F410526

General Info

Members Datasets Scaffolds Average Seq Length
331 192 309 192

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1000180|Ga0209257_100018088
Length 187
Sequence VSIETLEWIAAAVSIAAVWLTARRHLLGWPVGLVSVALYAGVFIDARLYSDALLQGAFAGFIVYGWWRWKANLGNDGRVRIAPLRAAVMCRDLGVGAVGALALGAAMHTWTDAALPLTAFSLVAQWWQGRRHVAAWWLWIVVDVIYIGLYLYKSLNVTAALYLGLVGLAIMGLQQWRRANAQPAAVA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
12 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
18 2919085039 Luteibacter sp. 1214 Isolate Unclassified
19 2919404418 Luteibacter sp. 3190 Isolate Unclassified
20 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
21 2941471342 Luteibacter sp. 621 Isolate Unclassified
22 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
123 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
124 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
125 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.45
Metatranscriptomes 0.91
Isolates 6.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 0
Rhizoplane 2.11
Rhizosphere 72.81
Stem 0
Stem Tuber 0
Unclassified 16.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10025052 3300001979 Bacteria 2016
2 JGI25162J39368_1001179 3300002737 Bacteria 15455
3 JGI25162J39368_1002482 3300002737 Bacteria 7105
4 JGI25157J39369_1002755 3300002741 Bacteria 4031
5 JGI25164J39214_1000560 3300002772 Bacteria 16884
6 JGI25164J39214_1000693 3300002772 Bacteria 13136
7 JGI25165J46597_1000873 3300003214 Bacteria 21443
8 JGI25165J46597_1007593 3300003214 Bacteria 1781
9 rootH2_10126653 3300003320 Bacteria 2893
10 Ga0006562J51391_1030997 3300003578 Bacteria 3060
11 Ga0006562J51391_1030998 3300003578 Bacteria 1827
12 Ga0055542_1015591 3300003762 Bacteria 1217
13 Ga0055531_10017112 3300003794 Bacteria 3080
14 Ga0055543_1019290 3300004625 Bacteria 1263
15 Ga0065165_1000205 3300005262 Bacteria 102670
16 Ga0070666_10000003 3300005335 Bacteria 463666
17 Ga0070680_100035096 3300005336 Bacteria 4048
18 Ga0070660_100047207 3300005339 Bacteria 3303
19 Ga0070660_100075988 3300005339 Bacteria 2630
20 Ga0070660_100207614 3300005339 Bacteria 1590
21 Ga0070660_100724651 3300005339 Bacteria 834
22 Ga0070661_100015213 3300005344 Bacteria 5430
23 Ga0070661_100022555 3300005344 Bacteria 4507
24 Ga0070661_100023750 3300005344 Bacteria 4397
25 Ga0070668_100249098 3300005347 Bacteria 1474
26 Ga0070659_100003891 3300005366 Bacteria 10637
27 Ga0070659_100137495 3300005366 Bacteria 1987
28 Ga0070714_100000280 3300005435 Bacteria 39190
29 Ga0070714_100468299 3300005435 Bacteria 1198
30 Ga0070713_100007533 3300005436 Bacteria 7649
31 Ga0070710_10028694 3300005437 Bacteria 2978
32 Ga0070710_10434076 3300005437 Bacteria 887
33 Ga0070662_100072448 3300005457 Bacteria 2543
34 Ga0070681_10011726 3300005458 Bacteria 8684
35 Ga0070681_10017794 3300005458 Bacteria 7100
36 Ga0070679_100174486 3300005530 Bacteria 2122
37 Ga0068853_100120100 3300005539 Bacteria 2343
38 Ga0068853_100143773 3300005539 Bacteria 2142
39 Ga0068853_100436386 3300005539 Bacteria 1230
40 Ga0070696_100272920 3300005546 Bacteria 1286
41 Ga0070693_100043727 3300005547 Bacteria 2531
42 Ga0070665_100083842 3300005548 Bacteria 3192
43 Ga0070665_100257454 3300005548 Bacteria 1746
44 Ga0068855_101245491 3300005563 Bacteria 772
45 Ga0068857_100085379 3300005577 Bacteria 2821
46 Ga0068854_100273960 3300005578 Bacteria 1356
47 Ga0068856_100204846 3300005614 Bacteria 1987
48 Ga0068858_100906016 3300005842 Bacteria 862
49 Ga0068860_100211537 3300005843 Bacteria 1881
50 Ga0070712_100162213 3300006175 Bacteria 1727
51 Ga0070712_100297053 3300006175 Bacteria 1306
52 Ga0075369_10045539 3300006186 Bacteria 1887
53 Ga0105247_10001155 3300009101 Bacteria 19591
54 Ga0105241_10316405 3300009174 Bacteria 1344
55 Ga0105237_10143430 3300009545 Bacteria 2383
56 Ga0105237_10538095 3300009545 Bacteria 1175
57 Ga0105238_10002982 3300009551 Bacteria 16898
58 Ga0105238_10587492 3300009551 Bacteria 1121
59 Ga0105239_10002546 3300010375 Bacteria 23137
60 Ga0105239_10095443 3300010375 Bacteria 3285
61 Ga0157373_10159776 3300013100 Bacteria 1586
62 Ga0157371_10009296 3300013102 Bacteria 7749
63 Ga0157370_10001232 3300013104 Bacteria 32075
64 Ga0157370_10035330 3300013104 Bacteria 4859
65 Ga0157370_10189473 3300013104 Bacteria 1909
66 Ga0157370_10222207 3300013104 Bacteria 1749
67 Ga0157369_10007244 3300013105 Bacteria 12768
68 Ga0163162_10000378 3300013306 Bacteria 40518
69 Ga0163162_11500590 3300013306 Bacteria 768
70 Ga0157372_10083203 3300013307 Bacteria 3625
71 Ga0157372_10209494 3300013307 Bacteria 2259
72 Ga0182008_10001715 3300014497 Bacteria 14386
73 Ga0182008_10009921 3300014497 Bacteria 5119
74 Ga0182008_10041186 3300014497 Bacteria 2304
75 Ga0182008_10057414 3300014497 Bacteria 1922
76 Ga0182008_10062708 3300014497 Bacteria 1831
77 Ga0182008_10118388 3300014497 Bacteria 1315
78 Ga0182006_1000171 3300015261 Bacteria 68591
79 Ga0182006_1000185 3300015261 Bacteria 64803
80 Ga0182006_1048282 3300015261 Bacteria 1647
81 Ga0182007_10002300 3300015262 Bacteria 9607
82 Ga0182007_10021106 3300015262 Bacteria 2318
83 Ga0182007_10032314 3300015262 Bacteria 1778
84 Ga0182007_10077663 3300015262 Bacteria 1089
85 Ga0182005_1000044 3300015265 Bacteria 139973
86 Ga0182005_1004131 3300015265 Bacteria 4746
87 Ga0182005_1007486 3300015265 Bacteria 3272
88 Ga0182005_1017554 3300015265 Bacteria 1981
89 Ga0183369_1006 3300015685 Bacteria 449058
90 Ga0163161_10000436 3300017792 Bacteria 34952
91 Ga0163161_10009397 3300017792 Bacteria 6771
92 Ga0206353_11619863 3300020082 Bacteria 1864
93 Ga0209674_100757 3300025226 Bacteria 10941
94 Ga0209147_112711 3300025229 Bacteria 896
95 Ga0207427_100069 3300025231 Bacteria 161547
96 Ga0207427_100249 3300025231 Bacteria 42568
97 Ga0209437_100139 3300025233 Bacteria 172506
98 Ga0209437_100154 3300025233 Bacteria 153383
99 Ga0209437_101036 3300025233 Bacteria 9363
100 Ga0209026_1000270 3300025250 Bacteria 62482
101 Ga0209148_1001867 3300025254 Bacteria 8754
102 Ga0209759_1028471 3300025256 Bacteria 1136
103 Ga0209233_1000083 3300025261 Bacteria 336016
104 Ga0209233_1000092 3300025261 Bacteria 308668
105 Ga0209233_1000191 3300025261 Bacteria 127938
106 Ga0209050_1051320 3300025298 Bacteria 1041
107 Ga0207426_1029039 3300025302 Bacteria 1829
108 Ga0209257_1000180 3300025304 Bacteria 158090
109 Ga0207692_10119523 3300025898 Bacteria 1473
110 Ga0207710_10005067 3300025900 Bacteria 5706
111 Ga0207680_10000006 3300025903 Bacteria 635950
112 Ga0207647_10000013 3300025904 Bacteria 144052
113 Ga0207647_10000724 3300025904 Bacteria 25874
114 Ga0207705_10010226 3300025909 Bacteria 6826
115 Ga0207705_10072596 3300025909 Bacteria 2496
116 Ga0207654_10260815 3300025911 Bacteria 1165
117 Ga0207707_10096907 3300025912 Bacteria 2577
118 Ga0207707_10124653 3300025912 Bacteria 2253
119 Ga0207693_10080045 3300025915 Bacteria 2558
120 Ga0207660_10735105 3300025917 Bacteria 805
121 Ga0207657_10040131 3300025919 Bacteria 4150
122 Ga0207657_10058836 3300025919 Bacteria 3305
123 Ga0207657_10058991 3300025919 Bacteria 3300
124 Ga0207649_10093651 3300025920 Bacteria 1972
125 Ga0207649_10476574 3300025920 Bacteria 946
126 Ga0207652_10302706 3300025921 Bacteria 1443
127 Ga0207694_10003832 3300025924 Bacteria 11893
128 Ga0207694_10032836 3300025924 Bacteria 3975
129 Ga0207694_10065299 3300025924 Bacteria 2837
130 Ga0207694_10347689 3300025924 Bacteria 1227
131 Ga0207700_10040360 3300025928 Bacteria 3406
132 Ga0207664_10000270 3300025929 Bacteria 39107
133 Ga0207664_10000711 3300025929 Bacteria 22659
134 Ga0207664_10686843 3300025929 Bacteria 920
135 Ga0207690_10001124 3300025932 Bacteria 17086
136 Ga0207690_10002402 3300025932 Bacteria 11339
137 Ga0207690_10003467 3300025932 Bacteria 9409
138 Ga0207690_10009543 3300025932 Bacteria 5764
139 Ga0207690_10113631 3300025932 Bacteria 1954
140 Ga0207690_10138863 3300025932 Bacteria 1788
141 Ga0207706_10006690 3300025933 Bacteria 10660
142 Ga0207667_10003499 3300025949 Bacteria 19405
143 Ga0207667_10361682 3300025949 Bacteria 1480
144 Ga0207640_10272550 3300025981 Bacteria 1325
145 Ga0207639_10482882 3300026041 Bacteria 1129
146 Ga0207639_10694407 3300026041 Bacteria 944
147 Ga0207678_10175728 3300026067 Bacteria 1829
148 Ga0207678_11081136 3300026067 Bacteria 710
149 Ga0207702_10307042 3300026078 Bacteria 1507
150 Ga0207674_10031918 3300026116 Bacteria 5529
151 Ga0268266_10000021 3300028379 Bacteria 522453
152 Ga0268265_10536728 3300028380 Bacteria 1108
153 Ga0265332_10202918 3300031238 Bacteria 823
154 Ga0307412_10000497 3300031911 Bacteria 23444
155 Ga0307510_10001447 3300033180 Bacteria 26132
156 Ga0395899_0068931 3300037312 Bacteria 2592
157 Ga0395900_0248597 3300037418 Bacteria 1780
158 Ga0395898_0042928 3300037466 Bacteria 4459
159 Ga0395901_0012286 3300038443 Bacteria 8690
160 Ga0395901_0033929 3300038443 Bacteria 5270
161 Ga0395901_0230493 3300038443 Bacteria 1933
162 Ga0395901_0279226 3300038443 Bacteria 1736
163 Ga0395901_0290664 3300038443 Bacteria 1696
164 Ga0439436_0000005 3300041404 Bacteria 168483
165 Ga0439465_0000093 3300041413 Bacteria 20099
166 Ga0451793_0502584 3300041452 Bacteria 1579
167 Ga0451795_0274230 3300041456 Bacteria 706
168 Ga0451795_0473239 3300041456 Bacteria 1561
169 Ga0450908_000006 3300042184 Bacteria 56117
170 Ga0439459_0001414 3300042438 Bacteria 3524
171 Ga0466982_0000027 3300044672 Bacteria 62332
172 Ga0466968_0000448 3300044735 Bacteria 13870
173 Ga0466957_0301321 3300044842 Bacteria 1077
174 Ga0495617_000058 3300046452 Bacteria 100393
175 Ga0495617_002617 3300046452 Bacteria 7044
176 Ga0495638_0000007 3300046460 Bacteria 602783
177 Ga0495638_0000536 3300046460 Bacteria 43871
178 Ga0495638_0013597 3300046460 Bacteria 5533
179 Ga0495650_0000564 3300046471 Bacteria 52182
180 Ga0495650_0012948 3300046471 Bacteria 4448
181 Ga0495650_0018109 3300046471 Bacteria 3511
182 Ga0495605_0044210 3300046474 Bacteria 2204
183 Ga0495584_0001814 3300046491 Bacteria 12391
184 Ga0495585_0000683 3300046492 Bacteria 30903
185 Ga0495607_0000038 3300046501 Bacteria 134124
186 Ga0495607_0000196 3300046501 Bacteria 63991
187 Ga0495607_0004741 3300046501 Bacteria 9940
188 Ga0495607_0009788 3300046501 Bacteria 6472
189 Ga0495583_0044142 3300046506 Bacteria 2070
190 Ga0495606_0000222 3300046507 Bacteria 100766
191 Ga0495606_0003796 3300046507 Bacteria 15696
192 Ga0495606_0005641 3300046507 Bacteria 11865
193 Ga0495606_0435782 3300046507 Bacteria 674
194 Ga0495610_0002520 3300046512 Bacteria 15285
195 Ga0495610_0010726 3300046512 Bacteria 5667
196 Ga0495616_0000056 3300046513 Bacteria 101901
197 Ga0495616_0014376 3300046513 Bacteria 4431
198 Ga0495616_0028624 3300046513 Bacteria 2949
199 Ga0495620_0000479 3300046515 Bacteria 25982
200 Ga0495631_0000120 3300046518 Bacteria 52656
201 Ga0495631_0000595 3300046518 Bacteria 23959
202 Ga0495631_0085947 3300046518 Bacteria 1355
203 Ga0495632_0006581 3300046519 Bacteria 7438
204 Ga0495632_0022289 3300046519 Bacteria 3397
205 Ga0495632_0041723 3300046519 Bacteria 2304
206 Ga0495637_0019340 3300046520 Bacteria 3151
207 Ga0495648_0001431 3300046524 Bacteria 23362
208 Ga0495648_0019624 3300046524 Bacteria 4743
209 Ga0495609_0019473 3300046538 Bacteria 3140
210 Ga0495668_0048165 3300046616 Bacteria 2364
211 Ga0495611_0000034 3300046648 Bacteria 103287
212 Ga0495611_0000078 3300046648 Bacteria 68937
213 Ga0495625_0000002 3300046660 Bacteria 813323
214 Ga0495625_0001745 3300046660 Bacteria 25143
215 Ga0495625_0006208 3300046660 Bacteria 10702
216 Ga0495625_0074287 3300046660 Bacteria 2382
217 Ga0495661_0001142 3300046665 Bacteria 23194
218 Ga0495670_0000166 3300046691 Bacteria 28919
219 Ga0495670_0001707 3300046691 Bacteria 10801
220 Ga0495671_0001575 3300046692 Bacteria 15099
221 Ga0495649_0004145 3300046694 Bacteria 9518
222 Ga0495589_0000192 3300046794 Bacteria 53416
223 Ga0495660_0000156 3300046810 Bacteria 74271
224 Ga0495660_0000273 3300046810 Bacteria 48544
225 Ga0495683_0001529 3300047323 Bacteria 14997
226 Ga0495679_000003 3300047446 Bacteria 787868
227 Ga0495673_0000004 3300047469 Bacteria 1354526
228 Ga0495673_0000127 3300047469 Bacteria 140402
229 Ga0495673_0001542 3300047469 Bacteria 18120
230 Ga0495686_0000024 3300047472 Bacteria 400343
231 Ga0495686_0000375 3300047472 Bacteria 71924
232 Ga0495686_0006156 3300047472 Bacteria 9277
233 Ga0495686_0010873 3300047472 Bacteria 6445
234 Ga0495686_0082974 3300047472 Bacteria 1955
235 Ga0496100_0036036 3300048903 Bacteria 3117
236 Ga0496101_0000359 3300048904 Bacteria 30569
237 Ga0496102_0475759 3300048905 Bacteria 1170
238 Ga0496106_0020189 3300048909 Bacteria 4943
239 Ga0496117_0010477 3300048920 Bacteria 8441
240 Ga0496117_0069099 3300048920 Bacteria 2381
241 Ga0496118_0000714 3300048921 Bacteria 53628
242 Ga0496118_0013920 3300048921 Bacteria 7564
243 Ga0496121_0000829 3300048924 Bacteria 56313
244 Ga0496121_0001307 3300048924 Bacteria 42738
245 Ga0496121_0005297 3300048924 Bacteria 16603
246 Ga0496121_0221536 3300048924 Bacteria 1332
247 Ga0496121_0222434 3300048924 Bacteria 1328
248 Ga0496121_0400992 3300048924 Bacteria 898
249 Ga0496122_0005001 3300048925 Bacteria 16035
250 Ga0496122_0085900 3300048925 Bacteria 2168
251 Ga0496122_0091045 3300048925 Bacteria 2078
252 Ga0496123_0001582 3300048926 Bacteria 30970
253 Ga0496123_0006858 3300048926 Bacteria 10908
254 Ga0496123_0025108 3300048926 Bacteria 4502
255 Ga0496123_0077717 3300048926 Bacteria 2037
256 Ga0496123_0191822 3300048926 Bacteria 1056
257 Ga0496124_0000009 3300048927 Bacteria 734820
258 Ga0496124_0000381 3300048927 Bacteria 81000
259 Ga0496124_0001381 3300048927 Bacteria 36365
260 Ga0496124_0035336 3300048927 Bacteria 4373
261 Ga0496125_0002397 3300048928 Bacteria 24412
262 Ga0496126_0032185 3300048929 Bacteria 4944
263 Ga0496126_0330734 3300048929 Bacteria 1250
264 Ga0496126_0849363 3300048929 Bacteria 696
265 Ga0495678_000026 3300049459 Bacteria 226978
266 Ga0495682_0005563 3300049460 Bacteria 5215
267 Ga0495682_0007157 3300049460 Bacteria 4457
268 Ga0501031_0044889 3300049568 Bacteria 2884
269 Ga0501031_0086048 3300049568 Bacteria 2049
270 Ga0501031_0126489 3300049568 Bacteria 1669
271 Ga0501032_0017089 3300049569 Bacteria 5098
272 Ga0501032_0242629 3300049569 Bacteria 1170
273 Ga0501033_0000626 3300049570 Bacteria 32770
274 Ga0501033_0000932 3300049570 Bacteria 26712
275 Ga0501034_0382474 3300049571 Bacteria 1332
276 Ga0501034_0717543 3300049571 Bacteria 897
277 Ga0501034_1177937 3300049571 Bacteria 645
278 Ga0501036_0103940 3300049572 Bacteria 2402
279 Ga0501037_0355698 3300049573 Bacteria 1009
280 Ga0501039_0064803 3300049575 Bacteria 2833
281 Ga0501040_0182705 3300049576 Bacteria 1487
282 Ga0501043_0050215 3300049579 Bacteria 3279
283 Ga0501043_0074781 3300049579 Bacteria 2661
284 Ga0501046_0056960 3300049580 Bacteria 3066
285 Ga0501046_0071679 3300049580 Bacteria 2691
286 Ga0501046_0272483 3300049580 Bacteria 1241
287 Ga0501047_0016740 3300049581 Bacteria 7004
288 Ga0501047_0059060 3300049581 Bacteria 3703
289 Ga0501048_0031467 3300049582 Bacteria 3838
290 Ga0501070_0419888 3300049586 Bacteria 1080
291 Ga0501073_0064544 3300049589 Bacteria 2554
292 Ga0501035_0020208 3300049822 Bacteria 6115
293 Ga0501035_0022786 3300049822 Bacteria 5751
294 Ga0501035_0085647 3300049822 Bacteria 2777
295 Ga0501035_0101634 3300049822 Bacteria 2523
296 Ga0501035_0404599 3300049822 Bacteria 1135
297 Ga0501035_0774742 3300049822 Bacteria 768
298 Ga0501035_0803149 3300049822 Bacteria 751
299 Ga0501044_0031745 3300049823 Bacteria 5556
300 Ga0501044_0044298 3300049823 Bacteria 4617
301 Ga0501044_0083340 3300049823 Bacteria 3234
302 Ga0501044_0101371 3300049823 Bacteria 2896
303 Ga0501044_0237806 3300049823 Bacteria 1766
304 Ga0501044_0864126 3300049823 Bacteria 781
305 nmdc:mga0sz30_216047_c1 3300050516 Bacteria 852
306 Ga0500643_000138 3300053087 Bacteria 73474
307 Ga0500555_000108 3300053103 Bacteria 39384
308 Ga0500633_0093742 3300053160 Bacteria 1099
309 Ga0500645_001061 3300053730 Bacteria 15232

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0774742 Ga0501035_0774742_21_545 161
2 3300037466 Ga0395898_0042928 Ga0395898_0042928_1840_2424 165
3 3300038443 Ga0395901_0033929 Ga0395901_0033929_1529_2113 165
4 3300005339 Ga0070660_100207614 Ga0070660_1002076141 168
5 3300005366 Ga0070659_100003891 Ga0070659_1000038918 168
6 3300005458 Ga0070681_10011726 Ga0070681_100117262 168
7 3300005530 Ga0070679_100174486 Ga0070679_1001744862 168
8 3300025912 Ga0207707_10124653 Ga0207707_101246532 168
9 3300025919 Ga0207657_10040131 Ga0207657_100401313 168
10 3300025932 Ga0207690_10002402 Ga0207690_100024028 168
11 3300049822 Ga0501035_0404599 Ga0501035_0404599_60_659 168
12 3300015685 Ga0183369_1006 Ga0183369_1006216 169
13 3300037418 Ga0395900_0248597 Ga0395900_0248597_990_1565 172
14 3300038443 Ga0395901_0230493 Ga0395901_0230493_216_791 172
15 3300049572 Ga0501036_0103940 Ga0501036_0103940_541_1125 174
16 3300049581 Ga0501047_0059060 Ga0501047_0059060_1681_2265 174
17 3300049822 Ga0501035_0803149 Ga0501035_0803149_13_597 174
18 3300049823 Ga0501044_0083340 Ga0501044_0083340_536_1120 174
19 3300049580 Ga0501046_0272483 Ga0501046_0272483_36_635 179
20 3300049822 Ga0501035_0022786 Ga0501035_0022786_2406_3005 179
21 3300049823 Ga0501044_0044298 Ga0501044_0044298_1409_2008 179
22 iso_pu_bacteria 2643221577 2643893983 182
23 iso_pu_bacteria 2643221685 2644476201 182
24 3300013102 Ga0157371_10009296 Ga0157371_100092965 183
25 3300013104 Ga0157370_10189473 Ga0157370_101894731 183
26 iso_pu_bacteria 2842780639 2842781185 184
27 3300003794 Ga0055531_10017112 Ga0055531_100171122 185
28 3300025298 Ga0209050_1051320 Ga0209050_10513202 185
29 3300025304 Ga0209257_1000180 Ga0209257_100018088 185
30 3300049823 Ga0501044_0237806 Ga0501044_0237806_162_737 185
31 iso_pu_bacteria 2537561836 2538833071 185
32 iso_pu_bacteria 2643221562 2643831537 185
33 iso_pu_bacteria 2687453130 2687583403 185
34 iso_pu_bacteria 2895395659 2895396977 185
35 iso_pu_bacteria 2939611941 2939614235 185
36 3300005539 Ga0068853_100436386 Ga0068853_1004363862 186
37 3300026041 Ga0207639_10694407 Ga0207639_106944072 186
38 3300049569 Ga0501032_0017089 Ga0501032_0017089_1049_1618 186
39 3300049571 Ga0501034_0382474 Ga0501034_0382474_65_634 186
40 3300049580 Ga0501046_0056960 Ga0501046_0056960_389_958 186
41 3300049822 Ga0501035_0101634 Ga0501035_0101634_1051_1620 186
42 3300049823 Ga0501044_0864126 Ga0501044_0864126_92_661 186
43 iso_pu_bacteria 2818991440 2819566222 186
44 iso_pu_bacteria 2904463128 2904466498 186
45 3300005547 Ga0070693_100043727 Ga0070693_1000437272 187
46 3300025233 Ga0209437_101036 Ga0209437_1010362 187
47 3300025900 Ga0207710_10005067 Ga0207710_100050674 187
48 3300046460 Ga0495638_0000007 Ga0495638_0000007_199583_200191 187
49 3300049579 Ga0501043_0050215 Ga0501043_0050215_837_1409 187
50 3300003762 Ga0055542_1015591 Ga0055542_10155912 188
51 3300015265 Ga0182005_1017554 Ga0182005_10175542 188
52 3300025254 Ga0209148_1001867 Ga0209148_10018676 188
53 3300041452 Ga0451793_0502584 Ga0451793_0502584_26_601 188
54 3300041456 Ga0451795_0274230 Ga0451795_0274230_32_607 188
55 3300042438 Ga0439459_0001414 Ga0439459_0001414_1936_2511 188
56 3300046452 Ga0495617_002617 Ga0495617_002617_1782_2372 188
57 3300046460 Ga0495638_0000536 Ga0495638_0000536_32201_32791 188
58 3300046501 Ga0495607_0000196 Ga0495607_0000196_52294_52884 188
59 3300046506 Ga0495583_0044142 Ga0495583_0044142_1040_1630 188
60 3300046513 Ga0495616_0014376 Ga0495616_0014376_1285_1875 188
61 3300046519 Ga0495632_0041723 Ga0495632_0041723_1358_1948 188
62 3300046520 Ga0495637_0019340 Ga0495637_0019340_1733_2323 188
63 3300046538 Ga0495609_0019473 Ga0495609_0019473_1658_2248 188
64 3300046648 Ga0495611_0000034 Ga0495611_0000034_78761_79351 188
65 3300046660 Ga0495625_0000002 Ga0495625_0000002_788797_789387 188
66 3300046691 Ga0495670_0001707 Ga0495670_0001707_5290_5880 188
67 3300046692 Ga0495671_0001575 Ga0495671_0001575_11107_11697 188
68 3300046794 Ga0495589_0000192 Ga0495589_0000192_10095_10685 188
69 3300046810 Ga0495660_0000156 Ga0495660_0000156_50758_51348 188
70 3300047446 Ga0495679_000003 Ga0495679_000003_11059_11649 188
71 3300047469 Ga0495673_0001542 Ga0495673_0001542_10057_10647 188
72 3300048927 Ga0496124_0001381 Ga0496124_0001381_16271_16855 188
73 3300049459 Ga0495678_000026 Ga0495678_000026_215308_215898 188
74 3300049460 Ga0495682_0005563 Ga0495682_0005563_4253_4843 188
75 3300049568 Ga0501031_0044889 Ga0501031_0044889_1470_2045 188
76 3300049568 Ga0501031_0086048 Ga0501031_0086048_1416_1988 188
77 3300049568 Ga0501031_0126489 Ga0501031_0126489_220_804 188
78 3300049569 Ga0501032_0242629 Ga0501032_0242629_139_711 188
79 3300049570 Ga0501033_0000932 Ga0501033_0000932_3250_3825 188
80 3300049571 Ga0501034_1177937 Ga0501034_1177937_25_597 188
81 3300049573 Ga0501037_0355698 Ga0501037_0355698_258_830 188
82 3300049575 Ga0501039_0064803 Ga0501039_0064803_2177_2749 188
83 3300049576 Ga0501040_0182705 Ga0501040_0182705_353_925 188
84 3300049579 Ga0501043_0074781 Ga0501043_0074781_1186_1770 188
85 3300049580 Ga0501046_0071679 Ga0501046_0071679_544_1116 188
86 3300049581 Ga0501047_0016740 Ga0501047_0016740_4641_5225 188
87 3300049582 Ga0501048_0031467 Ga0501048_0031467_3114_3686 188
88 3300049586 Ga0501070_0419888 Ga0501070_0419888_416_988 188
89 3300049589 Ga0501073_0064544 Ga0501073_0064544_673_1245 188
90 3300049822 Ga0501035_0020208 Ga0501035_0020208_4995_5567 188
91 3300049822 Ga0501035_0085647 Ga0501035_0085647_1437_2021 188
92 3300049823 Ga0501044_0031745 Ga0501044_0031745_4588_5172 188
93 3300049823 Ga0501044_0101371 Ga0501044_0101371_2300_2872 188
94 3300053087 Ga0500643_000138 Ga0500643_000138_21013_21603 188
95 3300053103 Ga0500555_000108 Ga0500555_000108_8515_9105 188
96 3300002737 JGI25162J39368_1001179 JGI25162J39368_10011792 189
97 3300002737 JGI25162J39368_1002482 JGI25162J39368_10024827 189
98 3300002741 JGI25157J39369_1002755 JGI25157J39369_10027552 189
99 3300002772 JGI25164J39214_1000560 JGI25164J39214_100056017 189
100 3300002772 JGI25164J39214_1000693 JGI25164J39214_100069312 189
101 3300003214 JGI25165J46597_1000873 JGI25165J46597_100087322 189
102 3300003214 JGI25165J46597_1007593 JGI25165J46597_10075932 189
103 3300005336 Ga0070680_100035096 Ga0070680_1000350962 189
104 3300005339 Ga0070660_100047207 Ga0070660_1000472072 189
105 3300005339 Ga0070660_100075988 Ga0070660_1000759882 189
106 3300005339 Ga0070660_100724651 Ga0070660_1007246511 189
107 3300005344 Ga0070661_100015213 Ga0070661_1000152135 189
108 3300005366 Ga0070659_100137495 Ga0070659_1001374952 189
109 3300005435 Ga0070714_100000280 Ga0070714_10000028015 189
110 3300005435 Ga0070714_100468299 Ga0070714_1004682992 189
111 3300005436 Ga0070713_100007533 Ga0070713_1000075333 189
112 3300005437 Ga0070710_10028694 Ga0070710_100286943 189
113 3300005437 Ga0070710_10434076 Ga0070710_104340761 189
114 3300005457 Ga0070662_100072448 Ga0070662_1000724482 189
115 3300005458 Ga0070681_10017794 Ga0070681_100177942 189
116 3300005539 Ga0068853_100120100 Ga0068853_1001201002 189
117 3300005539 Ga0068853_100143773 Ga0068853_1001437732 189
118 3300005546 Ga0070696_100272920 Ga0070696_1002729201 189
119 3300005563 Ga0068855_101245491 Ga0068855_1012454911 189
120 3300005577 Ga0068857_100085379 Ga0068857_1000853792 189
121 3300005578 Ga0068854_100273960 Ga0068854_1002739602 189
122 3300005614 Ga0068856_100204846 Ga0068856_1002048462 189
123 3300006175 Ga0070712_100162213 Ga0070712_1001622132 189
124 3300006175 Ga0070712_100297053 Ga0070712_1002970532 189
125 3300009174 Ga0105241_10316405 Ga0105241_103164052 189
126 3300009545 Ga0105237_10143430 Ga0105237_101434301 189
127 3300009551 Ga0105238_10587492 Ga0105238_105874921 189
128 3300013100 Ga0157373_10159776 Ga0157373_101597762 189
129 3300013104 Ga0157370_10001232 Ga0157370_100012329 189
130 3300013307 Ga0157372_10083203 Ga0157372_100832036 189
131 3300013307 Ga0157372_10209494 Ga0157372_102094942 189
132 3300014497 Ga0182008_10041186 Ga0182008_100411862 189
133 3300014497 Ga0182008_10057414 Ga0182008_100574142 189
134 3300014497 Ga0182008_10062708 Ga0182008_100627081 189
135 3300014497 Ga0182008_10118388 Ga0182008_101183882 189
136 3300015261 Ga0182006_1048282 Ga0182006_10482822 189
137 3300015262 Ga0182007_10021106 Ga0182007_100211061 189
138 3300015262 Ga0182007_10032314 Ga0182007_100323141 189
139 3300015262 Ga0182007_10077663 Ga0182007_100776632 189
140 3300020082 Ga0206353_11619863 Ga0206353_116198632 189
141 3300025226 Ga0209674_100757 Ga0209674_1007578 189
142 3300025231 Ga0207427_100069 Ga0207427_100069146 189
143 3300025231 Ga0207427_100249 Ga0207427_10024928 189
144 3300025233 Ga0209437_100139 Ga0209437_10013979 189
145 3300025233 Ga0209437_100154 Ga0209437_10015480 189
146 3300025250 Ga0209026_1000270 Ga0209026_100027042 189
147 3300025256 Ga0209759_1028471 Ga0209759_10284712 189
148 3300025261 Ga0209233_1000083 Ga0209233_1000083146 189
149 3300025261 Ga0209233_1000092 Ga0209233_1000092209 189
150 3300025261 Ga0209233_1000191 Ga0209233_100019166 189
151 3300025898 Ga0207692_10119523 Ga0207692_101195232 189
152 3300025904 Ga0207647_10000724 Ga0207647_1000072411 189
153 3300025909 Ga0207705_10010226 Ga0207705_100102262 189
154 3300025909 Ga0207705_10072596 Ga0207705_100725962 189
155 3300025911 Ga0207654_10260815 Ga0207654_102608152 189
156 3300025912 Ga0207707_10096907 Ga0207707_100969072 189
157 3300025915 Ga0207693_10080045 Ga0207693_100800452 189
158 3300025917 Ga0207660_10735105 Ga0207660_107351052 189
159 3300025919 Ga0207657_10058836 Ga0207657_100588364 189
160 3300025919 Ga0207657_10058991 Ga0207657_100589914 189
161 3300025921 Ga0207652_10302706 Ga0207652_103027062 189
162 3300025924 Ga0207694_10065299 Ga0207694_100652992 189
163 3300025924 Ga0207694_10347689 Ga0207694_103476892 189
164 3300025928 Ga0207700_10040360 Ga0207700_100403604 189
165 3300025929 Ga0207664_10000270 Ga0207664_1000027015 189
166 3300025929 Ga0207664_10000711 Ga0207664_1000071112 189
167 3300025929 Ga0207664_10686843 Ga0207664_106868432 189
168 3300025932 Ga0207690_10001124 Ga0207690_100011242 189
169 3300025932 Ga0207690_10003467 Ga0207690_100034672 189
170 3300025932 Ga0207690_10009543 Ga0207690_100095434 189
171 3300025932 Ga0207690_10113631 Ga0207690_101136312 189
172 3300025932 Ga0207690_10138863 Ga0207690_101388631 189
173 3300025933 Ga0207706_10006690 Ga0207706_100066902 189
174 3300025949 Ga0207667_10003499 Ga0207667_1000349915 189
175 3300025949 Ga0207667_10361682 Ga0207667_103616821 189
176 3300025981 Ga0207640_10272550 Ga0207640_102725502 189
177 3300026041 Ga0207639_10482882 Ga0207639_104828822 189
178 3300026067 Ga0207678_11081136 Ga0207678_110811361 189
179 3300026078 Ga0207702_10307042 Ga0207702_103070422 189
180 3300026116 Ga0207674_10031918 Ga0207674_100319183 189
181 3300031238 Ga0265332_10202918 Ga0265332_102029181 189
182 3300037312 Ga0395899_0068931 Ga0395899_0068931_166_744 189
183 3300038443 Ga0395901_0012286 Ga0395901_0012286_1578_2156 189
184 3300038443 Ga0395901_0279226 Ga0395901_0279226_89_670 189
185 3300038443 Ga0395901_0290664 Ga0395901_0290664_699_1286 189
186 3300049570 Ga0501033_0000626 Ga0501033_0000626_12127_12738 189
187 3300049571 Ga0501034_0717543 Ga0501034_0717543_26_613 189
188 iso_pu_bacteria 2593339238 2595449065 189
189 iso_pu_bacteria 2593339239 2595452804 189
190 iso_pu_bacteria 2718218334 2721025735 189
191 iso_pu_bacteria 2734482264 2735834290 189
192 iso_pu_bacteria 2738543009 2739225714 189
193 iso_pu_bacteria 2842914999 2842917166 189
194 iso_pu_bacteria 2842918807 2842920723 189
195 iso_pu_bacteria 2884338543 2884339064 189
196 iso_pu_bacteria 2919085039 2919086250 189
197 iso_pu_bacteria 2919404418 2919407837 189
198 iso_pu_bacteria 2941471342 2941473392 189
199 iso_pu_bacteria 2953994433 2953996001 189
200 3300044735 Ga0466968_0000448 Ga0466968_0000448_3122_3703 190
201 3300046474 Ga0495605_0044210 Ga0495605_0044210_500_1081 190
202 3300046501 Ga0495607_0004741 Ga0495607_0004741_130_711 190
203 3300046513 Ga0495616_0028624 Ga0495616_0028624_2289_2870 190
204 3300048926 Ga0496123_0025108 Ga0496123_0025108_242_820 190
205 3300048927 Ga0496124_0000009 Ga0496124_0000009_76037_76618 190
206 3300048927 Ga0496124_0035336 Ga0496124_0035336_2905_3477 190
207 3300003320 rootH2_10126653 rootH2_101266532 191
208 3300025229 Ga0209147_112711 Ga0209147_1127111 192
209 3300044672 Ga0466982_0000027 Ga0466982_0000027_29808_30389 192
210 3300044842 Ga0466957_0301321 Ga0466957_0301321_469_1050 192
211 3300001979 JGI24740J21852_10025052 JGI24740J21852_100250522 193
212 3300003578 Ga0006562J51391_1030997 Ga0006562J51391_10309971 193
213 3300003578 Ga0006562J51391_1030998 Ga0006562J51391_10309982 193
214 3300004625 Ga0055543_1019290 Ga0055543_10192901 193
215 3300005262 Ga0065165_1000205 Ga0065165_100020523 193
216 3300005335 Ga0070666_10000003 Ga0070666_10000003246 193
217 3300005344 Ga0070661_100022555 Ga0070661_1000225552 193
218 3300005344 Ga0070661_100023750 Ga0070661_1000237505 193
219 3300005347 Ga0070668_100249098 Ga0070668_1002490982 193
220 3300005548 Ga0070665_100083842 Ga0070665_1000838422 193
221 3300005548 Ga0070665_100257454 Ga0070665_1002574542 193
222 3300005842 Ga0068858_100906016 Ga0068858_1009060162 193
223 3300005843 Ga0068860_100211537 Ga0068860_1002115372 193
224 3300006186 Ga0075369_10045539 Ga0075369_100455392 193
225 3300009101 Ga0105247_10001155 Ga0105247_100011553 193
226 3300009545 Ga0105237_10538095 Ga0105237_105380951 193
227 3300009551 Ga0105238_10002982 Ga0105238_100029822 193
228 3300010375 Ga0105239_10002546 Ga0105239_1000254616 193
229 3300010375 Ga0105239_10095443 Ga0105239_100954432 193
230 3300013104 Ga0157370_10035330 Ga0157370_100353303 193
231 3300013104 Ga0157370_10222207 Ga0157370_102222072 193
232 3300013105 Ga0157369_10007244 Ga0157369_100072448 193
233 3300013306 Ga0163162_10000378 Ga0163162_1000037839 193
234 3300013306 Ga0163162_11500590 Ga0163162_115005901 193
235 3300014497 Ga0182008_10001715 Ga0182008_100017153 193
236 3300014497 Ga0182008_10009921 Ga0182008_100099214 193
237 3300015261 Ga0182006_1000171 Ga0182006_100017132 193
238 3300015261 Ga0182006_1000185 Ga0182006_100018519 193
239 3300015262 Ga0182007_10002300 Ga0182007_100023007 193
240 3300015265 Ga0182005_1000044 Ga0182005_100004443 193
241 3300015265 Ga0182005_1004131 Ga0182005_10041314 193
242 3300015265 Ga0182005_1007486 Ga0182005_10074862 193
243 3300017792 Ga0163161_10000436 Ga0163161_1000043628 193
244 3300017792 Ga0163161_10009397 Ga0163161_100093974 193
245 3300025302 Ga0207426_1029039 Ga0207426_10290392 193
246 3300025903 Ga0207680_10000006 Ga0207680_10000006393 193
247 3300025904 Ga0207647_10000013 Ga0207647_1000001348 193
248 3300025920 Ga0207649_10093651 Ga0207649_100936512 193
249 3300025920 Ga0207649_10476574 Ga0207649_104765742 193
250 3300025924 Ga0207694_10003832 Ga0207694_100038321 193
251 3300025924 Ga0207694_10032836 Ga0207694_100328363 193
252 3300026067 Ga0207678_10175728 Ga0207678_101757282 193
253 3300028379 Ga0268266_10000021 Ga0268266_10000021431 193
254 3300028380 Ga0268265_10536728 Ga0268265_105367282 193
255 3300031911 Ga0307412_10000497 Ga0307412_1000049711 193
256 3300033180 Ga0307510_10001447 Ga0307510_1000144727 193
257 3300041404 Ga0439436_0000005 Ga0439436_0000005_133318_133899 193
258 3300041413 Ga0439465_0000093 Ga0439465_0000093_3675_4256 193
259 3300041456 Ga0451795_0473239 Ga0451795_0473239_731_1312 193
260 3300042184 Ga0450908_000006 Ga0450908_000006_25364_25948 193
261 3300046452 Ga0495617_000058 Ga0495617_000058_78993_79586 193
262 3300046460 Ga0495638_0013597 Ga0495638_0013597_2297_2878 193
263 3300046471 Ga0495650_0000564 Ga0495650_0000564_50868_51476 193
264 3300046471 Ga0495650_0012948 Ga0495650_0012948_3114_3695 193
265 3300046471 Ga0495650_0018109 Ga0495650_0018109_677_1258 193
266 3300046491 Ga0495584_0001814 Ga0495584_0001814_4307_4888 193
267 3300046492 Ga0495585_0000683 Ga0495585_0000683_3846_4427 193
268 3300046501 Ga0495607_0000038 Ga0495607_0000038_40194_40775 193
269 3300046501 Ga0495607_0009788 Ga0495607_0009788_3351_3932 193
270 3300046507 Ga0495606_0000222 Ga0495606_0000222_59948_60529 193
271 3300046507 Ga0495606_0003796 Ga0495606_0003796_11202_11786 193
272 3300046507 Ga0495606_0005641 Ga0495606_0005641_3475_4068 193
273 3300046507 Ga0495606_0435782 Ga0495606_0435782_56_637 193
274 3300046512 Ga0495610_0002520 Ga0495610_0002520_13717_14298 193
275 3300046512 Ga0495610_0010726 Ga0495610_0010726_1291_1872 193
276 3300046513 Ga0495616_0000056 Ga0495616_0000056_40536_41117 193
277 3300046515 Ga0495620_0000479 Ga0495620_0000479_15940_16533 193
278 3300046518 Ga0495631_0000120 Ga0495631_0000120_32957_33538 193
279 3300046518 Ga0495631_0000595 Ga0495631_0000595_11938_12528 193
280 3300046518 Ga0495631_0085947 Ga0495631_0085947_258_851 193
281 3300046519 Ga0495632_0006581 Ga0495632_0006581_3215_3796 193
282 3300046519 Ga0495632_0022289 Ga0495632_0022289_2246_2827 193
283 3300046524 Ga0495648_0001431 Ga0495648_0001431_11042_11632 193
284 3300046524 Ga0495648_0019624 Ga0495648_0019624_2680_3261 193
285 3300046616 Ga0495668_0048165 Ga0495668_0048165_262_852 193
286 3300046648 Ga0495611_0000078 Ga0495611_0000078_19139_19720 193
287 3300046660 Ga0495625_0001745 Ga0495625_0001745_21465_22058 193
288 3300046660 Ga0495625_0006208 Ga0495625_0006208_7349_7930 193
289 3300046660 Ga0495625_0074287 Ga0495625_0074287_1637_2242 193
290 3300046665 Ga0495661_0001142 Ga0495661_0001142_11569_12159 193
291 3300046691 Ga0495670_0000166 Ga0495670_0000166_8688_9269 193
292 3300046694 Ga0495649_0004145 Ga0495649_0004145_6681_7262 193
293 3300046810 Ga0495660_0000273 Ga0495660_0000273_32900_33490 193
294 3300047323 Ga0495683_0001529 Ga0495683_0001529_7821_8402 193
295 3300047469 Ga0495673_0000004 Ga0495673_0000004_985664_986254 193
296 3300047469 Ga0495673_0000127 Ga0495673_0000127_98783_99364 193
297 3300047472 Ga0495686_0000024 Ga0495686_0000024_232140_232721 193
298 3300047472 Ga0495686_0000375 Ga0495686_0000375_22133_22714 193
299 3300047472 Ga0495686_0006156 Ga0495686_0006156_4115_4696 193
300 3300047472 Ga0495686_0010873 Ga0495686_0010873_1104_1685 193
301 3300047472 Ga0495686_0082974 Ga0495686_0082974_460_1053 193
302 3300048903 Ga0496100_0036036 Ga0496100_0036036_2291_2875 193
303 3300048904 Ga0496101_0000359 Ga0496101_0000359_8517_9101 193
304 3300048905 Ga0496102_0475759 Ga0496102_0475759_302_883 193
305 3300048909 Ga0496106_0020189 Ga0496106_0020189_3008_3589 193
306 3300048920 Ga0496117_0010477 Ga0496117_0010477_5199_5780 193
307 3300048920 Ga0496117_0069099 Ga0496117_0069099_232_813 193
308 3300048921 Ga0496118_0000714 Ga0496118_0000714_7485_8066 193
309 3300048921 Ga0496118_0013920 Ga0496118_0013920_4440_5021 193
310 3300048924 Ga0496121_0000829 Ga0496121_0000829_48235_48816 193
311 3300048924 Ga0496121_0001307 Ga0496121_0001307_22563_23144 193
312 3300048924 Ga0496121_0005297 Ga0496121_0005297_3210_3800 193
313 3300048924 Ga0496121_0221536 Ga0496121_0221536_168_755 193
314 3300048924 Ga0496121_0222434 Ga0496121_0222434_593_1186 193
315 3300048924 Ga0496121_0400992 Ga0496121_0400992_13_594 193
316 3300048925 Ga0496122_0005001 Ga0496122_0005001_3276_3860 193
317 3300048925 Ga0496122_0085900 Ga0496122_0085900_1409_1990 193
318 3300048925 Ga0496122_0091045 Ga0496122_0091045_985_1566 193
319 3300048926 Ga0496123_0001582 Ga0496123_0001582_19867_20454 193
320 3300048926 Ga0496123_0006858 Ga0496123_0006858_4858_5439 193
321 3300048926 Ga0496123_0077717 Ga0496123_0077717_188_769 193
322 3300048926 Ga0496123_0191822 Ga0496123_0191822_142_723 193
323 3300048927 Ga0496124_0000381 Ga0496124_0000381_16271_16855 193
324 3300048928 Ga0496125_0002397 Ga0496125_0002397_18433_19014 193
325 3300048929 Ga0496126_0032185 Ga0496126_0032185_3475_4056 193
326 3300048929 Ga0496126_0330734 Ga0496126_0330734_451_1038 193
327 3300048929 Ga0496126_0849363 Ga0496126_0849363_43_624 193
328 3300049460 Ga0495682_0007157 Ga0495682_0007157_2244_2834 193
329 3300050516 nmdc:mga0sz30_216047_c1 nmdc:mga0sz30_216047_c1_100_681 193
330 3300053160 Ga0500633_0093742 Ga0500633_0093742_235_816 193
331 3300053730 Ga0500645_001061 Ga0500645_001061_11729_12319 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

4

178

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8435 2 182
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8067 2 182
5xtc-assembly1.cif.gz_m cryo-em structure of human respiratory complex i transmembrane arm 0.5525 1 153
1i5n-assembly2.cif.gz_B crystal structure of the p1 domain of chea from salmonella typhimurium 0.4183 1 132
1i5n-assembly2.cif.gz_B crystal structure of the p1 domain of chea from salmonella typhimurium 0.4118 1 132
ID Description Score Start End Superfamily
2lchA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);HPT domain 0.7621 11 64 1.20.120.160
af_A0A1D6I862_132_224_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4929 92 183 1.20.1280.290
af_O17274_240_390_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4869 1 73 1.20.58.390
af_Q5JJY5_143_235_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4638 88 186 1.20.1280.290
4qndA00 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4604 92 182 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A6P1QFZ4-F1-model_v4 deleted 0.9721 5 180
AF-A0A7G5IEN1-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9684 5 181 GO:0005886
GO:0034257
AF-A0A7C2J9G3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9678 81 181 GO:0005886
GO:0034257
AF-A0A511BVH4-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9669 5 184 GO:0005886
GO:0034257
AF-A0A0A8TK22-F1-model_v4 deleted 0.9615 5 188

Feature Viewer

pLDDT pTM Quality
89 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map