708 3300031238 Bacteria 3590
235 Ga0265325_10104548 3300031241 Bacteria 1383
236 Ga0265331_10028366 3300031250 Bacteria 2800
237 Ga0265316_10000993 3300031344 Bacteria 30812
238 Ga0265314_10003083 3300031711 Bacteria 16429
239 Ga0265314_10021510 3300031711 Bacteria 4956
240 Ga0265342_10034909 3300031712 Bacteria 3082
241 Ga0316577_10003552 3300031733 Bacteria 7895
242 Ga0373944_0052399 3300035089 Bacteria 1289
243 Ga0373936_0081296 3300035113 Bacteria 1349
244 Ga0373954_0001549 3300035118 Bacteria 9371
245 Ga0373954_0037400 3300035118 Bacteria 2256
246 Ga0373957_0058938 3300035120 Bacteria 1484
247 Ga0373957_0072690 3300035120 Bacteria 1347
248 Ga0373943_0018616 3300035170 Bacteria 3192
249 Ga0373955_0045496 3300035172 Bacteria 2369
250 Ga0373924_0009201 3300035410 Bacteria 3616
251 Ga0373924_0062036 3300035410 Bacteria 1565
252 Ga0373935_0015089 3300035692 Unclassified 4665
253 Ga0373935_0045252 3300035692 Bacteria 2777
254 Ga0373927_0086866 3300035695 Bacteria 2030
255 Ga0373933_0057645 3300035724 Bacteria 2335
256 Ga0373947_0035967 3300035725 Bacteria 2934
257 Ga0373937_0003982 3300036401 Bacteria 12499
258 Ga0373937_0028263 3300036401 Bacteria 5073
259 Ga0373937_0071153 3300036401 Bacteria 3208
260 Ga0373937_0164359 3300036401 Bacteria 2081
261 Ga0373937_0414393 3300036401 Bacteria 1278
262 Ga0316582_0045902 3300036647 Bacteria 2752
263 Ga0316584_0005050 3300036712 Bacteria 8796
264 Ga0373925_0188852 3300037068 Bacteria 1634
265 Ga0436364_0890864 3300037853 Bacteria 67172
266 Ga0436364_0949563 3300037853 Bacteria 2836
267 Ga0436364_1169042 3300037853 Bacteria 9848
268 Ga0436362_0486690 3300039453 Bacteria 2385
269 Ga0451576_0119725 3300045051 Bacteria 2741
270 Ga0495629_0044358 3300046459 Bacteria 3121
271 Ga0495580_0013629 3300046472 Bacteria 6200
272 Ga0495580_0122856 3300046472 Bacteria 1802
273 Ga0495582_0006934 3300046473 Bacteria 6301
274 Ga0495582_0036858 3300046473 Bacteria 2690
275 Ga0495594_0141463 3300046499 Bacteria 1365
276 Ga0495608_0018855 3300046511 Bacteria 4754
277 Ga0495630_0016281 3300046517 Bacteria 5432
278 Ga0495652_0058292 3300046529 Bacteria 3270
279 Ga0495652_0274301 3300046529 Bacteria 1238
280 Ga0495586_0061652 3300046535 Bacteria 2041
281 Ga0495587_0013555 3300046536 Bacteria 5122
282 Ga0495645_0025612 3300046543 Bacteria 4282
283 Ga0495635_0092185 3300046663 Bacteria 2072
284 Ga0495657_0063002 3300046675 Bacteria 2448
285 Ga0495599_0020075 3300046678 Bacteria 4163
286 Ga0495646_0088621 3300046680 Bacteria 1792
287 Ga0495647_0054227 3300046681 Bacteria 1566
288 Ga0495658_0004639 3300046683 Bacteria 6758
289 Ga0495669_0001403 3300046684 Bacteria 9914
290 Ga0495613_0020566 3300046689 Bacteria 4920
291 Ga0495649_0074539 3300046694 Bacteria 1818
292 Ga0495604_0007292 3300047317 Bacteria 8754
293 Ga0495680_0172642 3300047322 Bacteria 1565
294 Ga0495675_0102039 3300047444 Bacteria 1795
295 Ga0495684_0000418 3300047471 Bacteria 34711
296 Ga0495684_0029066 3300047471 Bacteria 4242
297 Ga0495684_0079886 3300047471 Bacteria 2483
298 Ga0495602_0022574 3300048088 Bacteria 6156
299 Ga0496104_0180192 3300048907 Bacteria 2023
300 Ga0496104_0197070 3300048907 Unclassified 1926
301 Ga0496104_0231341 3300048907 Bacteria 1760
302 Ga0496104_0425236 3300048907 Bacteria 1240
303 Ga0496105_0150121 3300048908 Bacteria 1915
304 Ga0496110_0164486 3300048913 Bacteria 2012
305 Ga0496115_0051654 3300048918 Bacteria 3296
306 Ga0501068_0153312 3300049584 Bacteria 1449
307 Ga0501069_0053756 3300049585 Bacteria 2243
308 nmdc:mga00v17_25020_c1 3300050491 Bacteria 3466
309 nmdc:mga05p37_117190_c1 3300050507 Bacteria 3273
310 nmdc:mga05p37_3094_c1 3300050507 Bacteria 19331
311 nmdc:mga05p37_43509_c1 3300050507 Bacteria 5525
312 nmdc:mga05p37_71884_c1 3300050507 Bacteria 4257
313 nmdc:mga05p37_77147_c1 3300050507 Bacteria 4102
314 nmdc:mga05p37_8061_c1 3300050507 Bacteria 12442
315 nmdc:mga09592_65285_c1 3300050508 Bacteria 3083
316 nmdc:mga0qj67_220739_c1 3300050509 Bacteria 1539
317 nmdc:mga0qj67_36780_c1 3300050509 Bacteria 3832
318 nmdc:mga06r32_10428_c1 3300050510 Bacteria 8384
319 nmdc:mga06r32_67520_c1 3300050510 Bacteria 3452
320 nmdc:mga08y16_47850_c1 3300050511 Bacteria 4476
321 nmdc:mga0n895_230440_c1 3300050512 Bacteria 1880
322 nmdc:mga0n895_286468_c1 3300050512 Bacteria 1670
323 nmdc:mga0n895_50464_c1 3300050512 Bacteria 4079
324 nmdc:mga08x19_123296_c1 3300050514 Bacteria 1739
325 nmdc:mga08x19_17234_c1 3300050514 Bacteria 4417
326 nmdc:mga08x19_47502_c1 3300050514 Bacteria 2748
327 nmdc:mga0a205_50426_c2 3300050515 Bacteria 1838
328 Ga0495601_0015368 3300053077 Bacteria 4627
329 Ga0495601_0032008 3300053077 Bacteria 3271
330 Ga0495612_0030995 3300053078 Unclassified 2155
331 Ga0495619_0143238 3300053085 Bacteria 1647
332 Ga0207657_10043609
333 Ga0058862_11419192
334 Ga0070676_10000123
335 Ga0070683_100006355
336 Ga0070683_100019495
337 Ga0070683_100032521
338 Ga0070683_100036258
339 Ga0070683_100036458
340 Ga0070660_100014270
341 Ga0070660_100053078
342 Ga0070689_100049888
343 Ga0070691_10003569
344 Ga0070692_10094078
345 Ga0070668_100047981
346 Ga0070669_100009166
347 Ga0070669_100063548
348 Ga0070671_100095196
349 Ga0070674_100102805
350 Ga0070673_100016651
351 Ga0070688_100103838
352 Ga0070659_100240496
353 Ga0070709_10023318
354 Ga0070709_10154485
355 Ga0070714_100180787
356 Ga0070713_100129552
357 Ga0070701_10014793
358 Ga0070705_100001079
359 Ga0070700_100016592
360 Ga0070708_100025813
361 Ga0070663_100063852
362 Ga0070681_10000384
363 Ga0070681_10020476
364 Ga0070681_10253847
365 Ga0068867_100020060
366 Ga0068867_100282568
367 Ga0070685_10152572
368 Ga0070699_100002361
369 Ga0070679_100007490
370 Ga0070679_100365415
371 Ga0070684_100015798
372 Ga0070684_100191435
373 Ga0070697_100108071
374 Ga0070697_100147191
375 Ga0068853_100057289
376 Ga0068853_100148304
377 Ga0070696_100018224
378 Ga0070665_100014721
379 Ga0070665_100017847
380 Ga0070665_100217148
381 Ga0070704_100009357
382 Ga0068855_100012823
383 Ga0068855_100043248
384 Ga0068855_100182875
385 Ga0068855_100254189
386 Ga0068857_100007666
387 Ga0068857_100104412
388 Ga0068854_100030156
389 Ga0068856_100000895
390 Ga0068856_100061427
391 Ga0070702_100006565
392 Ga0068852_100183041
393 Ga0068852_100220376
394 Ga0068864_100445251
395 Ga0068861_100036227
396 Ga0068861_100081473
397 Ga0068851_10106897
398 Ga0068863_100229068
399 Ga0068858_100075030
400 Ga0068860_100036097
401 Ga0068862_100044513
402 Ga0081455_10150083
403 Ga0070717_10009038
404 Ga0070717_10017320
405 Ga0075364_10010194
406 Ga0097621_100010501
407 Ga0097621_100016250
408 Ga0097621_100017760
409 Ga0097621_100017978
410 Ga0097621_100078382
411 Ga0097621_100083185
412 Ga0068871_100003518
413 Ga0068871_100019215
414 Ga0068871_100020797
415 Ga0068871_100038704
416 Ga0068871_100043078
417 Ga0075430_100046834
418 Ga0075431_100002583
419 Ga0075431_100021085
420 Ga0075433_10023444
421 Ga0075434_100031224
422 Ga0075434_100255258
423 Ga0075429_100048738
424 Ga0068865_100003883
425 Ga0068865_100010064
426 Ga0068865_100065040
427 Ga0075436_100008769
428 Ga0075436_100026717
429 Ga0105240_10001076
430 Ga0105240_10004907
431 Ga0105240_10046167
432 Ga0105240_10120383
433 Ga0105240_10211962
434 Ga0105240_10290764
435 Ga0111539_10017492
436 Ga0105245_10001237
437 Ga0105245_10011154
438 Ga0105245_10133102
439 Ga0105245_10189253
440 Ga0114129_10008454
441 Ga0114129_10008520
442 Ga0114129_10009041
443 Ga0114129_10009110
444 Ga0114129_10023603
445 Ga0114129_10027772
446 Ga0105243_10047632
447 Ga0105243_10081118
448 Ga0105243_10099789
449 Ga0105241_10108675
450 Ga0105242_10045687
451 Ga0105248_10008820
452 Ga0105248_10017615
453 Ga0105248_10059912
454 Ga0105248_10140581
455 Ga0105248_10227668
456 Ga0105237_10005295
457 Ga0105237_10007797
458 Ga0105237_10070889
459 Ga0105238_10003566
460 Ga0105238_10017871
461 Ga0105238_10019925
462 Ga0105238_10063283
463 Ga0105238_10064246
464 Ga0105239_10002596
465 Ga0105239_10040540
466 Ga0105239_10234850
467 Ga0157370_10003781
468 Ga0157370_10016716
469 Ga0157370_10284566
470 Ga0157369_10007427
471 Ga0157369_10050534
472 Ga0157369_10302815
473 Ga0157378_10333131
474 Ga0163162_10100725
475 Ga0163162_10479608
476 Ga0157372_10024476
477 Ga0157372_10024656
478 Ga0157372_10037414
479 Ga0157375_10260147
480 Ga0157375_10306139
481 Ga0157375_10320689
482 Ga0163163_10027160
483 Ga0163163_10049979
484 Ga0163163_10101563
485 Ga0163163_10387592
486 Ga0157380_10177193
487 Ga0157379_10047899
488 Ga0157376_10008847
489 Ga0157376_10102643
490 Ga0163161_10169365
491 Ga0213875_10000689
492 Ga0207647_10003331
493 Ga0207699_10072887
494 Ga0207645_10001932
495 Ga0207684_10294052
496 Ga0207707_10000998
497 Ga0207707_10059576
498 Ga0207707_10241184
499 Ga0207695_10004446
500 Ga0207695_10009172
501 Ga0207695_10086279
502 Ga0207671_10043076
503 Ga0207671_10083094
504 Ga0207660_10089815
505 Ga0207657_10033015
506 Ga0207652_10022881
507 Ga0207652_10050367
508 Ga0207652_10060557
509 Ga0207681_10302888
510 Ga0207694_10031223
511 Ga0207694_10098737
512 Ga0207694_10222942
513 Ga0207687_10001836
514 Ga0207687_10002801
515 Ga0207687_10006714
516 Ga0207687_10010055
517 Ga0207644_10073387
518 Ga0207706_10148530
519 Ga0207686_10010546
520 Ga0207686_10016297
521 Ga0207686_10066778
522 Ga0207709_10121248
523 Ga0207669_10042270
524 Ga0207704_10001994
525 Ga0207704_10012540
526 Ga0207711_10009709
527 Ga0207711_10042304
528 Ga0207711_10118835
529 Ga0207711_10196823
530 Ga0207689_10099254
531 Ga0207689_10105113
532 Ga0207661_10012280
533 Ga0207661_10031196
534 Ga0207661_10043716
535 Ga0207667_10000776
536 Ga0207667_10001792
537 Ga0207667_10018117
538 Ga0207667_10096659
539 Ga0207667_10238570
540 Ga0207651_10235614
541 Ga0207651_10381293
542 Ga0207703_10075068
543 Ga0207703_10220005
544 Ga0207708_10000478
545 Ga0207708_10219413
546 Ga0207702_10028019
547 Ga0207641_10228249
548 Ga0207641_10314870
549 Ga0207648_10014310
550 Ga0207648_10018933
551 Ga0207648_10039178
552 Ga0207648_10233840
553 Ga0207676_10186555
554 Ga0207674_10000329
555 Ga0207674_10008683
556 Ga0207675_100000955
557 Ga0207675_100103356
558 Ga0207683_10032470
559 Ga0207698_10022142
560 Ga0207428_10231439
561 Ga0268266_10012450
562 Ga0268265_10028816
563 Ga0268264_10037230
564 Ga0268264_10096747
565 Ga0265332_10013708
566 Ga0265325_10104548
567 Ga0265331_10028366
568 Ga0265316_10000993
569 Ga0265314_10003083
570 Ga0265314_10021510
571 Ga0265342_10034909
572 Ga0316577_10003552
573 Ga0373944_0052399
574 Ga0373936_0081296
575 Ga0373954_0001549
576 Ga0373954_0037400
577 Ga0373957_0058938
578 Ga0373957_0072690
579 Ga0373943_0018616
580 Ga0373955_0045496
581 Ga0373924_0009201
582 Ga0373924_0062036
583 Ga0373935_0015089
584 Ga0373935_0045252
585 Ga0373927_0086866
586 Ga0373933_0057645
587 Ga0373947_0035967
588 Ga0373937_0003982
589 Ga0373937_0028263
590 Ga0373937_0071153
591 Ga0373937_0164359
592 Ga0373937_0414393
593 Ga0316582_0045902
594 Ga0316584_0005050
595 Ga0373925_0188852
596 Ga0436364_0890864
597 Ga0436364_0949563
598 Ga0436364_1169042
599 Ga0436362_0486690
600 Ga0451576_0119725
601 Ga0495629_0044358
602 Ga0495580_0013629
603 Ga0495580_0122856
604 Ga0495582_0006934
605 Ga0495582_0036858
606 Ga0495594_0141463
607 Ga0495608_0018855
608 Ga0495630_0016281
609 Ga0495652_0058292
610 Ga0495652_0274301
611 Ga0495586_0061652
612 Ga0495587_0013555
613 Ga0495645_0025612
614 Ga0495635_0092185
615 Ga0495657_0063002
616 Ga0495599_0020075
617 Ga0495646_0088621
618 Ga0495647_0054227
619 Ga0495658_0004639
620 Ga0495669_0001403
621 Ga0495613_0020566
622 Ga0495649_0074539
623 Ga0495604_0007292
624 Ga0495680_0172642
625 Ga0495675_0102039
626 Ga0495684_0000418
627 Ga0495684_0029066
628 Ga0495684_0079886
629 Ga0495602_0022574
630 Ga0496104_0180192
631 Ga0496104_0197070
632 Ga0496104_0231341
633 Ga0496104_0425236
634 Ga0496105_0150121
635 Ga0496110_0164486
636 Ga0496115_0051654
637 Ga0501068_0153312
638 Ga0501069_0053756
639 nmdc:mga00v17_25020_c1
640 nmdc:mga05p37_117190_c1
641 nmdc:mga05p37_3094_c1
642 nmdc:mga05p37_43509_c1
643 nmdc:mga05p37_71884_c1
644 nmdc:mga05p37_77147_c1
645 nmdc:mga05p37_8061_c1
646 nmdc:mga09592_65285_c1
647 nmdc:mga0qj67_220739_c1
648 nmdc:mga0qj67_36780_c1
649 nmdc:mga06r32_10428_c1
650 nmdc:mga06r32_67520_c1
651 nmdc:mga08y16_47850_c1
652 nmdc:mga0n895_230440_c1
653 nmdc:mga0n895_286468_c1
654 nmdc:mga0n895_50464_c1
655 nmdc:mga08x19_123296_c1
656 nmdc:mga08x19_17234_c1
657 nmdc:mga08x19_47502_c1
658 nmdc:mga0a205_50426_c2
659 Ga0495601_0015368
660 Ga0495601_0032008
661 Ga0495612_0030995
662 Ga0495619_0143238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

7

69

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

124

317

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9595 5 69
8glv-assembly1.cif.gz_KA 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.9487 5 69
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9481 3 65
7jtk-assembly1.cif.gz_y radial spoke 1 isolated from chlamydomonas reinhardtii 0.9453 5 69
5vso-assembly1.cif.gz_A nmr structure of ydj1 j-domain, a cytosolic hsp40 from saccharomyces cerevisiae 0.9401 5 70
ID Description Score Start End Superfamily
af_P87239_357_466_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9854 234 323 2.60.260.20
af_Q2FXZ3_261_371_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9679 235 325 2.60.260.20
af_I1LNJ9_332_440_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9663 234 325 2.60.260.20
af_P9WNV7_256_367_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9641 234 323 2.60.260.20
af_Q8CHS2_271_339_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9589 6 59 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A382M3G8-F1-model_v4 J domain-containing protein 0.9814 1 74 GO:0005634
GO:0005737
GO:0044183
GO:0051082
GO:0051087
GO:0061077
AF-A0A6V8NMM0-F1-model_v4 Molecular chaperone DnaJ 0.9797 221 309 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A7S1DXB1-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.9763 247 323 GO:0006457
GO:0051082
AF-A0A5N9GSS3-F1-model_v4 J domain-containing protein 0.9721 239 325 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A645IHY1-F1-model_v4 Chaperone protein DnaJ 0.971 238 323 GO:0005737
GO:0042026
GO:0051082
GO:0051085

Map