F410389

General Info

Members Datasets Scaffolds Average Seq Length
331 191 662 239

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100116261|Ga0070671_1001162612
Length 252
Sequence MKKRAFLCVVVLASIGTAWLLAQPAGDSLVDGFKTVEVASVSDAIEQLYGQRAYMSHEMRPLAVTKFAGTAVTVQLKREEHKEGSAASQGMLDAIDAAAPGSVYVMVLDNGAGPAASSWSNAGIDYAGIGGLMATAMKYRGFAGAVIDASVRDTPQIRKLQFPVFSRGVAPSTTINHFRVTGVNVPVTCAGVQVNPGDIITADEDGVAVVPAARAAEILKKSQELDDTEHRMIPFIEKFKSIKEAVKQFGRI

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.44
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 25.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100116261 3300005355 Bacteria 2249
2 Ga0065712_10000785 3300005290 Bacteria 8812
3 Ga0065715_10001029 3300005293 Bacteria 21388
4 Ga0065715_10168039 3300005293 Bacteria 1570
5 Ga0065707_10088325 3300005295 Bacteria 4692
6 Ga0070658_10195048 3300005327 Bacteria 1708
7 Ga0070683_100000001 3300005329 Bacteria 529385
8 Ga0070683_100001674 3300005329 Bacteria 17207
9 Ga0070683_100050847 3300005329 Bacteria 3838
10 Ga0070670_100005663 3300005331 Bacteria 10544
11 Ga0070670_100008943 3300005331 Bacteria 8554
12 Ga0070677_10024716 3300005333 Unclassified 2237
13 Ga0070666_10049414 3300005335 Bacteria 2827
14 Ga0070666_10348000 3300005335 Unclassified 1060
15 Ga0070680_100008992 3300005336 Bacteria 7658
16 Ga0070689_100315898 3300005340 Bacteria 1303
17 Ga0070687_100035394 3300005343 Bacteria 2479
18 Ga0070661_100042588 3300005344 Bacteria 3314
19 Ga0070668_100168411 3300005347 Unclassified 1782
20 Ga0070669_100000783 3300005353 Bacteria 23075
21 Ga0070669_100048699 3300005353 Bacteria 3093
22 Ga0070674_100016531 3300005356 Bacteria 4626
23 Ga0070674_100303729 3300005356 Bacteria 1273
24 Ga0070674_100649043 3300005356 Unclassified 897
25 Ga0070673_100220612 3300005364 Unclassified 1641
26 Ga0070673_100667906 3300005364 Unclassified 952
27 Ga0070667_100144515 3300005367 Bacteria 2085
28 Ga0070667_100145104 3300005367 Bacteria 2081
29 Ga0070667_100476987 3300005367 Unclassified 1142
30 Ga0070709_10199921 3300005434 Bacteria 1415
31 Ga0070700_100231596 3300005441 Bacteria 1315
32 Ga0070700_100329375 3300005441 Bacteria 1125
33 Ga0070700_100361227 3300005441 Unclassified 1080
34 Ga0070708_100222111 3300005445 Bacteria 1772
35 Ga0070663_100019714 3300005455 Bacteria 4453
36 Ga0070678_100288566 3300005456 Bacteria 1390
37 Ga0070678_100410219 3300005456 Bacteria 1179
38 Ga0070681_10004133 3300005458 Bacteria 13726
39 Ga0070681_10057854 3300005458 Bacteria 3857
40 Ga0070681_10376560 3300005458 Unclassified 1330
41 Ga0070685_10013060 3300005466 Unclassified 4372
42 Ga0070706_100106017 3300005467 Bacteria 2615
43 Ga0070706_100546840 3300005467 Bacteria 1077
44 Ga0070679_100141790 3300005530 Bacteria 2382
45 Ga0070684_100000055 3300005535 Bacteria 76528
46 Ga0070684_100021458 3300005535 Bacteria 5375
47 Ga0070684_100079964 3300005535 Bacteria 2891
48 Ga0070684_100201684 3300005535 Bacteria 1812
49 Ga0070684_100510921 3300005535 Bacteria 1113
50 Ga0070684_100666087 3300005535 Bacteria 969
51 Ga0068853_100935526 3300005539 Bacteria 833
52 Ga0070672_100029099 3300005543 Bacteria 4140
53 Ga0070686_100534046 3300005544 Bacteria 915
54 Ga0070696_100312292 3300005546 Bacteria 1207
55 Ga0070693_100018312 3300005547 Bacteria 3656
56 Ga0070665_100113851 3300005548 Unclassified 2708
57 Ga0068855_100029183 3300005563 Bacteria 6597
58 Ga0068855_100042015 3300005563 Bacteria 5418
59 Ga0070664_100188814 3300005564 Bacteria 1835
60 Ga0068854_100290190 3300005578 Bacteria 1320
61 Ga0070702_100301686 3300005615 Unclassified 1108
62 Ga0068852_100064411 3300005616 Bacteria 3195
63 Ga0068859_100275410 3300005617 Bacteria 1775
64 Ga0068859_100698626 3300005617 Bacteria 1105
65 Ga0068861_100029494 3300005719 Unclassified 4014
66 Ga0068861_100166194 3300005719 Bacteria 1824
67 Ga0068863_100038361 3300005841 Unclassified 4558
68 Ga0068863_100214222 3300005841 Bacteria 1855
69 Ga0068863_100651117 3300005841 Unclassified 1045
70 Ga0068858_100309867 3300005842 Bacteria 1507
71 Ga0068860_100509013 3300005843 Bacteria 1203
72 Ga0068862_100013103 3300005844 Bacteria 6857
73 Ga0081455_10267360 3300005937 Bacteria 1242
74 Ga0070717_10025557 3300006028 Bacteria 4699
75 Ga0070717_10263848 3300006028 Unclassified 1524
76 Ga0070717_10430145 3300006028 Unclassified 1188
77 Ga0070717_10666021 3300006028 Unclassified 945
78 Ga0097621_100092986 3300006237 Bacteria 2526
79 Ga0097621_100830066 3300006237 Bacteria 858
80 Ga0068871_100290217 3300006358 Bacteria 1433
81 Ga0068871_100325646 3300006358 Unclassified 1354
82 Ga0068871_100332712 3300006358 Bacteria 1340
83 Ga0068871_100507338 3300006358 Unclassified 1088
84 Ga0075428_100948802 3300006844 Bacteria 911
85 Ga0075430_100504791 3300006846 Bacteria 998
86 Ga0075433_10008951 3300006852 Bacteria 7993
87 Ga0075434_100269494 3300006871 Archaea 1722
88 Ga0068865_100173286 3300006881 Bacteria 1656
89 Ga0075436_100021148 3300006914 Bacteria 4464
90 Ga0097620_100275414 3300006931 Bacteria 1775
91 Ga0097620_100698473 3300006931 Bacteria 1105
92 Ga0075435_100103156 3300007076 Unclassified 2365
93 Ga0105240_10001246 3300009093 Bacteria 44166
94 Ga0105240_10001247 3300009093 Bacteria 44160
95 Ga0105240_10001467 3300009093 Bacteria 40325
96 Ga0105240_10002544 3300009093 Bacteria 29242
97 Ga0105240_10041179 3300009093 Bacteria 5899
98 Ga0105240_10128210 3300009093 Bacteria 3046
99 Ga0105240_10168671 3300009093 Unclassified 2594
100 Ga0105240_10273531 3300009093 Bacteria 1943
101 Ga0111539_10029418 3300009094 Bacteria 6690
102 Ga0111539_10110928 3300009094 Unclassified 3219
103 Ga0105245_10475285 3300009098 Unclassified 1262
104 Ga0114129_10005526 3300009147 Bacteria 17880
105 Ga0105248_10058765 3300009177 Bacteria 4318
106 Ga0105248_10089313 3300009177 Unclassified 3469
107 Ga0105237_10001650 3300009545 Bacteria 28964
108 Ga0105237_10009198 3300009545 Bacteria 10605
109 Ga0105237_10052948 3300009545 Bacteria 4072
110 Ga0105238_10170465 3300009551 Bacteria 2152
111 Ga0105238_10261713 3300009551 Bacteria 1709
112 Ga0105238_10602323 3300009551 Unclassified 1107
113 Ga0105249_10018452 3300009553 Bacteria 6207
114 Ga0105249_10044446 3300009553 Bacteria 4039
115 Ga0105249_10662949 3300009553 Unclassified 1102
116 Ga0105239_10100354 3300010375 Unclassified 3202
117 Ga0105239_10443637 3300010375 Bacteria 1472
118 Ga0105246_10216675 3300011119 Bacteria 1498
119 Ga0105246_10302471 3300011119 Bacteria 1292
120 Ga0157369_10008657 3300013105 Bacteria 11667
121 Ga0157369_10207751 3300013105 Unclassified 2053
122 Ga0157369_10247177 3300013105 Bacteria 1862
123 Ga0157374_10072971 3300013296 Unclassified 3239
124 Ga0157378_10662096 3300013297 Bacteria 1061
125 Ga0157378_10878575 3300013297 Unclassified 926
126 Ga0163162_10028918 3300013306 Bacteria 5485
127 Ga0157372_10413934 3300013307 Unclassified 1571
128 Ga0157375_10059426 3300013308 Unclassified 3788
129 Ga0157375_10097642 3300013308 Bacteria 3013
130 Ga0157375_10276135 3300013308 Bacteria 1843
131 Ga0157375_10935082 3300013308 Bacteria 1009
132 Ga0163163_10009305 3300014325 Bacteria 8763
133 Ga0163163_10066292 3300014325 Bacteria 3585
134 Ga0163163_10074738 3300014325 Bacteria 3381
135 Ga0163163_11004099 3300014325 Bacteria 898
136 Ga0157380_10060082 3300014326 Bacteria 3036
137 Ga0157377_10057444 3300014745 Bacteria 2213
138 Ga0157376_10156624 3300014969 Bacteria 2061
139 Ga0157376_10695649 3300014969 Bacteria 1021
140 Ga0207688_10021759 3300025901 Unclassified 3506
141 Ga0207688_10159836 3300025901 Bacteria 1335
142 Ga0207680_10162499 3300025903 Bacteria 1499
143 Ga0207680_10173156 3300025903 Bacteria 1455
144 Ga0207680_10324084 3300025903 Unclassified 1078
145 Ga0207684_10204749 3300025910 Bacteria 1702
146 Ga0207684_10466389 3300025910 Bacteria 1084
147 Ga0207707_10027665 3300025912 Bacteria 4958
148 Ga0207707_10041231 3300025912 Bacteria 4031
149 Ga0207695_10002623 3300025913 Bacteria 26311
150 Ga0207695_10005769 3300025913 Bacteria 16300
151 Ga0207695_10011531 3300025913 Bacteria 10695
152 Ga0207695_10013833 3300025913 Bacteria 9599
153 Ga0207695_10066881 3300025913 Bacteria 3688
154 Ga0207695_10118310 3300025913 Bacteria 2621
155 Ga0207695_10212131 3300025913 Unclassified 1846
156 Ga0207695_10266305 3300025913 Unclassified 1610
157 Ga0207671_10003265 3300025914 Bacteria 16311
158 Ga0207671_10044995 3300025914 Bacteria 3263
159 Ga0207671_10052271 3300025914 Bacteria 3027
160 Ga0207671_10423656 3300025914 Bacteria 1059
161 Ga0207660_10059186 3300025917 Unclassified 2749
162 Ga0207662_10076661 3300025918 Bacteria 2032
163 Ga0207649_10049996 3300025920 Bacteria 2585
164 Ga0207652_10217176 3300025921 Bacteria 1723
165 Ga0207652_10613630 3300025921 Unclassified 975
166 Ga0207681_10014024 3300025923 Bacteria 4968
167 Ga0207681_10181744 3300025923 Unclassified 1603
168 Ga0207694_10233636 3300025924 Bacteria 1502
169 Ga0207694_10440665 3300025924 Bacteria 1087
170 Ga0207650_10039360 3300025925 Unclassified 3455
171 Ga0207650_10091720 3300025925 Bacteria 2322
172 Ga0207659_10132078 3300025926 Bacteria 1928
173 Ga0207687_10354942 3300025927 Bacteria 1195
174 Ga0207700_10124939 3300025928 Bacteria 2092
175 Ga0207669_10006381 3300025937 Bacteria 5384
176 Ga0207704_10036597 3300025938 Unclassified 2825
177 Ga0207704_10124353 3300025938 Unclassified 1772
178 Ga0207691_10053535 3300025940 Unclassified 3684
179 Ga0207691_10174845 3300025940 Unclassified 1879
180 Ga0207691_10191302 3300025940 Bacteria 1784
181 Ga0207711_10073156 3300025941 Bacteria 2979
182 Ga0207711_10505920 3300025941 Bacteria 1126
183 Ga0207661_10000005 3300025944 Bacteria 557888
184 Ga0207661_10002309 3300025944 Bacteria 13133
185 Ga0207661_10037041 3300025944 Bacteria 3812
186 Ga0207661_10133281 3300025944 Bacteria 2131
187 Ga0207661_10148134 3300025944 Bacteria 2027
188 Ga0207679_10182021 3300025945 Bacteria 1739
189 Ga0207667_10058954 3300025949 Bacteria 4024
190 Ga0207667_10168921 3300025949 Unclassified 2248
191 Ga0207667_10174634 3300025949 Unclassified 2208
192 Ga0207651_10410176 3300025960 Unclassified 1154
193 Ga0207651_10504890 3300025960 Bacteria 1046
194 Ga0207712_10037294 3300025961 Bacteria 3315
195 Ga0207712_10040071 3300025961 Unclassified 3212
196 Ga0207712_10523769 3300025961 Bacteria 1016
197 Ga0207658_10064746 3300025986 Bacteria 2743
198 Ga0207658_10316869 3300025986 Bacteria 1349
199 Ga0207703_10034239 3300026035 Bacteria 4030
200 Ga0207639_10202242 3300026041 Bacteria 1704
201 Ga0207678_10047185 3300026067 Bacteria 3725
202 Ga0207708_10557899 3300026075 Unclassified 966
203 Ga0207641_10141363 3300026088 Bacteria 2172
204 Ga0207641_10167387 3300026088 Bacteria 2003
205 Ga0207641_10208723 3300026088 Bacteria 1805
206 Ga0207648_10291623 3300026089 Bacteria 1461
207 Ga0207676_10043507 3300026095 Unclassified 3459
208 Ga0207676_10132055 3300026095 Bacteria 2125
209 Ga0207676_10337622 3300026095 Bacteria 1389
210 Ga0207675_100113689 3300026118 Bacteria 2556
211 Ga0207675_100257010 3300026118 Bacteria 1692
212 Ga0207683_10324623 3300026121 Unclassified 1410
213 Ga0207698_10014206 3300026142 Bacteria 5284
214 Ga0268266_10108527 3300028379 Unclassified 2456
215 Ga0268266_10258966 3300028379 Bacteria 1612
216 Ga0268265_10008847 3300028380 Bacteria 6805
217 Ga0268264_10511364 3300028381 Bacteria 1173
218 Ga0265323_10000374 3300028653 Bacteria 25844
219 Ga0265330_10137962 3300031235 Unclassified 1037
220 Ga0265316_10001209 3300031344 Bacteria 27826
221 Ga0265316_10032517 3300031344 Bacteria 4257
222 Ga0265316_10170537 3300031344 Bacteria 1623
223 Ga0265316_10422068 3300031344 Unclassified 959
224 Ga0265314_10062490 3300031711 Bacteria 2531
225 Ga0265342_10042377 3300031712 Bacteria 2750
226 Ga0265342_10124100 3300031712 Bacteria 1451
227 Ga0307413_10078959 3300031824 Bacteria 2102
228 Ga0307407_10021227 3300031903 Bacteria 3345
229 Ga0307412_10050726 3300031911 Bacteria 2740
230 Ga0307409_100047079 3300031995 Unclassified 3270
231 Ga0307409_100555946 3300031995 Bacteria 1127
232 Ga0307416_100724331 3300032002 Bacteria 1085
233 Ga0307415_100205911 3300032126 Unclassified 1565
234 Ga0373926_0037973 3300035083 Unclassified 1714
235 Ga0373945_0205658 3300035116 Bacteria 819
236 Ga0373954_0164868 3300035118 Unclassified 1085
237 Ga0373943_0289383 3300035170 Bacteria 928
238 Ga0373927_0003095 3300035695 Bacteria 12040
239 Ga0373927_0049602 3300035695 Bacteria 2714
240 Ga0373947_0000038 3300035725 Bacteria 63712
241 Ga0373947_0071812 3300035725 Bacteria 2124
242 Ga0373947_0490586 3300035725 Bacteria 834
243 Ga0373937_0079834 3300036401 Bacteria 3025
244 Ga0373937_0199435 3300036401 Bacteria 1881
245 Ga0373925_0471176 3300037068 Bacteria 1030
246 Ga0436364_0833987 3300037853 Bacteria 907
247 Ga0436365_0341137 3300039437 Bacteria 2210
248 Ga0439434_0106514 3300042435 Bacteria 906
249 Ga0466963_0418461 3300044694 Unclassified 945
250 Ga0451576_0047780 3300045051 Unclassified 4498
251 Ga0451576_0483461 3300045051 Unclassified 1301
252 Ga0451576_0515096 3300045051 Bacteria 1257
253 Ga0495651_0105045 3300046462 Unclassified 2096
254 Ga0495653_0408381 3300046463 Bacteria 862
255 Ga0495580_0035220 3300046472 Bacteria 3600
256 Ga0495580_0038013 3300046472 Bacteria 3450
257 Ga0495580_0072082 3300046472 Bacteria 2413
258 Ga0495580_0401122 3300046472 Bacteria 925
259 Ga0495594_0283953 3300046499 Bacteria 943
260 Ga0495594_0384361 3300046499 Bacteria 799
261 Ga0495630_0249442 3300046517 Bacteria 1356
262 Ga0495630_0346089 3300046517 Bacteria 1138
263 Ga0495666_0171622 3300046526 Bacteria 1003
264 Ga0495652_0230674 3300046529 Unclassified 1385
265 Ga0495652_0447534 3300046529 Unclassified 905
266 Ga0495665_0044775 3300046531 Bacteria 2351
267 Ga0495587_0109707 3300046536 Bacteria 1586
268 Ga0495587_0131507 3300046536 Unclassified 1430
269 Ga0495587_0169316 3300046536 Unclassified 1241
270 Ga0495645_0019865 3300046543 Bacteria 4842
271 Ga0495645_0265982 3300046543 Bacteria 1133
272 Ga0495667_0064871 3300046559 Bacteria 2389
273 Ga0495667_0202993 3300046559 Unclassified 1268
274 Ga0495635_0305530 3300046663 Bacteria 1066
275 Ga0495635_0369014 3300046663 Unclassified 956
276 Ga0495599_0221404 3300046678 Unclassified 1158
277 Ga0495623_0021849 3300046679 Bacteria 4133
278 Ga0495623_0070435 3300046679 Bacteria 2179
279 Ga0495623_0124741 3300046679 Bacteria 1547
280 Ga0495658_0479757 3300046683 Bacteria 795
281 Ga0495604_0451750 3300047317 Bacteria 839
282 Ga0495674_0000722 3300047319 Bacteria 31277
283 Ga0495674_0108819 3300047319 Bacteria 2351
284 Ga0495680_0121320 3300047322 Unclassified 1930
285 Ga0495675_0008460 3300047444 Bacteria 6378
286 Ga0495675_0179610 3300047444 Bacteria 1296
287 Ga0495675_0204329 3300047444 Unclassified 1201
288 Ga0495684_0007201 3300047471 Bacteria 8635
289 Ga0495684_0028669 3300047471 Bacteria 4274
290 Ga0495684_0377403 3300047471 Bacteria 1001
291 Ga0495593_0310236 3300047673 Bacteria 789
292 Ga0495602_0163331 3300048088 Unclassified 1736
293 Ga0495602_0244461 3300048088 Bacteria 1341
294 Ga0496101_0276541 3300048904 Bacteria 1312
295 Ga0496101_0277637 3300048904 Bacteria 1309
296 Ga0496103_0285860 3300048906 Unclassified 1061
297 Ga0496104_0002694 3300048907 Bacteria 15295
298 Ga0496105_0071786 3300048908 Unclassified 2861
299 Ga0496106_0349255 3300048909 Bacteria 1188
300 Ga0496108_0003882 3300048911 Bacteria 11999
301 Ga0496109_0000478 3300048912 Bacteria 34020
302 Ga0496109_0025420 3300048912 Bacteria 5277
303 Ga0496109_0676030 3300048912 Unclassified 970
304 Ga0496110_0022084 3300048913 Bacteria 5398
305 Ga0496110_0069260 3300048913 Unclassified 3124
306 Ga0496111_0495462 3300048914 Bacteria 899
307 Ga0496112_0001862 3300048915 Bacteria 16605
308 Ga0496113_0012269 3300048916 Bacteria 5754
309 Ga0496113_0170525 3300048916 Unclassified 1723
310 Ga0496113_0553389 3300048916 Bacteria 923
311 Ga0496115_0177579 3300048918 Bacteria 1761
312 Ga0501036_0800810 3300049572 Unclassified 776
313 Ga0501039_0897158 3300049575 Unclassified 690
314 Ga0501042_0229899 3300049578 Bacteria 1338
315 Ga0501071_0267525 3300049587 Unclassified 1292
316 Ga0501072_0034601 3300049588 Bacteria 3960
317 Ga0501074_0458559 3300049590 Unclassified 903
318 Ga0501079_0086688 3300049741 Bacteria 2424
319 Ga0501081_0149595 3300049743 Bacteria 1677
320 Ga0501045_0638366 3300049824 Unclassified 787
321 nmdc:mga05p37_74034_c1 3300050507 Bacteria 4192
322 nmdc:mga09592_429706_c1 3300050508 Bacteria 1140
323 nmdc:mga0qj67_315139_c1 3300050509 Bacteria 1266
324 nmdc:mga08y16_110278_c2 3300050511 Bacteria 2016
325 nmdc:mga0n895_31093_c1 3300050512 Bacteria 5108
326 nmdc:mga0n895_317313_c1 3300050512 Bacteria 1579
327 nmdc:mga08x19_3056_c1 3300050514 Bacteria 10058
328 nmdc:mga08x19_545538_c1 3300050514 Unclassified 820
329 nmdc:mga0a205_23719_c1 3300050515 Bacteria 5820
330 nmdc:mga0a205_704175_c1 3300050515 Bacteria 860
331 Ga0495601_0520359 3300053077 Unclassified 767
332 Ga0070671_100116261
333 Ga0065712_10000785
334 Ga0065715_10001029
335 Ga0065715_10168039
336 Ga0065707_10088325
337 Ga0070658_10195048
338 Ga0070683_100000001
339 Ga0070683_100001674
340 Ga0070683_100050847
341 Ga0070670_100005663
342 Ga0070670_100008943
343 Ga0070677_10024716
344 Ga0070666_10049414
345 Ga0070666_10348000
346 Ga0070680_100008992
347 Ga0070689_100315898
348 Ga0070687_100035394
349 Ga0070661_100042588
350 Ga0070668_100168411
351 Ga0070669_100000783
352 Ga0070669_100048699
353 Ga0070674_100016531
354 Ga0070674_100303729
355 Ga0070674_100649043
356 Ga0070673_100220612
357 Ga0070673_100667906
358 Ga0070667_100144515
359 Ga0070667_100145104
360 Ga0070667_100476987
361 Ga0070709_10199921
362 Ga0070700_100231596
363 Ga0070700_100329375
364 Ga0070700_100361227
365 Ga0070708_100222111
366 Ga0070663_100019714
367 Ga0070678_100288566
368 Ga0070678_100410219
369 Ga0070681_10004133
370 Ga0070681_10057854
371 Ga0070681_10376560
372 Ga0070685_10013060
373 Ga0070706_100106017
374 Ga0070706_100546840
375 Ga0070679_100141790
376 Ga0070684_100000055
377 Ga0070684_100021458
378 Ga0070684_100079964
379 Ga0070684_100201684
380 Ga0070684_100510921
381 Ga0070684_100666087
382 Ga0068853_100935526
383 Ga0070672_100029099
384 Ga0070686_100534046
385 Ga0070696_100312292
386 Ga0070693_100018312
387 Ga0070665_100113851
388 Ga0068855_100029183
389 Ga0068855_100042015
390 Ga0070664_100188814
391 Ga0068854_100290190
392 Ga0070702_100301686
393 Ga0068852_100064411
394 Ga0068859_100275410
395 Ga0068859_100698626
396 Ga0068861_100029494
397 Ga0068861_100166194
398 Ga0068863_100038361
399 Ga0068863_100214222
400 Ga0068863_100651117
401 Ga0068858_100309867
402 Ga0068860_100509013
403 Ga0068862_100013103
404 Ga0081455_10267360
405 Ga0070717_10025557
406 Ga0070717_10263848
407 Ga0070717_10430145
408 Ga0070717_10666021
409 Ga0097621_100092986
410 Ga0097621_100830066
411 Ga0068871_100290217
412 Ga0068871_100325646
413 Ga0068871_100332712
414 Ga0068871_100507338
415 Ga0075428_100948802
416 Ga0075430_100504791
417 Ga0075433_10008951
418 Ga0075434_100269494
419 Ga0068865_100173286
420 Ga0075436_100021148
421 Ga0097620_100275414
422 Ga0097620_100698473
423 Ga0075435_100103156
424 Ga0105240_10001246
425 Ga0105240_10001247
426 Ga0105240_10001467
427 Ga0105240_10002544
428 Ga0105240_10041179
429 Ga0105240_10128210
430 Ga0105240_10168671
431 Ga0105240_10273531
432 Ga0111539_10029418
433 Ga0111539_10110928
434 Ga0105245_10475285
435 Ga0114129_10005526
436 Ga0105248_10058765
437 Ga0105248_10089313
438 Ga0105237_10001650
439 Ga0105237_10009198
440 Ga0105237_10052948
441 Ga0105238_10170465
442 Ga0105238_10261713
443 Ga0105238_10602323
444 Ga0105249_10018452
445 Ga0105249_10044446
446 Ga0105249_10662949
447 Ga0105239_10100354
448 Ga0105239_10443637
449 Ga0105246_10216675
450 Ga0105246_10302471
451 Ga0157369_10008657
452 Ga0157369_10207751
453 Ga0157369_10247177
454 Ga0157374_10072971
455 Ga0157378_10662096
456 Ga0157378_10878575
457 Ga0163162_10028918
458 Ga0157372_10413934
459 Ga0157375_10059426
460 Ga0157375_10097642
461 Ga0157375_10276135
462 Ga0157375_10935082
463 Ga0163163_10009305
464 Ga0163163_10066292
465 Ga0163163_10074738
466 Ga0163163_11004099
467 Ga0157380_10060082
468 Ga0157377_10057444
469 Ga0157376_10156624
470 Ga0157376_10695649
471 Ga0207688_10021759
472 Ga0207688_10159836
473 Ga0207680_10162499
474 Ga0207680_10173156
475 Ga0207680_10324084
476 Ga0207684_10204749
477 Ga0207684_10466389
478 Ga0207707_10027665
479 Ga0207707_10041231
480 Ga0207695_10002623
481 Ga0207695_10005769
482 Ga0207695_10011531
483 Ga0207695_10013833
484 Ga0207695_10066881
485 Ga0207695_10118310
486 Ga0207695_10212131
487 Ga0207695_10266305
488 Ga0207671_10003265
489 Ga0207671_10044995
490 Ga0207671_10052271
491 Ga0207671_10423656
492 Ga0207660_10059186
493 Ga0207662_10076661
494 Ga0207649_10049996
495 Ga0207652_10217176
496 Ga0207652_10613630
497 Ga0207681_10014024
498 Ga0207681_10181744
499 Ga0207694_10233636
500 Ga0207694_10440665
501 Ga0207650_10039360
502 Ga0207650_10091720
503 Ga0207659_10132078
504 Ga0207687_10354942
505 Ga0207700_10124939
506 Ga0207669_10006381
507 Ga0207704_10036597
508 Ga0207704_10124353
509 Ga0207691_10053535
510 Ga0207691_10174845
511 Ga0207691_10191302
512 Ga0207711_10073156
513 Ga0207711_10505920
514 Ga0207661_10000005
515 Ga0207661_10002309
516 Ga0207661_10037041
517 Ga0207661_10133281
518 Ga0207661_10148134
519 Ga0207679_10182021
520 Ga0207667_10058954
521 Ga0207667_10168921
522 Ga0207667_10174634
523 Ga0207651_10410176
524 Ga0207651_10504890
525 Ga0207712_10037294
526 Ga0207712_10040071
527 Ga0207712_10523769
528 Ga0207658_10064746
529 Ga0207658_10316869
530 Ga0207703_10034239
531 Ga0207639_10202242
532 Ga0207678_10047185
533 Ga0207708_10557899
534 Ga0207641_10141363
535 Ga0207641_10167387
536 Ga0207641_10208723
537 Ga0207648_10291623
538 Ga0207676_10043507
539 Ga0207676_10132055
540 Ga0207676_10337622
541 Ga0207675_100113689
542 Ga0207675_100257010
543 Ga0207683_10324623
544 Ga0207698_10014206
545 Ga0268266_10108527
546 Ga0268266_10258966
547 Ga0268265_10008847
548 Ga0268264_10511364
549 Ga0265323_10000374
550 Ga0265330_10137962
551 Ga0265316_10001209
552 Ga0265316_10032517
553 Ga0265316_10170537
554 Ga0265316_10422068
555 Ga0265314_10062490
556 Ga0265342_10042377
557 Ga0265342_10124100
558 Ga0307413_10078959
559 Ga0307407_10021227
560 Ga0307412_10050726
561 Ga0307409_100047079
562 Ga0307409_100555946
563 Ga0307416_100724331
564 Ga0307415_100205911
565 Ga0373926_0037973
566 Ga0373945_0205658
567 Ga0373954_0164868
568 Ga0373943_0289383
569 Ga0373927_0003095
570 Ga0373927_0049602
571 Ga0373947_0000038
572 Ga0373947_0071812
573 Ga0373947_0490586
574 Ga0373937_0079834
575 Ga0373937_0199435
576 Ga0373925_0471176
577 Ga0436364_0833987
578 Ga0436365_0341137
579 Ga0439434_0106514
580 Ga0466963_0418461
581 Ga0451576_0047780
582 Ga0451576_0483461
583 Ga0451576_0515096
584 Ga0495651_0105045
585 Ga0495653_0408381
586 Ga0495580_0035220
587 Ga0495580_0038013
588 Ga0495580_0072082
589 Ga0495580_0401122
590 Ga0495594_0283953
591 Ga0495594_0384361
592 Ga0495630_0249442
593 Ga0495630_0346089
594 Ga0495666_0171622
595 Ga0495652_0230674
596 Ga0495652_0447534
597 Ga0495665_0044775
598 Ga0495587_0109707
599 Ga0495587_0131507
600 Ga0495587_0169316
601 Ga0495645_0019865
602 Ga0495645_0265982
603 Ga0495667_0064871
604 Ga0495667_0202993
605 Ga0495635_0305530
606 Ga0495635_0369014
607 Ga0495599_0221404
608 Ga0495623_0021849
609 Ga0495623_0070435
610 Ga0495623_0124741
611 Ga0495658_0479757
612 Ga0495604_0451750
613 Ga0495674_0000722
614 Ga0495674_0108819
615 Ga0495680_0121320
616 Ga0495675_0008460
617 Ga0495675_0179610
618 Ga0495675_0204329
619 Ga0495684_0007201
620 Ga0495684_0028669
621 Ga0495684_0377403
622 Ga0495593_0310236
623 Ga0495602_0163331
624 Ga0495602_0244461
625 Ga0496101_0276541
626 Ga0496101_0277637
627 Ga0496103_0285860
628 Ga0496104_0002694
629 Ga0496105_0071786
630 Ga0496106_0349255
631 Ga0496108_0003882
632 Ga0496109_0000478
633 Ga0496109_0025420
634 Ga0496109_0676030
635 Ga0496110_0022084
636 Ga0496110_0069260
637 Ga0496111_0495462
638 Ga0496112_0001862
639 Ga0496113_0012269
640 Ga0496113_0170525
641 Ga0496113_0553389
642 Ga0496115_0177579
643 Ga0501036_0800810
644 Ga0501039_0897158
645 Ga0501042_0229899
646 Ga0501071_0267525
647 Ga0501072_0034601
648 Ga0501074_0458559
649 Ga0501079_0086688
650 Ga0501081_0149595
651 Ga0501045_0638366
652 nmdc:mga05p37_74034_c1
653 nmdc:mga09592_429706_c1
654 nmdc:mga0qj67_315139_c1
655 nmdc:mga08y16_110278_c2
656 nmdc:mga0n895_31093_c1
657 nmdc:mga0n895_317313_c1
658 nmdc:mga08x19_3056_c1
659 nmdc:mga08x19_545538_c1
660 nmdc:mga0a205_23719_c1
661 nmdc:mga0a205_704175_c1
662 Ga0495601_0520359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

38

209

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ir2-assembly1.cif.gz_A crystal structure of novel cellulases from microbes associated with the gut ecosystem 0.9102 23 216
3k4i-assembly1.cif.gz_C crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.9019 23 233
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.9002 23 230
3k4i-assembly1.cif.gz_B crystal structure of uncharacterized protein pspto_3204 from pseudomonas syringae pv. tomato str. dc3000 0.8831 23 230
5x15-assembly1.cif.gz_A-2 crystal structure of streptomyces coelicolor rraas2, an unusual member of the rnase es inhibitor rraa protein family 0.8807 24 215
ID Description Score Start End Superfamily
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9005 37 195 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8998 28 196 3.50.30.40
5ir2A00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8922 23 216 3.50.30.40
3nojA01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8892 37 195 3.50.30.40
3k4iB01 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.8781 28 196 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A2V8YKM8-F1-model_v4 Regulator of ribonuclease activity homolog 0.9599 26 237 GO:0008168
GO:0032259
GO:0046872
AF-A0A2V9YE34-F1-model_v4 Regulator of ribonuclease activity homolog 0.9586 21 215 GO:0008168
GO:0032259
GO:0046872
AF-A0A1I6M482-F1-model_v4 Regulator of ribonuclease activity homolog 0.9548 25 237 GO:0046872
AF-A0A2V9TIG0-F1-model_v4 Regulator of ribonuclease activity homolog 0.9536 26 237 GO:0008168
GO:0032259
GO:0046872
AF-A0A6N7MAT5-F1-model_v4 Regulator of ribonuclease activity homolog 0.9492 31 210 GO:0008948
GO:0046872
GO:0047443

Map