F410526
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 331 | 192 | 309 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300025304|Ga0209257_1000180|Ga0209257_100018088 |
| Length | 187 |
| Sequence | VSIETLEWIAAAVSIAAVWLTARRHLLGWPVGLVSVALYAGVFIDARLYSDALLQGAFAGFIVYGWWRWKANLGNDGRVRIAPLRAAVMCRDLGVGAVGALALGAAMHTWTDAALPLTAFSLVAQWWQGRRHVAAWWLWIVVDVIYIGLYLYKSLNVTAALYLGLVGLAIMGLQQWRRANAQPAAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 3 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 9 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 10 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 11 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 12 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 13 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 14 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 15 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 16 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 17 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 18 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 19 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 20 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 21 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 22 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 25 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 26 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 123 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 124 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 125 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 166 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 167 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 168 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 190 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 191 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 192 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.45 |
| Metatranscriptomes | 0.91 |
| Isolates | 6.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.06 |
| Nodule | 0 |
| Rhizoplane | 2.11 |
| Rhizosphere | 72.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10025052 | 3300001979 | Bacteria | 2016 |
| 2 | JGI25162J39368_1001179 | 3300002737 | Bacteria | 15455 |
| 3 | JGI25162J39368_1002482 | 3300002737 | Bacteria | 7105 |
| 4 | JGI25157J39369_1002755 | 3300002741 | Bacteria | 4031 |
| 5 | JGI25164J39214_1000560 | 3300002772 | Bacteria | 16884 |
| 6 | JGI25164J39214_1000693 | 3300002772 | Bacteria | 13136 |
| 7 | JGI25165J46597_1000873 | 3300003214 | Bacteria | 21443 |
| 8 | JGI25165J46597_1007593 | 3300003214 | Bacteria | 1781 |
| 9 | rootH2_10126653 | 3300003320 | Bacteria | 2893 |
| 10 | Ga0006562J51391_1030997 | 3300003578 | Bacteria | 3060 |
| 11 | Ga0006562J51391_1030998 | 3300003578 | Bacteria | 1827 |
| 12 | Ga0055542_1015591 | 3300003762 | Bacteria | 1217 |
| 13 | Ga0055531_10017112 | 3300003794 | Bacteria | 3080 |
| 14 | Ga0055543_1019290 | 3300004625 | Bacteria | 1263 |
| 15 | Ga0065165_1000205 | 3300005262 | Bacteria | 102670 |
| 16 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 17 | Ga0070680_100035096 | 3300005336 | Bacteria | 4048 |
| 18 | Ga0070660_100047207 | 3300005339 | Bacteria | 3303 |
| 19 | Ga0070660_100075988 | 3300005339 | Bacteria | 2630 |
| 20 | Ga0070660_100207614 | 3300005339 | Bacteria | 1590 |
| 21 | Ga0070660_100724651 | 3300005339 | Bacteria | 834 |
| 22 | Ga0070661_100015213 | 3300005344 | Bacteria | 5430 |
| 23 | Ga0070661_100022555 | 3300005344 | Bacteria | 4507 |
| 24 | Ga0070661_100023750 | 3300005344 | Bacteria | 4397 |
| 25 | Ga0070668_100249098 | 3300005347 | Bacteria | 1474 |
| 26 | Ga0070659_100003891 | 3300005366 | Bacteria | 10637 |
| 27 | Ga0070659_100137495 | 3300005366 | Bacteria | 1987 |
| 28 | Ga0070714_100000280 | 3300005435 | Bacteria | 39190 |
| 29 | Ga0070714_100468299 | 3300005435 | Bacteria | 1198 |
| 30 | Ga0070713_100007533 | 3300005436 | Bacteria | 7649 |
| 31 | Ga0070710_10028694 | 3300005437 | Bacteria | 2978 |
| 32 | Ga0070710_10434076 | 3300005437 | Bacteria | 887 |
| 33 | Ga0070662_100072448 | 3300005457 | Bacteria | 2543 |
| 34 | Ga0070681_10011726 | 3300005458 | Bacteria | 8684 |
| 35 | Ga0070681_10017794 | 3300005458 | Bacteria | 7100 |
| 36 | Ga0070679_100174486 | 3300005530 | Bacteria | 2122 |
| 37 | Ga0068853_100120100 | 3300005539 | Bacteria | 2343 |
| 38 | Ga0068853_100143773 | 3300005539 | Bacteria | 2142 |
| 39 | Ga0068853_100436386 | 3300005539 | Bacteria | 1230 |
| 40 | Ga0070696_100272920 | 3300005546 | Bacteria | 1286 |
| 41 | Ga0070693_100043727 | 3300005547 | Bacteria | 2531 |
| 42 | Ga0070665_100083842 | 3300005548 | Bacteria | 3192 |
| 43 | Ga0070665_100257454 | 3300005548 | Bacteria | 1746 |
| 44 | Ga0068855_101245491 | 3300005563 | Bacteria | 772 |
| 45 | Ga0068857_100085379 | 3300005577 | Bacteria | 2821 |
| 46 | Ga0068854_100273960 | 3300005578 | Bacteria | 1356 |
| 47 | Ga0068856_100204846 | 3300005614 | Bacteria | 1987 |
| 48 | Ga0068858_100906016 | 3300005842 | Bacteria | 862 |
| 49 | Ga0068860_100211537 | 3300005843 | Bacteria | 1881 |
| 50 | Ga0070712_100162213 | 3300006175 | Bacteria | 1727 |
| 51 | Ga0070712_100297053 | 3300006175 | Bacteria | 1306 |
| 52 | Ga0075369_10045539 | 3300006186 | Bacteria | 1887 |
| 53 | Ga0105247_10001155 | 3300009101 | Bacteria | 19591 |
| 54 | Ga0105241_10316405 | 3300009174 | Bacteria | 1344 |
| 55 | Ga0105237_10143430 | 3300009545 | Bacteria | 2383 |
| 56 | Ga0105237_10538095 | 3300009545 | Bacteria | 1175 |
| 57 | Ga0105238_10002982 | 3300009551 | Bacteria | 16898 |
| 58 | Ga0105238_10587492 | 3300009551 | Bacteria | 1121 |
| 59 | Ga0105239_10002546 | 3300010375 | Bacteria | 23137 |
| 60 | Ga0105239_10095443 | 3300010375 | Bacteria | 3285 |
| 61 | Ga0157373_10159776 | 3300013100 | Bacteria | 1586 |
| 62 | Ga0157371_10009296 | 3300013102 | Bacteria | 7749 |
| 63 | Ga0157370_10001232 | 3300013104 | Bacteria | 32075 |
| 64 | Ga0157370_10035330 | 3300013104 | Bacteria | 4859 |
| 65 | Ga0157370_10189473 | 3300013104 | Bacteria | 1909 |
| 66 | Ga0157370_10222207 | 3300013104 | Bacteria | 1749 |
| 67 | Ga0157369_10007244 | 3300013105 | Bacteria | 12768 |
| 68 | Ga0163162_10000378 | 3300013306 | Bacteria | 40518 |
| 69 | Ga0163162_11500590 | 3300013306 | Bacteria | 768 |
| 70 | Ga0157372_10083203 | 3300013307 | Bacteria | 3625 |
| 71 | Ga0157372_10209494 | 3300013307 | Bacteria | 2259 |
| 72 | Ga0182008_10001715 | 3300014497 | Bacteria | 14386 |
| 73 | Ga0182008_10009921 | 3300014497 | Bacteria | 5119 |
| 74 | Ga0182008_10041186 | 3300014497 | Bacteria | 2304 |
| 75 | Ga0182008_10057414 | 3300014497 | Bacteria | 1922 |
| 76 | Ga0182008_10062708 | 3300014497 | Bacteria | 1831 |
| 77 | Ga0182008_10118388 | 3300014497 | Bacteria | 1315 |
| 78 | Ga0182006_1000171 | 3300015261 | Bacteria | 68591 |
| 79 | Ga0182006_1000185 | 3300015261 | Bacteria | 64803 |
| 80 | Ga0182006_1048282 | 3300015261 | Bacteria | 1647 |
| 81 | Ga0182007_10002300 | 3300015262 | Bacteria | 9607 |
| 82 | Ga0182007_10021106 | 3300015262 | Bacteria | 2318 |
| 83 | Ga0182007_10032314 | 3300015262 | Bacteria | 1778 |
| 84 | Ga0182007_10077663 | 3300015262 | Bacteria | 1089 |
| 85 | Ga0182005_1000044 | 3300015265 | Bacteria | 139973 |
| 86 | Ga0182005_1004131 | 3300015265 | Bacteria | 4746 |
| 87 | Ga0182005_1007486 | 3300015265 | Bacteria | 3272 |
| 88 | Ga0182005_1017554 | 3300015265 | Bacteria | 1981 |
| 89 | Ga0183369_1006 | 3300015685 | Bacteria | 449058 |
| 90 | Ga0163161_10000436 | 3300017792 | Bacteria | 34952 |
| 91 | Ga0163161_10009397 | 3300017792 | Bacteria | 6771 |
| 92 | Ga0206353_11619863 | 3300020082 | Bacteria | 1864 |
| 93 | Ga0209674_100757 | 3300025226 | Bacteria | 10941 |
| 94 | Ga0209147_112711 | 3300025229 | Bacteria | 896 |
| 95 | Ga0207427_100069 | 3300025231 | Bacteria | 161547 |
| 96 | Ga0207427_100249 | 3300025231 | Bacteria | 42568 |
| 97 | Ga0209437_100139 | 3300025233 | Bacteria | 172506 |
| 98 | Ga0209437_100154 | 3300025233 | Bacteria | 153383 |
| 99 | Ga0209437_101036 | 3300025233 | Bacteria | 9363 |
| 100 | Ga0209026_1000270 | 3300025250 | Bacteria | 62482 |
| 101 | Ga0209148_1001867 | 3300025254 | Bacteria | 8754 |
| 102 | Ga0209759_1028471 | 3300025256 | Bacteria | 1136 |
| 103 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 104 | Ga0209233_1000092 | 3300025261 | Bacteria | 308668 |
| 105 | Ga0209233_1000191 | 3300025261 | Bacteria | 127938 |
| 106 | Ga0209050_1051320 | 3300025298 | Bacteria | 1041 |
| 107 | Ga0207426_1029039 | 3300025302 | Bacteria | 1829 |
| 108 | Ga0209257_1000180 | 3300025304 | Bacteria | 158090 |
| 109 | Ga0207692_10119523 | 3300025898 | Bacteria | 1473 |
| 110 | Ga0207710_10005067 | 3300025900 | Bacteria | 5706 |
| 111 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 112 | Ga0207647_10000013 | 3300025904 | Bacteria | 144052 |
| 113 | Ga0207647_10000724 | 3300025904 | Bacteria | 25874 |
| 114 | Ga0207705_10010226 | 3300025909 | Bacteria | 6826 |
| 115 | Ga0207705_10072596 | 3300025909 | Bacteria | 2496 |
| 116 | Ga0207654_10260815 | 3300025911 | Bacteria | 1165 |
| 117 | Ga0207707_10096907 | 3300025912 | Bacteria | 2577 |
| 118 | Ga0207707_10124653 | 3300025912 | Bacteria | 2253 |
| 119 | Ga0207693_10080045 | 3300025915 | Bacteria | 2558 |
| 120 | Ga0207660_10735105 | 3300025917 | Bacteria | 805 |
| 121 | Ga0207657_10040131 | 3300025919 | Bacteria | 4150 |
| 122 | Ga0207657_10058836 | 3300025919 | Bacteria | 3305 |
| 123 | Ga0207657_10058991 | 3300025919 | Bacteria | 3300 |
| 124 | Ga0207649_10093651 | 3300025920 | Bacteria | 1972 |
| 125 | Ga0207649_10476574 | 3300025920 | Bacteria | 946 |
| 126 | Ga0207652_10302706 | 3300025921 | Bacteria | 1443 |
| 127 | Ga0207694_10003832 | 3300025924 | Bacteria | 11893 |
| 128 | Ga0207694_10032836 | 3300025924 | Bacteria | 3975 |
| 129 | Ga0207694_10065299 | 3300025924 | Bacteria | 2837 |
| 130 | Ga0207694_10347689 | 3300025924 | Bacteria | 1227 |
| 131 | Ga0207700_10040360 | 3300025928 | Bacteria | 3406 |
| 132 | Ga0207664_10000270 | 3300025929 | Bacteria | 39107 |
| 133 | Ga0207664_10000711 | 3300025929 | Bacteria | 22659 |
| 134 | Ga0207664_10686843 | 3300025929 | Bacteria | 920 |
| 135 | Ga0207690_10001124 | 3300025932 | Bacteria | 17086 |
| 136 | Ga0207690_10002402 | 3300025932 | Bacteria | 11339 |
| 137 | Ga0207690_10003467 | 3300025932 | Bacteria | 9409 |
| 138 | Ga0207690_10009543 | 3300025932 | Bacteria | 5764 |
| 139 | Ga0207690_10113631 | 3300025932 | Bacteria | 1954 |
| 140 | Ga0207690_10138863 | 3300025932 | Bacteria | 1788 |
| 141 | Ga0207706_10006690 | 3300025933 | Bacteria | 10660 |
| 142 | Ga0207667_10003499 | 3300025949 | Bacteria | 19405 |
| 143 | Ga0207667_10361682 | 3300025949 | Bacteria | 1480 |
| 144 | Ga0207640_10272550 | 3300025981 | Bacteria | 1325 |
| 145 | Ga0207639_10482882 | 3300026041 | Bacteria | 1129 |
| 146 | Ga0207639_10694407 | 3300026041 | Bacteria | 944 |
| 147 | Ga0207678_10175728 | 3300026067 | Bacteria | 1829 |
| 148 | Ga0207678_11081136 | 3300026067 | Bacteria | 710 |
| 149 | Ga0207702_10307042 | 3300026078 | Bacteria | 1507 |
| 150 | Ga0207674_10031918 | 3300026116 | Bacteria | 5529 |
| 151 | Ga0268266_10000021 | 3300028379 | Bacteria | 522453 |
| 152 | Ga0268265_10536728 | 3300028380 | Bacteria | 1108 |
| 153 | Ga0265332_10202918 | 3300031238 | Bacteria | 823 |
| 154 | Ga0307412_10000497 | 3300031911 | Bacteria | 23444 |
| 155 | Ga0307510_10001447 | 3300033180 | Bacteria | 26132 |
| 156 | Ga0395899_0068931 | 3300037312 | Bacteria | 2592 |
| 157 | Ga0395900_0248597 | 3300037418 | Bacteria | 1780 |
| 158 | Ga0395898_0042928 | 3300037466 | Bacteria | 4459 |
| 159 | Ga0395901_0012286 | 3300038443 | Bacteria | 8690 |
| 160 | Ga0395901_0033929 | 3300038443 | Bacteria | 5270 |
| 161 | Ga0395901_0230493 | 3300038443 | Bacteria | 1933 |
| 162 | Ga0395901_0279226 | 3300038443 | Bacteria | 1736 |
| 163 | Ga0395901_0290664 | 3300038443 | Bacteria | 1696 |
| 164 | Ga0439436_0000005 | 3300041404 | Bacteria | 168483 |
| 165 | Ga0439465_0000093 | 3300041413 | Bacteria | 20099 |
| 166 | Ga0451793_0502584 | 3300041452 | Bacteria | 1579 |
| 167 | Ga0451795_0274230 | 3300041456 | Bacteria | 706 |
| 168 | Ga0451795_0473239 | 3300041456 | Bacteria | 1561 |
| 169 | Ga0450908_000006 | 3300042184 | Bacteria | 56117 |
| 170 | Ga0439459_0001414 | 3300042438 | Bacteria | 3524 |
| 171 | Ga0466982_0000027 | 3300044672 | Bacteria | 62332 |
| 172 | Ga0466968_0000448 | 3300044735 | Bacteria | 13870 |
| 173 | Ga0466957_0301321 | 3300044842 | Bacteria | 1077 |
| 174 | Ga0495617_000058 | 3300046452 | Bacteria | 100393 |
| 175 | Ga0495617_002617 | 3300046452 | Bacteria | 7044 |
| 176 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 177 | Ga0495638_0000536 | 3300046460 | Bacteria | 43871 |
| 178 | Ga0495638_0013597 | 3300046460 | Bacteria | 5533 |
| 179 | Ga0495650_0000564 | 3300046471 | Bacteria | 52182 |
| 180 | Ga0495650_0012948 | 3300046471 | Bacteria | 4448 |
| 181 | Ga0495650_0018109 | 3300046471 | Bacteria | 3511 |
| 182 | Ga0495605_0044210 | 3300046474 | Bacteria | 2204 |
| 183 | Ga0495584_0001814 | 3300046491 | Bacteria | 12391 |
| 184 | Ga0495585_0000683 | 3300046492 | Bacteria | 30903 |
| 185 | Ga0495607_0000038 | 3300046501 | Bacteria | 134124 |
| 186 | Ga0495607_0000196 | 3300046501 | Bacteria | 63991 |
| 187 | Ga0495607_0004741 | 3300046501 | Bacteria | 9940 |
| 188 | Ga0495607_0009788 | 3300046501 | Bacteria | 6472 |
| 189 | Ga0495583_0044142 | 3300046506 | Bacteria | 2070 |
| 190 | Ga0495606_0000222 | 3300046507 | Bacteria | 100766 |
| 191 | Ga0495606_0003796 | 3300046507 | Bacteria | 15696 |
| 192 | Ga0495606_0005641 | 3300046507 | Bacteria | 11865 |
| 193 | Ga0495606_0435782 | 3300046507 | Bacteria | 674 |
| 194 | Ga0495610_0002520 | 3300046512 | Bacteria | 15285 |
| 195 | Ga0495610_0010726 | 3300046512 | Bacteria | 5667 |
| 196 | Ga0495616_0000056 | 3300046513 | Bacteria | 101901 |
| 197 | Ga0495616_0014376 | 3300046513 | Bacteria | 4431 |
| 198 | Ga0495616_0028624 | 3300046513 | Bacteria | 2949 |
| 199 | Ga0495620_0000479 | 3300046515 | Bacteria | 25982 |
| 200 | Ga0495631_0000120 | 3300046518 | Bacteria | 52656 |
| 201 | Ga0495631_0000595 | 3300046518 | Bacteria | 23959 |
| 202 | Ga0495631_0085947 | 3300046518 | Bacteria | 1355 |
| 203 | Ga0495632_0006581 | 3300046519 | Bacteria | 7438 |
| 204 | Ga0495632_0022289 | 3300046519 | Bacteria | 3397 |
| 205 | Ga0495632_0041723 | 3300046519 | Bacteria | 2304 |
| 206 | Ga0495637_0019340 | 3300046520 | Bacteria | 3151 |
| 207 | Ga0495648_0001431 | 3300046524 | Bacteria | 23362 |
| 208 | Ga0495648_0019624 | 3300046524 | Bacteria | 4743 |
| 209 | Ga0495609_0019473 | 3300046538 | Bacteria | 3140 |
| 210 | Ga0495668_0048165 | 3300046616 | Bacteria | 2364 |
| 211 | Ga0495611_0000034 | 3300046648 | Bacteria | 103287 |
| 212 | Ga0495611_0000078 | 3300046648 | Bacteria | 68937 |
| 213 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 214 | Ga0495625_0001745 | 3300046660 | Bacteria | 25143 |
| 215 | Ga0495625_0006208 | 3300046660 | Bacteria | 10702 |
| 216 | Ga0495625_0074287 | 3300046660 | Bacteria | 2382 |
| 217 | Ga0495661_0001142 | 3300046665 | Bacteria | 23194 |
| 218 | Ga0495670_0000166 | 3300046691 | Bacteria | 28919 |
| 219 | Ga0495670_0001707 | 3300046691 | Bacteria | 10801 |
| 220 | Ga0495671_0001575 | 3300046692 | Bacteria | 15099 |
| 221 | Ga0495649_0004145 | 3300046694 | Bacteria | 9518 |
| 222 | Ga0495589_0000192 | 3300046794 | Bacteria | 53416 |
| 223 | Ga0495660_0000156 | 3300046810 | Bacteria | 74271 |
| 224 | Ga0495660_0000273 | 3300046810 | Bacteria | 48544 |
| 225 | Ga0495683_0001529 | 3300047323 | Bacteria | 14997 |
| 226 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 227 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 228 | Ga0495673_0000127 | 3300047469 | Bacteria | 140402 |
| 229 | Ga0495673_0001542 | 3300047469 | Bacteria | 18120 |
| 230 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 231 | Ga0495686_0000375 | 3300047472 | Bacteria | 71924 |
| 232 | Ga0495686_0006156 | 3300047472 | Bacteria | 9277 |
| 233 | Ga0495686_0010873 | 3300047472 | Bacteria | 6445 |
| 234 | Ga0495686_0082974 | 3300047472 | Bacteria | 1955 |
| 235 | Ga0496100_0036036 | 3300048903 | Bacteria | 3117 |
| 236 | Ga0496101_0000359 | 3300048904 | Bacteria | 30569 |
| 237 | Ga0496102_0475759 | 3300048905 | Bacteria | 1170 |
| 238 | Ga0496106_0020189 | 3300048909 | Bacteria | 4943 |
| 239 | Ga0496117_0010477 | 3300048920 | Bacteria | 8441 |
| 240 | Ga0496117_0069099 | 3300048920 | Bacteria | 2381 |
| 241 | Ga0496118_0000714 | 3300048921 | Bacteria | 53628 |
| 242 | Ga0496118_0013920 | 3300048921 | Bacteria | 7564 |
| 243 | Ga0496121_0000829 | 3300048924 | Bacteria | 56313 |
| 244 | Ga0496121_0001307 | 3300048924 | Bacteria | 42738 |
| 245 | Ga0496121_0005297 | 3300048924 | Bacteria | 16603 |
| 246 | Ga0496121_0221536 | 3300048924 | Bacteria | 1332 |
| 247 | Ga0496121_0222434 | 3300048924 | Bacteria | 1328 |
| 248 | Ga0496121_0400992 | 3300048924 | Bacteria | 898 |
| 249 | Ga0496122_0005001 | 3300048925 | Bacteria | 16035 |
| 250 | Ga0496122_0085900 | 3300048925 | Bacteria | 2168 |
| 251 | Ga0496122_0091045 | 3300048925 | Bacteria | 2078 |
| 252 | Ga0496123_0001582 | 3300048926 | Bacteria | 30970 |
| 253 | Ga0496123_0006858 | 3300048926 | Bacteria | 10908 |
| 254 | Ga0496123_0025108 | 3300048926 | Bacteria | 4502 |
| 255 | Ga0496123_0077717 | 3300048926 | Bacteria | 2037 |
| 256 | Ga0496123_0191822 | 3300048926 | Bacteria | 1056 |
| 257 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 258 | Ga0496124_0000381 | 3300048927 | Bacteria | 81000 |
| 259 | Ga0496124_0001381 | 3300048927 | Bacteria | 36365 |
| 260 | Ga0496124_0035336 | 3300048927 | Bacteria | 4373 |
| 261 | Ga0496125_0002397 | 3300048928 | Bacteria | 24412 |
| 262 | Ga0496126_0032185 | 3300048929 | Bacteria | 4944 |
| 263 | Ga0496126_0330734 | 3300048929 | Bacteria | 1250 |
| 264 | Ga0496126_0849363 | 3300048929 | Bacteria | 696 |
| 265 | Ga0495678_000026 | 3300049459 | Bacteria | 226978 |
| 266 | Ga0495682_0005563 | 3300049460 | Bacteria | 5215 |
| 267 | Ga0495682_0007157 | 3300049460 | Bacteria | 4457 |
| 268 | Ga0501031_0044889 | 3300049568 | Bacteria | 2884 |
| 269 | Ga0501031_0086048 | 3300049568 | Bacteria | 2049 |
| 270 | Ga0501031_0126489 | 3300049568 | Bacteria | 1669 |
| 271 | Ga0501032_0017089 | 3300049569 | Bacteria | 5098 |
| 272 | Ga0501032_0242629 | 3300049569 | Bacteria | 1170 |
| 273 | Ga0501033_0000626 | 3300049570 | Bacteria | 32770 |
| 274 | Ga0501033_0000932 | 3300049570 | Bacteria | 26712 |
| 275 | Ga0501034_0382474 | 3300049571 | Bacteria | 1332 |
| 276 | Ga0501034_0717543 | 3300049571 | Bacteria | 897 |
| 277 | Ga0501034_1177937 | 3300049571 | Bacteria | 645 |
| 278 | Ga0501036_0103940 | 3300049572 | Bacteria | 2402 |
| 279 | Ga0501037_0355698 | 3300049573 | Bacteria | 1009 |
| 280 | Ga0501039_0064803 | 3300049575 | Bacteria | 2833 |
| 281 | Ga0501040_0182705 | 3300049576 | Bacteria | 1487 |
| 282 | Ga0501043_0050215 | 3300049579 | Bacteria | 3279 |
| 283 | Ga0501043_0074781 | 3300049579 | Bacteria | 2661 |
| 284 | Ga0501046_0056960 | 3300049580 | Bacteria | 3066 |
| 285 | Ga0501046_0071679 | 3300049580 | Bacteria | 2691 |
| 286 | Ga0501046_0272483 | 3300049580 | Bacteria | 1241 |
| 287 | Ga0501047_0016740 | 3300049581 | Bacteria | 7004 |
| 288 | Ga0501047_0059060 | 3300049581 | Bacteria | 3703 |
| 289 | Ga0501048_0031467 | 3300049582 | Bacteria | 3838 |
| 290 | Ga0501070_0419888 | 3300049586 | Bacteria | 1080 |
| 291 | Ga0501073_0064544 | 3300049589 | Bacteria | 2554 |
| 292 | Ga0501035_0020208 | 3300049822 | Bacteria | 6115 |
| 293 | Ga0501035_0022786 | 3300049822 | Bacteria | 5751 |
| 294 | Ga0501035_0085647 | 3300049822 | Bacteria | 2777 |
| 295 | Ga0501035_0101634 | 3300049822 | Bacteria | 2523 |
| 296 | Ga0501035_0404599 | 3300049822 | Bacteria | 1135 |
| 297 | Ga0501035_0774742 | 3300049822 | Bacteria | 768 |
| 298 | Ga0501035_0803149 | 3300049822 | Bacteria | 751 |
| 299 | Ga0501044_0031745 | 3300049823 | Bacteria | 5556 |
| 300 | Ga0501044_0044298 | 3300049823 | Bacteria | 4617 |
| 301 | Ga0501044_0083340 | 3300049823 | Bacteria | 3234 |
| 302 | Ga0501044_0101371 | 3300049823 | Bacteria | 2896 |
| 303 | Ga0501044_0237806 | 3300049823 | Bacteria | 1766 |
| 304 | Ga0501044_0864126 | 3300049823 | Bacteria | 781 |
| 305 | nmdc:mga0sz30_216047_c1 | 3300050516 | Bacteria | 852 |
| 306 | Ga0500643_000138 | 3300053087 | Bacteria | 73474 |
| 307 | Ga0500555_000108 | 3300053103 | Bacteria | 39384 |
| 308 | Ga0500633_0093742 | 3300053160 | Bacteria | 1099 |
| 309 | Ga0500645_001061 | 3300053730 | Bacteria | 15232 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0774742 | Ga0501035_0774742_21_545 | 161 |
| 2 | 3300037466 | Ga0395898_0042928 | Ga0395898_0042928_1840_2424 | 165 |
| 3 | 3300038443 | Ga0395901_0033929 | Ga0395901_0033929_1529_2113 | 165 |
| 4 | 3300005339 | Ga0070660_100207614 | Ga0070660_1002076141 | 168 |
| 5 | 3300005366 | Ga0070659_100003891 | Ga0070659_1000038918 | 168 |
| 6 | 3300005458 | Ga0070681_10011726 | Ga0070681_100117262 | 168 |
| 7 | 3300005530 | Ga0070679_100174486 | Ga0070679_1001744862 | 168 |
| 8 | 3300025912 | Ga0207707_10124653 | Ga0207707_101246532 | 168 |
| 9 | 3300025919 | Ga0207657_10040131 | Ga0207657_100401313 | 168 |
| 10 | 3300025932 | Ga0207690_10002402 | Ga0207690_100024028 | 168 |
| 11 | 3300049822 | Ga0501035_0404599 | Ga0501035_0404599_60_659 | 168 |
| 12 | 3300015685 | Ga0183369_1006 | Ga0183369_1006216 | 169 |
| 13 | 3300037418 | Ga0395900_0248597 | Ga0395900_0248597_990_1565 | 172 |
| 14 | 3300038443 | Ga0395901_0230493 | Ga0395901_0230493_216_791 | 172 |
| 15 | 3300049572 | Ga0501036_0103940 | Ga0501036_0103940_541_1125 | 174 |
| 16 | 3300049581 | Ga0501047_0059060 | Ga0501047_0059060_1681_2265 | 174 |
| 17 | 3300049822 | Ga0501035_0803149 | Ga0501035_0803149_13_597 | 174 |
| 18 | 3300049823 | Ga0501044_0083340 | Ga0501044_0083340_536_1120 | 174 |
| 19 | 3300049580 | Ga0501046_0272483 | Ga0501046_0272483_36_635 | 179 |
| 20 | 3300049822 | Ga0501035_0022786 | Ga0501035_0022786_2406_3005 | 179 |
| 21 | 3300049823 | Ga0501044_0044298 | Ga0501044_0044298_1409_2008 | 179 |
| 22 | iso_pu_bacteria | 2643221577 | 2643893983 | 182 |
| 23 | iso_pu_bacteria | 2643221685 | 2644476201 | 182 |
| 24 | 3300013102 | Ga0157371_10009296 | Ga0157371_100092965 | 183 |
| 25 | 3300013104 | Ga0157370_10189473 | Ga0157370_101894731 | 183 |
| 26 | iso_pu_bacteria | 2842780639 | 2842781185 | 184 |
| 27 | 3300003794 | Ga0055531_10017112 | Ga0055531_100171122 | 185 |
| 28 | 3300025298 | Ga0209050_1051320 | Ga0209050_10513202 | 185 |
| 29 | 3300025304 | Ga0209257_1000180 | Ga0209257_100018088 | 185 |
| 30 | 3300049823 | Ga0501044_0237806 | Ga0501044_0237806_162_737 | 185 |
| 31 | iso_pu_bacteria | 2537561836 | 2538833071 | 185 |
| 32 | iso_pu_bacteria | 2643221562 | 2643831537 | 185 |
| 33 | iso_pu_bacteria | 2687453130 | 2687583403 | 185 |
| 34 | iso_pu_bacteria | 2895395659 | 2895396977 | 185 |
| 35 | iso_pu_bacteria | 2939611941 | 2939614235 | 185 |
| 36 | 3300005539 | Ga0068853_100436386 | Ga0068853_1004363862 | 186 |
| 37 | 3300026041 | Ga0207639_10694407 | Ga0207639_106944072 | 186 |
| 38 | 3300049569 | Ga0501032_0017089 | Ga0501032_0017089_1049_1618 | 186 |
| 39 | 3300049571 | Ga0501034_0382474 | Ga0501034_0382474_65_634 | 186 |
| 40 | 3300049580 | Ga0501046_0056960 | Ga0501046_0056960_389_958 | 186 |
| 41 | 3300049822 | Ga0501035_0101634 | Ga0501035_0101634_1051_1620 | 186 |
| 42 | 3300049823 | Ga0501044_0864126 | Ga0501044_0864126_92_661 | 186 |
| 43 | iso_pu_bacteria | 2818991440 | 2819566222 | 186 |
| 44 | iso_pu_bacteria | 2904463128 | 2904466498 | 186 |
| 45 | 3300005547 | Ga0070693_100043727 | Ga0070693_1000437272 | 187 |
| 46 | 3300025233 | Ga0209437_101036 | Ga0209437_1010362 | 187 |
| 47 | 3300025900 | Ga0207710_10005067 | Ga0207710_100050674 | 187 |
| 48 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_199583_200191 | 187 |
| 49 | 3300049579 | Ga0501043_0050215 | Ga0501043_0050215_837_1409 | 187 |
| 50 | 3300003762 | Ga0055542_1015591 | Ga0055542_10155912 | 188 |
| 51 | 3300015265 | Ga0182005_1017554 | Ga0182005_10175542 | 188 |
| 52 | 3300025254 | Ga0209148_1001867 | Ga0209148_10018676 | 188 |
| 53 | 3300041452 | Ga0451793_0502584 | Ga0451793_0502584_26_601 | 188 |
| 54 | 3300041456 | Ga0451795_0274230 | Ga0451795_0274230_32_607 | 188 |
| 55 | 3300042438 | Ga0439459_0001414 | Ga0439459_0001414_1936_2511 | 188 |
| 56 | 3300046452 | Ga0495617_002617 | Ga0495617_002617_1782_2372 | 188 |
| 57 | 3300046460 | Ga0495638_0000536 | Ga0495638_0000536_32201_32791 | 188 |
| 58 | 3300046501 | Ga0495607_0000196 | Ga0495607_0000196_52294_52884 | 188 |
| 59 | 3300046506 | Ga0495583_0044142 | Ga0495583_0044142_1040_1630 | 188 |
| 60 | 3300046513 | Ga0495616_0014376 | Ga0495616_0014376_1285_1875 | 188 |
| 61 | 3300046519 | Ga0495632_0041723 | Ga0495632_0041723_1358_1948 | 188 |
| 62 | 3300046520 | Ga0495637_0019340 | Ga0495637_0019340_1733_2323 | 188 |
| 63 | 3300046538 | Ga0495609_0019473 | Ga0495609_0019473_1658_2248 | 188 |
| 64 | 3300046648 | Ga0495611_0000034 | Ga0495611_0000034_78761_79351 | 188 |
| 65 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_788797_789387 | 188 |
| 66 | 3300046691 | Ga0495670_0001707 | Ga0495670_0001707_5290_5880 | 188 |
| 67 | 3300046692 | Ga0495671_0001575 | Ga0495671_0001575_11107_11697 | 188 |
| 68 | 3300046794 | Ga0495589_0000192 | Ga0495589_0000192_10095_10685 | 188 |
| 69 | 3300046810 | Ga0495660_0000156 | Ga0495660_0000156_50758_51348 | 188 |
| 70 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_11059_11649 | 188 |
| 71 | 3300047469 | Ga0495673_0001542 | Ga0495673_0001542_10057_10647 | 188 |
| 72 | 3300048927 | Ga0496124_0001381 | Ga0496124_0001381_16271_16855 | 188 |
| 73 | 3300049459 | Ga0495678_000026 | Ga0495678_000026_215308_215898 | 188 |
| 74 | 3300049460 | Ga0495682_0005563 | Ga0495682_0005563_4253_4843 | 188 |
| 75 | 3300049568 | Ga0501031_0044889 | Ga0501031_0044889_1470_2045 | 188 |
| 76 | 3300049568 | Ga0501031_0086048 | Ga0501031_0086048_1416_1988 | 188 |
| 77 | 3300049568 | Ga0501031_0126489 | Ga0501031_0126489_220_804 | 188 |
| 78 | 3300049569 | Ga0501032_0242629 | Ga0501032_0242629_139_711 | 188 |
| 79 | 3300049570 | Ga0501033_0000932 | Ga0501033_0000932_3250_3825 | 188 |
| 80 | 3300049571 | Ga0501034_1177937 | Ga0501034_1177937_25_597 | 188 |
| 81 | 3300049573 | Ga0501037_0355698 | Ga0501037_0355698_258_830 | 188 |
| 82 | 3300049575 | Ga0501039_0064803 | Ga0501039_0064803_2177_2749 | 188 |
| 83 | 3300049576 | Ga0501040_0182705 | Ga0501040_0182705_353_925 | 188 |
| 84 | 3300049579 | Ga0501043_0074781 | Ga0501043_0074781_1186_1770 | 188 |
| 85 | 3300049580 | Ga0501046_0071679 | Ga0501046_0071679_544_1116 | 188 |
| 86 | 3300049581 | Ga0501047_0016740 | Ga0501047_0016740_4641_5225 | 188 |
| 87 | 3300049582 | Ga0501048_0031467 | Ga0501048_0031467_3114_3686 | 188 |
| 88 | 3300049586 | Ga0501070_0419888 | Ga0501070_0419888_416_988 | 188 |
| 89 | 3300049589 | Ga0501073_0064544 | Ga0501073_0064544_673_1245 | 188 |
| 90 | 3300049822 | Ga0501035_0020208 | Ga0501035_0020208_4995_5567 | 188 |
| 91 | 3300049822 | Ga0501035_0085647 | Ga0501035_0085647_1437_2021 | 188 |
| 92 | 3300049823 | Ga0501044_0031745 | Ga0501044_0031745_4588_5172 | 188 |
| 93 | 3300049823 | Ga0501044_0101371 | Ga0501044_0101371_2300_2872 | 188 |
| 94 | 3300053087 | Ga0500643_000138 | Ga0500643_000138_21013_21603 | 188 |
| 95 | 3300053103 | Ga0500555_000108 | Ga0500555_000108_8515_9105 | 188 |
| 96 | 3300002737 | JGI25162J39368_1001179 | JGI25162J39368_10011792 | 189 |
| 97 | 3300002737 | JGI25162J39368_1002482 | JGI25162J39368_10024827 | 189 |
| 98 | 3300002741 | JGI25157J39369_1002755 | JGI25157J39369_10027552 | 189 |
| 99 | 3300002772 | JGI25164J39214_1000560 | JGI25164J39214_100056017 | 189 |
| 100 | 3300002772 | JGI25164J39214_1000693 | JGI25164J39214_100069312 | 189 |
| 101 | 3300003214 | JGI25165J46597_1000873 | JGI25165J46597_100087322 | 189 |
| 102 | 3300003214 | JGI25165J46597_1007593 | JGI25165J46597_10075932 | 189 |
| 103 | 3300005336 | Ga0070680_100035096 | Ga0070680_1000350962 | 189 |
| 104 | 3300005339 | Ga0070660_100047207 | Ga0070660_1000472072 | 189 |
| 105 | 3300005339 | Ga0070660_100075988 | Ga0070660_1000759882 | 189 |
| 106 | 3300005339 | Ga0070660_100724651 | Ga0070660_1007246511 | 189 |
| 107 | 3300005344 | Ga0070661_100015213 | Ga0070661_1000152135 | 189 |
| 108 | 3300005366 | Ga0070659_100137495 | Ga0070659_1001374952 | 189 |
| 109 | 3300005435 | Ga0070714_100000280 | Ga0070714_10000028015 | 189 |
| 110 | 3300005435 | Ga0070714_100468299 | Ga0070714_1004682992 | 189 |
| 111 | 3300005436 | Ga0070713_100007533 | Ga0070713_1000075333 | 189 |
| 112 | 3300005437 | Ga0070710_10028694 | Ga0070710_100286943 | 189 |
| 113 | 3300005437 | Ga0070710_10434076 | Ga0070710_104340761 | 189 |
| 114 | 3300005457 | Ga0070662_100072448 | Ga0070662_1000724482 | 189 |
| 115 | 3300005458 | Ga0070681_10017794 | Ga0070681_100177942 | 189 |
| 116 | 3300005539 | Ga0068853_100120100 | Ga0068853_1001201002 | 189 |
| 117 | 3300005539 | Ga0068853_100143773 | Ga0068853_1001437732 | 189 |
| 118 | 3300005546 | Ga0070696_100272920 | Ga0070696_1002729201 | 189 |
| 119 | 3300005563 | Ga0068855_101245491 | Ga0068855_1012454911 | 189 |
| 120 | 3300005577 | Ga0068857_100085379 | Ga0068857_1000853792 | 189 |
| 121 | 3300005578 | Ga0068854_100273960 | Ga0068854_1002739602 | 189 |
| 122 | 3300005614 | Ga0068856_100204846 | Ga0068856_1002048462 | 189 |
| 123 | 3300006175 | Ga0070712_100162213 | Ga0070712_1001622132 | 189 |
| 124 | 3300006175 | Ga0070712_100297053 | Ga0070712_1002970532 | 189 |
| 125 | 3300009174 | Ga0105241_10316405 | Ga0105241_103164052 | 189 |
| 126 | 3300009545 | Ga0105237_10143430 | Ga0105237_101434301 | 189 |
| 127 | 3300009551 | Ga0105238_10587492 | Ga0105238_105874921 | 189 |
| 128 | 3300013100 | Ga0157373_10159776 | Ga0157373_101597762 | 189 |
| 129 | 3300013104 | Ga0157370_10001232 | Ga0157370_100012329 | 189 |
| 130 | 3300013307 | Ga0157372_10083203 | Ga0157372_100832036 | 189 |
| 131 | 3300013307 | Ga0157372_10209494 | Ga0157372_102094942 | 189 |
| 132 | 3300014497 | Ga0182008_10041186 | Ga0182008_100411862 | 189 |
| 133 | 3300014497 | Ga0182008_10057414 | Ga0182008_100574142 | 189 |
| 134 | 3300014497 | Ga0182008_10062708 | Ga0182008_100627081 | 189 |
| 135 | 3300014497 | Ga0182008_10118388 | Ga0182008_101183882 | 189 |
| 136 | 3300015261 | Ga0182006_1048282 | Ga0182006_10482822 | 189 |
| 137 | 3300015262 | Ga0182007_10021106 | Ga0182007_100211061 | 189 |
| 138 | 3300015262 | Ga0182007_10032314 | Ga0182007_100323141 | 189 |
| 139 | 3300015262 | Ga0182007_10077663 | Ga0182007_100776632 | 189 |
| 140 | 3300020082 | Ga0206353_11619863 | Ga0206353_116198632 | 189 |
| 141 | 3300025226 | Ga0209674_100757 | Ga0209674_1007578 | 189 |
| 142 | 3300025231 | Ga0207427_100069 | Ga0207427_100069146 | 189 |
| 143 | 3300025231 | Ga0207427_100249 | Ga0207427_10024928 | 189 |
| 144 | 3300025233 | Ga0209437_100139 | Ga0209437_10013979 | 189 |
| 145 | 3300025233 | Ga0209437_100154 | Ga0209437_10015480 | 189 |
| 146 | 3300025250 | Ga0209026_1000270 | Ga0209026_100027042 | 189 |
| 147 | 3300025256 | Ga0209759_1028471 | Ga0209759_10284712 | 189 |
| 148 | 3300025261 | Ga0209233_1000083 | Ga0209233_1000083146 | 189 |
| 149 | 3300025261 | Ga0209233_1000092 | Ga0209233_1000092209 | 189 |
| 150 | 3300025261 | Ga0209233_1000191 | Ga0209233_100019166 | 189 |
| 151 | 3300025898 | Ga0207692_10119523 | Ga0207692_101195232 | 189 |
| 152 | 3300025904 | Ga0207647_10000724 | Ga0207647_1000072411 | 189 |
| 153 | 3300025909 | Ga0207705_10010226 | Ga0207705_100102262 | 189 |
| 154 | 3300025909 | Ga0207705_10072596 | Ga0207705_100725962 | 189 |
| 155 | 3300025911 | Ga0207654_10260815 | Ga0207654_102608152 | 189 |
| 156 | 3300025912 | Ga0207707_10096907 | Ga0207707_100969072 | 189 |
| 157 | 3300025915 | Ga0207693_10080045 | Ga0207693_100800452 | 189 |
| 158 | 3300025917 | Ga0207660_10735105 | Ga0207660_107351052 | 189 |
| 159 | 3300025919 | Ga0207657_10058836 | Ga0207657_100588364 | 189 |
| 160 | 3300025919 | Ga0207657_10058991 | Ga0207657_100589914 | 189 |
| 161 | 3300025921 | Ga0207652_10302706 | Ga0207652_103027062 | 189 |
| 162 | 3300025924 | Ga0207694_10065299 | Ga0207694_100652992 | 189 |
| 163 | 3300025924 | Ga0207694_10347689 | Ga0207694_103476892 | 189 |
| 164 | 3300025928 | Ga0207700_10040360 | Ga0207700_100403604 | 189 |
| 165 | 3300025929 | Ga0207664_10000270 | Ga0207664_1000027015 | 189 |
| 166 | 3300025929 | Ga0207664_10000711 | Ga0207664_1000071112 | 189 |
| 167 | 3300025929 | Ga0207664_10686843 | Ga0207664_106868432 | 189 |
| 168 | 3300025932 | Ga0207690_10001124 | Ga0207690_100011242 | 189 |
| 169 | 3300025932 | Ga0207690_10003467 | Ga0207690_100034672 | 189 |
| 170 | 3300025932 | Ga0207690_10009543 | Ga0207690_100095434 | 189 |
| 171 | 3300025932 | Ga0207690_10113631 | Ga0207690_101136312 | 189 |
| 172 | 3300025932 | Ga0207690_10138863 | Ga0207690_101388631 | 189 |
| 173 | 3300025933 | Ga0207706_10006690 | Ga0207706_100066902 | 189 |
| 174 | 3300025949 | Ga0207667_10003499 | Ga0207667_1000349915 | 189 |
| 175 | 3300025949 | Ga0207667_10361682 | Ga0207667_103616821 | 189 |
| 176 | 3300025981 | Ga0207640_10272550 | Ga0207640_102725502 | 189 |
| 177 | 3300026041 | Ga0207639_10482882 | Ga0207639_104828822 | 189 |
| 178 | 3300026067 | Ga0207678_11081136 | Ga0207678_110811361 | 189 |
| 179 | 3300026078 | Ga0207702_10307042 | Ga0207702_103070422 | 189 |
| 180 | 3300026116 | Ga0207674_10031918 | Ga0207674_100319183 | 189 |
| 181 | 3300031238 | Ga0265332_10202918 | Ga0265332_102029181 | 189 |
| 182 | 3300037312 | Ga0395899_0068931 | Ga0395899_0068931_166_744 | 189 |
| 183 | 3300038443 | Ga0395901_0012286 | Ga0395901_0012286_1578_2156 | 189 |
| 184 | 3300038443 | Ga0395901_0279226 | Ga0395901_0279226_89_670 | 189 |
| 185 | 3300038443 | Ga0395901_0290664 | Ga0395901_0290664_699_1286 | 189 |
| 186 | 3300049570 | Ga0501033_0000626 | Ga0501033_0000626_12127_12738 | 189 |
| 187 | 3300049571 | Ga0501034_0717543 | Ga0501034_0717543_26_613 | 189 |
| 188 | iso_pu_bacteria | 2593339238 | 2595449065 | 189 |
| 189 | iso_pu_bacteria | 2593339239 | 2595452804 | 189 |
| 190 | iso_pu_bacteria | 2718218334 | 2721025735 | 189 |
| 191 | iso_pu_bacteria | 2734482264 | 2735834290 | 189 |
| 192 | iso_pu_bacteria | 2738543009 | 2739225714 | 189 |
| 193 | iso_pu_bacteria | 2842914999 | 2842917166 | 189 |
| 194 | iso_pu_bacteria | 2842918807 | 2842920723 | 189 |
| 195 | iso_pu_bacteria | 2884338543 | 2884339064 | 189 |
| 196 | iso_pu_bacteria | 2919085039 | 2919086250 | 189 |
| 197 | iso_pu_bacteria | 2919404418 | 2919407837 | 189 |
| 198 | iso_pu_bacteria | 2941471342 | 2941473392 | 189 |
| 199 | iso_pu_bacteria | 2953994433 | 2953996001 | 189 |
| 200 | 3300044735 | Ga0466968_0000448 | Ga0466968_0000448_3122_3703 | 190 |
| 201 | 3300046474 | Ga0495605_0044210 | Ga0495605_0044210_500_1081 | 190 |
| 202 | 3300046501 | Ga0495607_0004741 | Ga0495607_0004741_130_711 | 190 |
| 203 | 3300046513 | Ga0495616_0028624 | Ga0495616_0028624_2289_2870 | 190 |
| 204 | 3300048926 | Ga0496123_0025108 | Ga0496123_0025108_242_820 | 190 |
| 205 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_76037_76618 | 190 |
| 206 | 3300048927 | Ga0496124_0035336 | Ga0496124_0035336_2905_3477 | 190 |
| 207 | 3300003320 | rootH2_10126653 | rootH2_101266532 | 191 |
| 208 | 3300025229 | Ga0209147_112711 | Ga0209147_1127111 | 192 |
| 209 | 3300044672 | Ga0466982_0000027 | Ga0466982_0000027_29808_30389 | 192 |
| 210 | 3300044842 | Ga0466957_0301321 | Ga0466957_0301321_469_1050 | 192 |
| 211 | 3300001979 | JGI24740J21852_10025052 | JGI24740J21852_100250522 | 193 |
| 212 | 3300003578 | Ga0006562J51391_1030997 | Ga0006562J51391_10309971 | 193 |
| 213 | 3300003578 | Ga0006562J51391_1030998 | Ga0006562J51391_10309982 | 193 |
| 214 | 3300004625 | Ga0055543_1019290 | Ga0055543_10192901 | 193 |
| 215 | 3300005262 | Ga0065165_1000205 | Ga0065165_100020523 | 193 |
| 216 | 3300005335 | Ga0070666_10000003 | Ga0070666_10000003246 | 193 |
| 217 | 3300005344 | Ga0070661_100022555 | Ga0070661_1000225552 | 193 |
| 218 | 3300005344 | Ga0070661_100023750 | Ga0070661_1000237505 | 193 |
| 219 | 3300005347 | Ga0070668_100249098 | Ga0070668_1002490982 | 193 |
| 220 | 3300005548 | Ga0070665_100083842 | Ga0070665_1000838422 | 193 |
| 221 | 3300005548 | Ga0070665_100257454 | Ga0070665_1002574542 | 193 |
| 222 | 3300005842 | Ga0068858_100906016 | Ga0068858_1009060162 | 193 |
| 223 | 3300005843 | Ga0068860_100211537 | Ga0068860_1002115372 | 193 |
| 224 | 3300006186 | Ga0075369_10045539 | Ga0075369_100455392 | 193 |
| 225 | 3300009101 | Ga0105247_10001155 | Ga0105247_100011553 | 193 |
| 226 | 3300009545 | Ga0105237_10538095 | Ga0105237_105380951 | 193 |
| 227 | 3300009551 | Ga0105238_10002982 | Ga0105238_100029822 | 193 |
| 228 | 3300010375 | Ga0105239_10002546 | Ga0105239_1000254616 | 193 |
| 229 | 3300010375 | Ga0105239_10095443 | Ga0105239_100954432 | 193 |
| 230 | 3300013104 | Ga0157370_10035330 | Ga0157370_100353303 | 193 |
| 231 | 3300013104 | Ga0157370_10222207 | Ga0157370_102222072 | 193 |
| 232 | 3300013105 | Ga0157369_10007244 | Ga0157369_100072448 | 193 |
| 233 | 3300013306 | Ga0163162_10000378 | Ga0163162_1000037839 | 193 |
| 234 | 3300013306 | Ga0163162_11500590 | Ga0163162_115005901 | 193 |
| 235 | 3300014497 | Ga0182008_10001715 | Ga0182008_100017153 | 193 |
| 236 | 3300014497 | Ga0182008_10009921 | Ga0182008_100099214 | 193 |
| 237 | 3300015261 | Ga0182006_1000171 | Ga0182006_100017132 | 193 |
| 238 | 3300015261 | Ga0182006_1000185 | Ga0182006_100018519 | 193 |
| 239 | 3300015262 | Ga0182007_10002300 | Ga0182007_100023007 | 193 |
| 240 | 3300015265 | Ga0182005_1000044 | Ga0182005_100004443 | 193 |
| 241 | 3300015265 | Ga0182005_1004131 | Ga0182005_10041314 | 193 |
| 242 | 3300015265 | Ga0182005_1007486 | Ga0182005_10074862 | 193 |
| 243 | 3300017792 | Ga0163161_10000436 | Ga0163161_1000043628 | 193 |
| 244 | 3300017792 | Ga0163161_10009397 | Ga0163161_100093974 | 193 |
| 245 | 3300025302 | Ga0207426_1029039 | Ga0207426_10290392 | 193 |
| 246 | 3300025903 | Ga0207680_10000006 | Ga0207680_10000006393 | 193 |
| 247 | 3300025904 | Ga0207647_10000013 | Ga0207647_1000001348 | 193 |
| 248 | 3300025920 | Ga0207649_10093651 | Ga0207649_100936512 | 193 |
| 249 | 3300025920 | Ga0207649_10476574 | Ga0207649_104765742 | 193 |
| 250 | 3300025924 | Ga0207694_10003832 | Ga0207694_100038321 | 193 |
| 251 | 3300025924 | Ga0207694_10032836 | Ga0207694_100328363 | 193 |
| 252 | 3300026067 | Ga0207678_10175728 | Ga0207678_101757282 | 193 |
| 253 | 3300028379 | Ga0268266_10000021 | Ga0268266_10000021431 | 193 |
| 254 | 3300028380 | Ga0268265_10536728 | Ga0268265_105367282 | 193 |
| 255 | 3300031911 | Ga0307412_10000497 | Ga0307412_1000049711 | 193 |
| 256 | 3300033180 | Ga0307510_10001447 | Ga0307510_1000144727 | 193 |
| 257 | 3300041404 | Ga0439436_0000005 | Ga0439436_0000005_133318_133899 | 193 |
| 258 | 3300041413 | Ga0439465_0000093 | Ga0439465_0000093_3675_4256 | 193 |
| 259 | 3300041456 | Ga0451795_0473239 | Ga0451795_0473239_731_1312 | 193 |
| 260 | 3300042184 | Ga0450908_000006 | Ga0450908_000006_25364_25948 | 193 |
| 261 | 3300046452 | Ga0495617_000058 | Ga0495617_000058_78993_79586 | 193 |
| 262 | 3300046460 | Ga0495638_0013597 | Ga0495638_0013597_2297_2878 | 193 |
| 263 | 3300046471 | Ga0495650_0000564 | Ga0495650_0000564_50868_51476 | 193 |
| 264 | 3300046471 | Ga0495650_0012948 | Ga0495650_0012948_3114_3695 | 193 |
| 265 | 3300046471 | Ga0495650_0018109 | Ga0495650_0018109_677_1258 | 193 |
| 266 | 3300046491 | Ga0495584_0001814 | Ga0495584_0001814_4307_4888 | 193 |
| 267 | 3300046492 | Ga0495585_0000683 | Ga0495585_0000683_3846_4427 | 193 |
| 268 | 3300046501 | Ga0495607_0000038 | Ga0495607_0000038_40194_40775 | 193 |
| 269 | 3300046501 | Ga0495607_0009788 | Ga0495607_0009788_3351_3932 | 193 |
| 270 | 3300046507 | Ga0495606_0000222 | Ga0495606_0000222_59948_60529 | 193 |
| 271 | 3300046507 | Ga0495606_0003796 | Ga0495606_0003796_11202_11786 | 193 |
| 272 | 3300046507 | Ga0495606_0005641 | Ga0495606_0005641_3475_4068 | 193 |
| 273 | 3300046507 | Ga0495606_0435782 | Ga0495606_0435782_56_637 | 193 |
| 274 | 3300046512 | Ga0495610_0002520 | Ga0495610_0002520_13717_14298 | 193 |
| 275 | 3300046512 | Ga0495610_0010726 | Ga0495610_0010726_1291_1872 | 193 |
| 276 | 3300046513 | Ga0495616_0000056 | Ga0495616_0000056_40536_41117 | 193 |
| 277 | 3300046515 | Ga0495620_0000479 | Ga0495620_0000479_15940_16533 | 193 |
| 278 | 3300046518 | Ga0495631_0000120 | Ga0495631_0000120_32957_33538 | 193 |
| 279 | 3300046518 | Ga0495631_0000595 | Ga0495631_0000595_11938_12528 | 193 |
| 280 | 3300046518 | Ga0495631_0085947 | Ga0495631_0085947_258_851 | 193 |
| 281 | 3300046519 | Ga0495632_0006581 | Ga0495632_0006581_3215_3796 | 193 |
| 282 | 3300046519 | Ga0495632_0022289 | Ga0495632_0022289_2246_2827 | 193 |
| 283 | 3300046524 | Ga0495648_0001431 | Ga0495648_0001431_11042_11632 | 193 |
| 284 | 3300046524 | Ga0495648_0019624 | Ga0495648_0019624_2680_3261 | 193 |
| 285 | 3300046616 | Ga0495668_0048165 | Ga0495668_0048165_262_852 | 193 |
| 286 | 3300046648 | Ga0495611_0000078 | Ga0495611_0000078_19139_19720 | 193 |
| 287 | 3300046660 | Ga0495625_0001745 | Ga0495625_0001745_21465_22058 | 193 |
| 288 | 3300046660 | Ga0495625_0006208 | Ga0495625_0006208_7349_7930 | 193 |
| 289 | 3300046660 | Ga0495625_0074287 | Ga0495625_0074287_1637_2242 | 193 |
| 290 | 3300046665 | Ga0495661_0001142 | Ga0495661_0001142_11569_12159 | 193 |
| 291 | 3300046691 | Ga0495670_0000166 | Ga0495670_0000166_8688_9269 | 193 |
| 292 | 3300046694 | Ga0495649_0004145 | Ga0495649_0004145_6681_7262 | 193 |
| 293 | 3300046810 | Ga0495660_0000273 | Ga0495660_0000273_32900_33490 | 193 |
| 294 | 3300047323 | Ga0495683_0001529 | Ga0495683_0001529_7821_8402 | 193 |
| 295 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_985664_986254 | 193 |
| 296 | 3300047469 | Ga0495673_0000127 | Ga0495673_0000127_98783_99364 | 193 |
| 297 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_232140_232721 | 193 |
| 298 | 3300047472 | Ga0495686_0000375 | Ga0495686_0000375_22133_22714 | 193 |
| 299 | 3300047472 | Ga0495686_0006156 | Ga0495686_0006156_4115_4696 | 193 |
| 300 | 3300047472 | Ga0495686_0010873 | Ga0495686_0010873_1104_1685 | 193 |
| 301 | 3300047472 | Ga0495686_0082974 | Ga0495686_0082974_460_1053 | 193 |
| 302 | 3300048903 | Ga0496100_0036036 | Ga0496100_0036036_2291_2875 | 193 |
| 303 | 3300048904 | Ga0496101_0000359 | Ga0496101_0000359_8517_9101 | 193 |
| 304 | 3300048905 | Ga0496102_0475759 | Ga0496102_0475759_302_883 | 193 |
| 305 | 3300048909 | Ga0496106_0020189 | Ga0496106_0020189_3008_3589 | 193 |
| 306 | 3300048920 | Ga0496117_0010477 | Ga0496117_0010477_5199_5780 | 193 |
| 307 | 3300048920 | Ga0496117_0069099 | Ga0496117_0069099_232_813 | 193 |
| 308 | 3300048921 | Ga0496118_0000714 | Ga0496118_0000714_7485_8066 | 193 |
| 309 | 3300048921 | Ga0496118_0013920 | Ga0496118_0013920_4440_5021 | 193 |
| 310 | 3300048924 | Ga0496121_0000829 | Ga0496121_0000829_48235_48816 | 193 |
| 311 | 3300048924 | Ga0496121_0001307 | Ga0496121_0001307_22563_23144 | 193 |
| 312 | 3300048924 | Ga0496121_0005297 | Ga0496121_0005297_3210_3800 | 193 |
| 313 | 3300048924 | Ga0496121_0221536 | Ga0496121_0221536_168_755 | 193 |
| 314 | 3300048924 | Ga0496121_0222434 | Ga0496121_0222434_593_1186 | 193 |
| 315 | 3300048924 | Ga0496121_0400992 | Ga0496121_0400992_13_594 | 193 |
| 316 | 3300048925 | Ga0496122_0005001 | Ga0496122_0005001_3276_3860 | 193 |
| 317 | 3300048925 | Ga0496122_0085900 | Ga0496122_0085900_1409_1990 | 193 |
| 318 | 3300048925 | Ga0496122_0091045 | Ga0496122_0091045_985_1566 | 193 |
| 319 | 3300048926 | Ga0496123_0001582 | Ga0496123_0001582_19867_20454 | 193 |
| 320 | 3300048926 | Ga0496123_0006858 | Ga0496123_0006858_4858_5439 | 193 |
| 321 | 3300048926 | Ga0496123_0077717 | Ga0496123_0077717_188_769 | 193 |
| 322 | 3300048926 | Ga0496123_0191822 | Ga0496123_0191822_142_723 | 193 |
| 323 | 3300048927 | Ga0496124_0000381 | Ga0496124_0000381_16271_16855 | 193 |
| 324 | 3300048928 | Ga0496125_0002397 | Ga0496125_0002397_18433_19014 | 193 |
| 325 | 3300048929 | Ga0496126_0032185 | Ga0496126_0032185_3475_4056 | 193 |
| 326 | 3300048929 | Ga0496126_0330734 | Ga0496126_0330734_451_1038 | 193 |
| 327 | 3300048929 | Ga0496126_0849363 | Ga0496126_0849363_43_624 | 193 |
| 328 | 3300049460 | Ga0495682_0007157 | Ga0495682_0007157_2244_2834 | 193 |
| 329 | 3300050516 | nmdc:mga0sz30_216047_c1 | nmdc:mga0sz30_216047_c1_100_681 | 193 |
| 330 | 3300053160 | Ga0500633_0093742 | Ga0500633_0093742_235_816 | 193 |
| 331 | 3300053730 | Ga0500645_001061 | Ga0500645_001061_11729_12319 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.8435 | 2 | 182 |
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.8067 | 2 | 182 |
| 5xtc-assembly1.cif.gz_m | cryo-em structure of human respiratory complex i transmembrane arm | 0.5525 | 1 | 153 |
| 1i5n-assembly2.cif.gz_B | crystal structure of the p1 domain of chea from salmonella typhimurium | 0.4183 | 1 | 132 |
| 1i5n-assembly2.cif.gz_B | crystal structure of the p1 domain of chea from salmonella typhimurium | 0.4118 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2lchA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain | 0.7621 | 11 | 64 | 1.20.120.160 |
| af_A0A1D6I862_132_224_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.4929 | 92 | 183 | 1.20.1280.290 |
| af_O17274_240_390_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.4869 | 1 | 73 | 1.20.58.390 |
| af_Q5JJY5_143_235_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.4638 | 88 | 186 | 1.20.1280.290 |
| 4qndA00 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.4604 | 92 | 182 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1QFZ4-F1-model_v4 | deleted | 0.9721 | 5 | 180 |
|
| AF-A0A7G5IEN1-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9684 | 5 | 181 |
GO:0005886
GO:0034257 |
| AF-A0A7C2J9G3-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9678 | 81 | 181 |
GO:0005886
GO:0034257 |
| AF-A0A511BVH4-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9669 | 5 | 184 |
GO:0005886
GO:0034257 |
| AF-A0A0A8TK22-F1-model_v4 | deleted | 0.9615 | 5 | 188 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar