F410424

General Info

Members Datasets Scaffolds Average Seq Length
331 151 662 155

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100916255|Ga0070684_1009162551
Length 182
Sequence LEQAASVSQARVIYGVDGCTLELHAMRTISKRTQYGLKAMLALGRKYREGPILIGTLAREEAIPVKFLEAILLDLKGRGLLQSKMGRKGGYQLSRPPSAITIGSIIRIMEGPLAPLPCASETAFRACDECQDVENCGTRIIMRRVRDAISDVLDRTTLAELLKQVDSGRVDKAASEILMYHI

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 1.51
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 32.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100916255 3300005535 Unclassified 821
2 Ga0070658_10248524 3300005327 Unclassified 1509
3 Ga0070658_10321365 3300005327 Bacteria 1322
4 Ga0070658_10418735 3300005327 Unclassified 1152
5 Ga0070683_100569341 3300005329 Bacteria 1083
6 Ga0070683_100931922 3300005329 Unclassified 833
7 Ga0070670_100148387 3300005331 Bacteria 2029
8 Ga0070670_100472158 3300005331 Bacteria 1113
9 Ga0070666_10011356 3300005335 Bacteria 5587
10 Ga0070666_10165618 3300005335 Bacteria 1546
11 Ga0070666_10686787 3300005335 Unclassified 750
12 Ga0070680_100526399 3300005336 Unclassified 1012
13 Ga0070680_101284524 3300005336 Bacteria 633
14 Ga0070682_100959374 3300005337 Unclassified 707
15 Ga0068868_100009112 3300005338 Bacteria 7126
16 Ga0068868_101196789 3300005338 Unclassified 702
17 Ga0070660_100021551 3300005339 Unclassified 4754
18 Ga0070691_10308039 3300005341 Unclassified 867
19 Ga0070675_100614897 3300005354 Unclassified 986
20 Ga0070674_100461904 3300005356 Bacteria 1050
21 Ga0070674_100638292 3300005356 Unclassified 904
22 Ga0070659_100035092 3300005366 Bacteria 3903
23 Ga0070667_100419882 3300005367 Bacteria 1219
24 Ga0070667_100891923 3300005367 Bacteria 828
25 Ga0070714_100231253 3300005435 Unclassified 1703
26 Ga0070681_10095484 3300005458 Bacteria 2922
27 Ga0070681_10149680 3300005458 Bacteria 2261
28 Ga0070681_11737843 3300005458 Unclassified 550
29 Ga0068867_100036106 3300005459 Bacteria 3586
30 Ga0070685_10099945 3300005466 Bacteria 1770
31 Ga0070699_100007945 3300005518 Bacteria 9212
32 Ga0070679_100144894 3300005530 Bacteria 2353
33 Ga0070679_100363304 3300005530 Bacteria 1395
34 Ga0070684_100068199 3300005535 Unclassified 3126
35 Ga0070684_101821228 3300005535 Unclassified 574
36 Ga0068853_100070049 3300005539 Unclassified 3052
37 Ga0068853_100594075 3300005539 Bacteria 1051
38 Ga0070686_100340309 3300005544 Bacteria 1124
39 Ga0070665_100030064 3300005548 Bacteria 5466
40 Ga0070665_100160116 3300005548 Unclassified 2253
41 Ga0070665_100330574 3300005548 Bacteria 1529
42 Ga0070665_100832344 3300005548 Bacteria 936
43 Ga0068855_100027972 3300005563 Bacteria 6744
44 Ga0068855_100033409 3300005563 Bacteria 6139
45 Ga0068855_100228540 3300005563 Bacteria 2084
46 Ga0070664_100071422 3300005564 Bacteria 2975
47 Ga0068857_100004590 3300005577 Bacteria 11694
48 Ga0068854_100366643 3300005578 Unclassified 1183
49 Ga0068856_100014674 3300005614 Bacteria 7562
50 Ga0068856_100093328 3300005614 Unclassified 2995
51 Ga0068856_100173423 3300005614 Bacteria 2169
52 Ga0068856_100534217 3300005614 Bacteria 1194
53 Ga0068856_100602468 3300005614 Unclassified 1120
54 Ga0068856_100828263 3300005614 Bacteria 945
55 Ga0068856_101030878 3300005614 Unclassified 841
56 Ga0068852_100003156 3300005616 Bacteria 11496
57 Ga0068852_100562165 3300005616 Bacteria 1142
58 Ga0068852_100788288 3300005616 Bacteria 964
59 Ga0068859_100014526 3300005617 Bacteria 7907
60 Ga0068859_100194253 3300005617 Unclassified 2114
61 Ga0068859_100412705 3300005617 Bacteria 1446
62 Ga0068859_102193675 3300005617 Unclassified 609
63 Ga0068864_100003580 3300005618 Bacteria 12842
64 Ga0068864_100054913 3300005618 Bacteria 3438
65 Ga0068864_100832213 3300005618 Unclassified 909
66 Ga0068864_101904794 3300005618 Unclassified 600
67 Ga0068866_10524210 3300005718 Bacteria 788
68 Ga0068863_100057439 3300005841 Bacteria 3683
69 Ga0068863_100084452 3300005841 Bacteria 3009
70 Ga0068863_100154640 3300005841 Bacteria 2196
71 Ga0068858_100004914 3300005842 Bacteria 13093
72 Ga0068858_100321290 3300005842 Bacteria 1479
73 Ga0068858_100392703 3300005842 Unclassified 1332
74 Ga0068858_100825593 3300005842 Bacteria 905
75 Ga0068860_100015154 3300005843 Bacteria 7531
76 Ga0068860_100374384 3300005843 Bacteria 1405
77 Ga0097621_100007337 3300006237 Bacteria 7881
78 Ga0097621_100216912 3300006237 Bacteria 1666
79 Ga0097621_100552799 3300006237 Unclassified 1048
80 Ga0097621_100859225 3300006237 Unclassified 843
81 Ga0097621_102015771 3300006237 Unclassified 551
82 Ga0068871_100018256 3300006358 Bacteria 5328
83 Ga0068871_100119834 3300006358 Bacteria 2222
84 Ga0068871_100130232 3300006358 Unclassified 2133
85 Ga0068871_100371787 3300006358 Unclassified 1268
86 Ga0075429_100563622 3300006880 Bacteria 998
87 Ga0068865_100063080 3300006881 Bacteria 2603
88 Ga0097620_100014526 3300006931 Bacteria 7907
89 Ga0097620_100194247 3300006931 Unclassified 2114
90 Ga0097620_100412701 3300006931 Bacteria 1446
91 Ga0097620_102194748 3300006931 Unclassified 609
92 Ga0105240_10000381 3300009093 Bacteria 83148
93 Ga0105240_10027125 3300009093 Bacteria 7505
94 Ga0105240_10100788 3300009093 Bacteria 3514
95 Ga0105240_10142358 3300009093 Unclassified 2866
96 Ga0105240_10264022 3300009093 Bacteria 1985
97 Ga0105240_10288051 3300009093 Bacteria 1884
98 Ga0105240_10911903 3300009093 Bacteria 945
99 Ga0105240_11027057 3300009093 Bacteria 880
100 Ga0105240_11122556 3300009093 Unclassified 836
101 Ga0105245_10018544 3300009098 Bacteria 6086
102 Ga0105245_10020680 3300009098 Bacteria 5770
103 Ga0105245_10027745 3300009098 Bacteria 4989
104 Ga0105245_10169316 3300009098 Unclassified 2079
105 Ga0105245_10515690 3300009098 Bacteria 1213
106 Ga0105247_10047369 3300009101 Bacteria 2639
107 Ga0105241_10106952 3300009174 Bacteria 2233
108 Ga0105241_10107330 3300009174 Unclassified 2230
109 Ga0105241_10205771 3300009174 Unclassified 1646
110 Ga0105241_10359562 3300009174 Bacteria 1266
111 Ga0105242_10008417 3300009176 Bacteria 7930
112 Ga0105242_10065838 3300009176 Bacteria 2991
113 Ga0105242_10066473 3300009176 Bacteria 2977
114 Ga0105242_10444211 3300009176 Unclassified 1221
115 Ga0105242_10697480 3300009176 Unclassified 993
116 Ga0105248_10017681 3300009177 Bacteria 7864
117 Ga0105248_10030092 3300009177 Bacteria 6059
118 Ga0105248_10180132 3300009177 Bacteria 2381
119 Ga0105248_10574140 3300009177 Bacteria 1272
120 Ga0105248_10750918 3300009177 Unclassified 1101
121 Ga0105237_10014044 3300009545 Bacteria 8378
122 Ga0105237_10030978 3300009545 Bacteria 5425
123 Ga0105237_10183465 3300009545 Unclassified 2092
124 Ga0105237_10254292 3300009545 Bacteria 1759
125 Ga0105237_10462050 3300009545 Unclassified 1275
126 Ga0105237_10488998 3300009545 Bacteria 1237
127 Ga0105237_10714560 3300009545 Bacteria 1009
128 Ga0105237_11719043 3300009545 Bacteria 635
129 Ga0105238_10021714 3300009551 Bacteria 6539
130 Ga0105238_10025180 3300009551 Bacteria 6064
131 Ga0105238_10029185 3300009551 Bacteria 5620
132 Ga0105238_10084885 3300009551 Bacteria 3155
133 Ga0105238_10348129 3300009551 Bacteria 1471
134 Ga0105238_11319444 3300009551 Unclassified 748
135 Ga0105238_12176588 3300009551 Unclassified 589
136 Ga0105238_12446486 3300009551 Unclassified 558
137 Ga0105249_10076447 3300009553 Bacteria 3103
138 Ga0105239_10270476 3300010375 Bacteria 1911
139 Ga0105239_10370359 3300010375 Unclassified 1619
140 Ga0105239_10567290 3300010375 Unclassified 1293
141 Ga0105239_10831631 3300010375 Bacteria 1058
142 Ga0105239_12326547 3300010375 Bacteria 624
143 Ga0105246_10506222 3300011119 Bacteria 1026
144 Ga0105246_11209371 3300011119 Bacteria 696
145 Ga0157370_10044633 3300013104 Unclassified 4258
146 Ga0157370_10122023 3300013104 Unclassified 2433
147 Ga0157370_10474869 3300013104 Bacteria 1149
148 Ga0157370_10631236 3300013104 Bacteria 980
149 Ga0157369_10010431 3300013105 Bacteria 10587
150 Ga0157369_10067084 3300013105 Bacteria 3859
151 Ga0157369_10086616 3300013105 Bacteria 3345
152 Ga0157369_10595064 3300013105 Unclassified 1142
153 Ga0157374_10101445 3300013296 Bacteria 2759
154 Ga0157374_10392950 3300013296 Unclassified 1382
155 Ga0157374_11342289 3300013296 Unclassified 737
156 Ga0157378_10011657 3300013297 Bacteria 7694
157 Ga0157378_10086505 3300013297 Bacteria 2842
158 Ga0157378_10618214 3300013297 Bacteria 1096
159 Ga0157378_10981866 3300013297 Bacteria 878
160 Ga0157378_11418016 3300013297 Unclassified 738
161 Ga0163162_10006295 3300013306 Bacteria 11496
162 Ga0163162_10029974 3300013306 Bacteria 5387
163 Ga0163162_10503587 3300013306 Unclassified 1341
164 Ga0157372_10113027 3300013307 Unclassified 3112
165 Ga0157372_10267778 3300013307 Bacteria 1985
166 Ga0157372_11537541 3300013307 Unclassified 766
167 Ga0157375_10088986 3300013308 Bacteria 3143
168 Ga0157375_10151987 3300013308 Bacteria 2451
169 Ga0157375_10226969 3300013308 Unclassified 2026
170 Ga0157375_10320591 3300013308 Unclassified 1714
171 Ga0157375_10564271 3300013308 Bacteria 1299
172 Ga0157375_10789646 3300013308 Unclassified 1099
173 Ga0157375_11823495 3300013308 Unclassified 721
174 Ga0157375_11958232 3300013308 Bacteria 696
175 Ga0163163_10007008 3300014325 Bacteria 9901
176 Ga0163163_10009094 3300014325 Bacteria 8852
177 Ga0163163_10028822 3300014325 Bacteria 5336
178 Ga0163163_10047305 3300014325 Bacteria 4228
179 Ga0163163_10887121 3300014325 Bacteria 955
180 Ga0163163_11479159 3300014325 Bacteria 741
181 Ga0163163_11842857 3300014325 Unclassified 665
182 Ga0157379_10032827 3300014968 Bacteria 4629
183 Ga0157379_10040130 3300014968 Bacteria 4177
184 Ga0157379_10768185 3300014968 Unclassified 908
185 Ga0157379_10881723 3300014968 Bacteria 848
186 Ga0157379_11283122 3300014968 Unclassified 707
187 Ga0157379_12259044 3300014968 Unclassified 541
188 Ga0157376_10433457 3300014969 Bacteria 1278
189 Ga0157376_11374725 3300014969 Unclassified 737
190 Ga0213875_10015738 3300021388 Bacteria 3677
191 Ga0213875_10032620 3300021388 Bacteria 2460
192 Ga0207645_10202212 3300025907 Bacteria 1307
193 Ga0207705_10382453 3300025909 Unclassified 1087
194 Ga0207705_10436599 3300025909 Unclassified 1014
195 Ga0207654_10382639 3300025911 Bacteria 975
196 Ga0207654_10533786 3300025911 Bacteria 832
197 Ga0207654_10925095 3300025911 Unclassified 633
198 Ga0207707_10111297 3300025912 Bacteria 2394
199 Ga0207707_10451985 3300025912 Bacteria 1099
200 Ga0207695_10025886 3300025913 Bacteria 6556
201 Ga0207695_10031076 3300025913 Bacteria 5867
202 Ga0207695_10045168 3300025913 Unclassified 4679
203 Ga0207695_10103137 3300025913 Bacteria 2844
204 Ga0207695_10236909 3300025913 Bacteria 1727
205 Ga0207695_10240293 3300025913 Bacteria 1712
206 Ga0207695_10852326 3300025913 Bacteria 791
207 Ga0207671_10076562 3300025914 Bacteria 2504
208 Ga0207671_10534129 3300025914 Bacteria 935
209 Ga0207660_10995351 3300025917 Bacteria 684
210 Ga0207652_10037405 3300025921 Bacteria 4108
211 Ga0207652_10056550 3300025921 Bacteria 3377
212 Ga0207694_10078488 3300025924 Bacteria 2588
213 Ga0207694_10291368 3300025924 Bacteria 1342
214 Ga0207694_10457727 3300025924 Unclassified 1066
215 Ga0207650_10146803 3300025925 Bacteria 1858
216 Ga0207687_10038269 3300025927 Bacteria 3278
217 Ga0207700_10174197 3300025928 Bacteria 1797
218 Ga0207686_10348408 3300025934 Bacteria 1114
219 Ga0207686_10657077 3300025934 Unclassified 830
220 Ga0207711_10098059 3300025941 Bacteria 2589
221 Ga0207711_10113491 3300025941 Bacteria 2412
222 Ga0207711_10266963 3300025941 Bacteria 1574
223 Ga0207711_10686176 3300025941 Unclassified 955
224 Ga0207711_10725941 3300025941 Unclassified 926
225 Ga0207711_10858563 3300025941 Unclassified 844
226 Ga0207661_10008545 3300025944 Bacteria 7319
227 Ga0207667_10020423 3300025949 Bacteria 7367
228 Ga0207667_10021089 3300025949 Bacteria 7226
229 Ga0207667_10132037 3300025949 Unclassified 2572
230 Ga0207667_11311568 3300025949 Bacteria 700
231 Ga0207667_11416275 3300025949 Bacteria 668
232 Ga0207712_10178885 3300025961 Bacteria 1664
233 Ga0207658_10433600 3300025986 Bacteria 1161
234 Ga0207658_11222494 3300025986 Bacteria 687
235 Ga0207677_10159702 3300026023 Bacteria 1750
236 Ga0207677_11183116 3300026023 Bacteria 699
237 Ga0207703_10082770 3300026035 Bacteria 2680
238 Ga0207703_10289290 3300026035 Unclassified 1491
239 Ga0207639_10076044 3300026041 Unclassified 2642
240 Ga0207639_10153805 3300026041 Bacteria 1930
241 Ga0207702_10146003 3300026078 Bacteria 2147
242 Ga0207702_10558809 3300026078 Bacteria 1120
243 Ga0207702_10673112 3300026078 Bacteria 1019
244 Ga0207702_11485894 3300026078 Bacteria 671
245 Ga0207641_10035090 3300026088 Bacteria 4177
246 Ga0207641_10036942 3300026088 Bacteria 4078
247 Ga0207641_10397338 3300026088 Unclassified 1323
248 Ga0207641_10403686 3300026088 Bacteria 1313
249 Ga0207641_10785627 3300026088 Unclassified 941
250 Ga0207676_10323140 3300026095 Bacteria 1417
251 Ga0207676_10523621 3300026095 Unclassified 1129
252 Ga0207683_10463820 3300026121 Unclassified 1168
253 Ga0207683_11234572 3300026121 Unclassified 692
254 Ga0207698_10610058 3300026142 Unclassified 1077
255 Ga0268266_10033819 3300028379 Unclassified 4344
256 Ga0265338_10083055 3300028800 Bacteria 2681
257 Ga0265331_10146258 3300031250 Bacteria 1074
258 Ga0265316_10044752 3300031344 Bacteria 3518
259 Ga0265313_10364059 3300031595 Unclassified 571
260 Ga0265314_10002520 3300031711 Bacteria 18664
261 Ga0307416_101014865 3300032002 Unclassified 933
262 Ga0373955_0391387 3300035172 Bacteria 844
263 Ga0373955_0667943 3300035172 Unclassified 637
264 Ga0373931_0963132 3300035691 Unclassified 576
265 Ga0373933_0562283 3300035724 Bacteria 748
266 Ga0373947_0209856 3300035725 Unclassified 1277
267 Ga0373937_0545111 3300036401 Unclassified 1102
268 Ga0373937_1017337 3300036401 Bacteria 777
269 Ga0373937_1687691 3300036401 Bacteria 580
270 Ga0436364_0088281 3300037853 Bacteria 3749
271 Ga0436364_0295060 3300037853 Bacteria 4032
272 Ga0436364_0786163 3300037853 Bacteria 977
273 Ga0436364_0915998 3300037853 Bacteria 12132
274 Ga0436365_1473787 3300039437 Bacteria 862
275 Ga0436365_1569813 3300039437 Bacteria 4268
276 Ga0451576_0122066 3300045051 Unclassified 2713
277 Ga0495651_0247337 3300046462 Unclassified 1220
278 Ga0495580_0063820 3300046472 Unclassified 2582
279 Ga0495580_0106688 3300046472 Unclassified 1945
280 Ga0495580_0265676 3300046472 Bacteria 1173
281 Ga0495580_0318657 3300046472 Bacteria 1057
282 Ga0495594_0091891 3300046499 Unclassified 1701
283 Ga0495594_0766293 3300046499 Unclassified 544
284 Ga0495587_0370372 3300046536 Unclassified 797
285 Ga0495645_0655083 3300046543 Bacteria 641
286 Ga0495633_0447616 3300046558 Bacteria 583
287 Ga0495674_0020719 3300047319 Bacteria 6089
288 Ga0495675_0169995 3300047444 Bacteria 1339
289 Ga0495684_0040658 3300047471 Bacteria 3564
290 Ga0495684_0614866 3300047471 Unclassified 731
291 Ga0496100_0874516 3300048903 Unclassified 705
292 Ga0496104_0433021 3300048907 Bacteria 1227
293 Ga0496104_0730058 3300048907 Unclassified 898
294 Ga0496110_0540659 3300048913 Unclassified 1059
295 Ga0496114_0411937 3300048917 Unclassified 1197
296 Ga0501031_0068965 3300049568 Bacteria 2303
297 Ga0501032_0000753 3300049569 Bacteria 26307
298 Ga0501033_0031533 3300049570 Bacteria 3982
299 Ga0501034_0037712 3300049571 Bacteria 4895
300 Ga0501036_0000903 3300049572 Bacteria 22237
301 Ga0501037_0006095 3300049573 Bacteria 8813
302 Ga0501038_0018082 3300049574 Bacteria 6367
303 Ga0501039_0002253 3300049575 Bacteria 14308
304 Ga0501042_1220568 3300049578 Unclassified 548
305 Ga0501043_0006128 3300049579 Bacteria 9658
306 Ga0501046_0001219 3300049580 Bacteria 24926
307 Ga0501047_0034350 3300049581 Bacteria 4895
308 Ga0501048_0045632 3300049582 Bacteria 3130
309 Ga0501067_0000509 3300049583 Bacteria 21255
310 Ga0501068_0000678 3300049584 Bacteria 17415
311 Ga0501069_0003417 3300049585 Bacteria 8153
312 Ga0501070_0014085 3300049586 Bacteria 6732
313 Ga0501072_0001402 3300049588 Bacteria 18127
314 Ga0501073_0000471 3300049589 Bacteria 27854
315 Ga0501074_0108609 3300049590 Bacteria 1985
316 Ga0501075_0182474 3300049591 Bacteria 1601
317 Ga0501076_0022531 3300049592 Bacteria 4841
318 Ga0501077_0072468 3300049593 Bacteria 2183
319 Ga0501253_043875 3300049683 Bacteria 912
320 Ga0501079_0007513 3300049741 Bacteria 8245
321 Ga0501080_0000006 3300049742 Bacteria 138444
322 Ga0501083_0012241 3300049744 Bacteria 6003
323 Ga0501035_0011422 3300049822 Bacteria 8234
324 Ga0501044_0026136 3300049823 Bacteria 6182
325 Ga0501045_0380012 3300049824 Bacteria 1051
326 nmdc:mga09592_385908_c1 3300050508 Bacteria 1211
327 Ga0500616_0111739 3300053153 Unclassified 1319
328 Ga0501084_0000747 3300054114 Bacteria 24758
329 Ga0501082_0026094 3300060353 Bacteria 5036
330 Ga0501082_0088462 3300060353 Bacteria 2673
331 Ga0530510_0308953 3300061734 Bacteria 1184
332 Ga0070684_100916255
333 Ga0070658_10248524
334 Ga0070658_10321365
335 Ga0070658_10418735
336 Ga0070683_100569341
337 Ga0070683_100931922
338 Ga0070670_100148387
339 Ga0070670_100472158
340 Ga0070666_10011356
341 Ga0070666_10165618
342 Ga0070666_10686787
343 Ga0070680_100526399
344 Ga0070680_101284524
345 Ga0070682_100959374
346 Ga0068868_100009112
347 Ga0068868_101196789
348 Ga0070660_100021551
349 Ga0070691_10308039
350 Ga0070675_100614897
351 Ga0070674_100461904
352 Ga0070674_100638292
353 Ga0070659_100035092
354 Ga0070667_100419882
355 Ga0070667_100891923
356 Ga0070714_100231253
357 Ga0070681_10095484
358 Ga0070681_10149680
359 Ga0070681_11737843
360 Ga0068867_100036106
361 Ga0070685_10099945
362 Ga0070699_100007945
363 Ga0070679_100144894
364 Ga0070679_100363304
365 Ga0070684_100068199
366 Ga0070684_101821228
367 Ga0068853_100070049
368 Ga0068853_100594075
369 Ga0070686_100340309
370 Ga0070665_100030064
371 Ga0070665_100160116
372 Ga0070665_100330574
373 Ga0070665_100832344
374 Ga0068855_100027972
375 Ga0068855_100033409
376 Ga0068855_100228540
377 Ga0070664_100071422
378 Ga0068857_100004590
379 Ga0068854_100366643
380 Ga0068856_100014674
381 Ga0068856_100093328
382 Ga0068856_100173423
383 Ga0068856_100534217
384 Ga0068856_100602468
385 Ga0068856_100828263
386 Ga0068856_101030878
387 Ga0068852_100003156
388 Ga0068852_100562165
389 Ga0068852_100788288
390 Ga0068859_100014526
391 Ga0068859_100194253
392 Ga0068859_100412705
393 Ga0068859_102193675
394 Ga0068864_100003580
395 Ga0068864_100054913
396 Ga0068864_100832213
397 Ga0068864_101904794
398 Ga0068866_10524210
399 Ga0068863_100057439
400 Ga0068863_100084452
401 Ga0068863_100154640
402 Ga0068858_100004914
403 Ga0068858_100321290
404 Ga0068858_100392703
405 Ga0068858_100825593
406 Ga0068860_100015154
407 Ga0068860_100374384
408 Ga0097621_100007337
409 Ga0097621_100216912
410 Ga0097621_100552799
411 Ga0097621_100859225
412 Ga0097621_102015771
413 Ga0068871_100018256
414 Ga0068871_100119834
415 Ga0068871_100130232
416 Ga0068871_100371787
417 Ga0075429_100563622
418 Ga0068865_100063080
419 Ga0097620_100014526
420 Ga0097620_100194247
421 Ga0097620_100412701
422 Ga0097620_102194748
423 Ga0105240_10000381
424 Ga0105240_10027125
425 Ga0105240_10100788
426 Ga0105240_10142358
427 Ga0105240_10264022
428 Ga0105240_10288051
429 Ga0105240_10911903
430 Ga0105240_11027057
431 Ga0105240_11122556
432 Ga0105245_10018544
433 Ga0105245_10020680
434 Ga0105245_10027745
435 Ga0105245_10169316
436 Ga0105245_10515690
437 Ga0105247_10047369
438 Ga0105241_10106952
439 Ga0105241_10107330
440 Ga0105241_10205771
441 Ga0105241_10359562
442 Ga0105242_10008417
443 Ga0105242_10065838
444 Ga0105242_10066473
445 Ga0105242_10444211
446 Ga0105242_10697480
447 Ga0105248_10017681
448 Ga0105248_10030092
449 Ga0105248_10180132
450 Ga0105248_10574140
451 Ga0105248_10750918
452 Ga0105237_10014044
453 Ga0105237_10030978
454 Ga0105237_10183465
455 Ga0105237_10254292
456 Ga0105237_10462050
457 Ga0105237_10488998
458 Ga0105237_10714560
459 Ga0105237_11719043
460 Ga0105238_10021714
461 Ga0105238_10025180
462 Ga0105238_10029185
463 Ga0105238_10084885
464 Ga0105238_10348129
465 Ga0105238_11319444
466 Ga0105238_12176588
467 Ga0105238_12446486
468 Ga0105249_10076447
469 Ga0105239_10270476
470 Ga0105239_10370359
471 Ga0105239_10567290
472 Ga0105239_10831631
473 Ga0105239_12326547
474 Ga0105246_10506222
475 Ga0105246_11209371
476 Ga0157370_10044633
477 Ga0157370_10122023
478 Ga0157370_10474869
479 Ga0157370_10631236
480 Ga0157369_10010431
481 Ga0157369_10067084
482 Ga0157369_10086616
483 Ga0157369_10595064
484 Ga0157374_10101445
485 Ga0157374_10392950
486 Ga0157374_11342289
487 Ga0157378_10011657
488 Ga0157378_10086505
489 Ga0157378_10618214
490 Ga0157378_10981866
491 Ga0157378_11418016
492 Ga0163162_10006295
493 Ga0163162_10029974
494 Ga0163162_10503587
495 Ga0157372_10113027
496 Ga0157372_10267778
497 Ga0157372_11537541
498 Ga0157375_10088986
499 Ga0157375_10151987
500 Ga0157375_10226969
501 Ga0157375_10320591
502 Ga0157375_10564271
503 Ga0157375_10789646
504 Ga0157375_11823495
505 Ga0157375_11958232
506 Ga0163163_10007008
507 Ga0163163_10009094
508 Ga0163163_10028822
509 Ga0163163_10047305
510 Ga0163163_10887121
511 Ga0163163_11479159
512 Ga0163163_11842857
513 Ga0157379_10032827
514 Ga0157379_10040130
515 Ga0157379_10768185
516 Ga0157379_10881723
517 Ga0157379_11283122
518 Ga0157379_12259044
519 Ga0157376_10433457
520 Ga0157376_11374725
521 Ga0213875_10015738
522 Ga0213875_10032620
523 Ga0207645_10202212
524 Ga0207705_10382453
525 Ga0207705_10436599
526 Ga0207654_10382639
527 Ga0207654_10533786
528 Ga0207654_10925095
529 Ga0207707_10111297
530 Ga0207707_10451985
531 Ga0207695_10025886
532 Ga0207695_10031076
533 Ga0207695_10045168
534 Ga0207695_10103137
535 Ga0207695_10236909
536 Ga0207695_10240293
537 Ga0207695_10852326
538 Ga0207671_10076562
539 Ga0207671_10534129
540 Ga0207660_10995351
541 Ga0207652_10037405
542 Ga0207652_10056550
543 Ga0207694_10078488
544 Ga0207694_10291368
545 Ga0207694_10457727
546 Ga0207650_10146803
547 Ga0207687_10038269
548 Ga0207700_10174197
549 Ga0207686_10348408
550 Ga0207686_10657077
551 Ga0207711_10098059
552 Ga0207711_10113491
553 Ga0207711_10266963
554 Ga0207711_10686176
555 Ga0207711_10725941
556 Ga0207711_10858563
557 Ga0207661_10008545
558 Ga0207667_10020423
559 Ga0207667_10021089
560 Ga0207667_10132037
561 Ga0207667_11311568
562 Ga0207667_11416275
563 Ga0207712_10178885
564 Ga0207658_10433600
565 Ga0207658_11222494
566 Ga0207677_10159702
567 Ga0207677_11183116
568 Ga0207703_10082770
569 Ga0207703_10289290
570 Ga0207639_10076044
571 Ga0207639_10153805
572 Ga0207702_10146003
573 Ga0207702_10558809
574 Ga0207702_10673112
575 Ga0207702_11485894
576 Ga0207641_10035090
577 Ga0207641_10036942
578 Ga0207641_10397338
579 Ga0207641_10403686
580 Ga0207641_10785627
581 Ga0207676_10323140
582 Ga0207676_10523621
583 Ga0207683_10463820
584 Ga0207683_11234572
585 Ga0207698_10610058
586 Ga0268266_10033819
587 Ga0265338_10083055
588 Ga0265331_10146258
589 Ga0265316_10044752
590 Ga0265313_10364059
591 Ga0265314_10002520
592 Ga0307416_101014865
593 Ga0373955_0391387
594 Ga0373955_0667943
595 Ga0373931_0963132
596 Ga0373933_0562283
597 Ga0373947_0209856
598 Ga0373937_0545111
599 Ga0373937_1017337
600 Ga0373937_1687691
601 Ga0436364_0088281
602 Ga0436364_0295060
603 Ga0436364_0786163
604 Ga0436364_0915998
605 Ga0436365_1473787
606 Ga0436365_1569813
607 Ga0451576_0122066
608 Ga0495651_0247337
609 Ga0495580_0063820
610 Ga0495580_0106688
611 Ga0495580_0265676
612 Ga0495580_0318657
613 Ga0495594_0091891
614 Ga0495594_0766293
615 Ga0495587_0370372
616 Ga0495645_0655083
617 Ga0495633_0447616
618 Ga0495674_0020719
619 Ga0495675_0169995
620 Ga0495684_0040658
621 Ga0495684_0614866
622 Ga0496100_0874516
623 Ga0496104_0433021
624 Ga0496104_0730058
625 Ga0496110_0540659
626 Ga0496114_0411937
627 Ga0501031_0068965
628 Ga0501032_0000753
629 Ga0501033_0031533
630 Ga0501034_0037712
631 Ga0501036_0000903
632 Ga0501037_0006095
633 Ga0501038_0018082
634 Ga0501039_0002253
635 Ga0501042_1220568
636 Ga0501043_0006128
637 Ga0501046_0001219
638 Ga0501047_0034350
639 Ga0501048_0045632
640 Ga0501067_0000509
641 Ga0501068_0000678
642 Ga0501069_0003417
643 Ga0501070_0014085
644 Ga0501072_0001402
645 Ga0501073_0000471
646 Ga0501074_0108609
647 Ga0501075_0182474
648 Ga0501076_0022531
649 Ga0501077_0072468
650 Ga0501253_043875
651 Ga0501079_0007513
652 Ga0501080_0000006
653 Ga0501083_0012241
654 Ga0501035_0011422
655 Ga0501044_0026136
656 Ga0501045_0380012
657 nmdc:mga09592_385908_c1
658 Ga0500616_0111739
659 Ga0501084_0000747
660 Ga0501082_0026094
661 Ga0501082_0088462
662 Ga0530510_0308953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

29

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hso-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis marr family protein rv2887 complex with dna 0.9252 11 68
2heo-assembly1.cif.gz_A general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9186 9 68
2y75-assembly1.cif.gz_E the structure of cymr (yrzc) the global cysteine regulator of b. subtilis 0.9025 1 139
2y75-assembly1.cif.gz_C the structure of cymr (yrzc) the global cysteine regulator of b. subtilis 0.8998 1 136
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.8998 5 68
ID Description Score Start End Superfamily
af_Q8IHR0_748_830_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9457 10 61 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.918 12 68 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.91 5 68 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9064 11 68 1.10.10.10
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9033 9 54 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F4R8S7-F1-model_v4 Rrf2 family transcriptional regulator 0.9 3 147 GO:0003700
GO:0005829
AF-Q7M9T7-F1-model_v4 LIN1550 PROTEIN 0.8907 1 147 GO:0003700
GO:0005829
AF-A0A3B0V590-F1-model_v4 Iron-sulfur cluster regulator IscR 0.8864 1 146 GO:0003700
GO:0005829
AF-A0A7V5RAR4-F1-model_v4 Rrf2 family transcriptional regulator 0.8837 1 135 GO:0003700
GO:0005829
AF-A0A3E1E6W0-F1-model_v4 Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor 0.8799 3 145 GO:0003700
GO:0005829

Map