F410172

General Info

Members Datasets Scaffolds Average Seq Length
330 166 660 213

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0100658|Ga0373957_0100658_104_823
Length 239
Sequence MPVRLDLPPRGVLKPNDADDPLPYYYHPWVGWLYRHRLQMGLDFLDPTAETPRGFPHPPAKDSAGQSPAPSTRSGKRVLEIGVGSGVLVPTLTKHYAEYTGTDLTLAPGLDALVAPGCRAEFRRADLLNDADLPAAHFDAIVCFSVLEHIRDADGAARGLARALAPGGTLVTGYPMVSRLMTRAFAAIGYDRIDDHHVSPPARIAAALGAVLTPVRRAAFPPGAPVPAALYQCTAWTTR

Samples

Sample ID Description Type Environment
1 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.55
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 15.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373957_0100658 3300035120 Bacteria 1157
2 rootH1_10012560 3300003323 Bacteria 3909
3 rootH1_10084932 3300003323 Bacteria 2262
4 Ga0070658_10000207 3300005327 Bacteria 52055
5 Ga0070676_10044108 3300005328 Unclassified 2594
6 Ga0070676_10608397 3300005328 Bacteria 789
7 Ga0070683_100001679 3300005329 Bacteria 17191
8 Ga0070683_100089034 3300005329 Bacteria 2897
9 Ga0070690_100064776 3300005330 Bacteria 2362
10 Ga0070690_100065274 3300005330 Bacteria 2353
11 Ga0070670_100073087 3300005331 Bacteria 2946
12 Ga0070670_100085754 3300005331 Bacteria 2706
13 Ga0070677_10082615 3300005333 Bacteria 1378
14 Ga0068869_100474153 3300005334 Unclassified 1041
15 Ga0068869_100930159 3300005334 Bacteria 754
16 Ga0070666_10082351 3300005335 Unclassified 2201
17 Ga0070680_100079192 3300005336 Unclassified 2708
18 Ga0070680_100085241 3300005336 Bacteria 2610
19 Ga0070682_100009200 3300005337 Bacteria 5585
20 Ga0070689_100062789 3300005340 Bacteria 2891
21 Ga0070689_100071174 3300005340 Bacteria 2716
22 Ga0070687_100034417 3300005343 Bacteria 2508
23 Ga0070687_100217915 3300005343 Bacteria 1167
24 Ga0070668_100030228 3300005347 Bacteria 4118
25 Ga0070669_100010506 3300005353 Bacteria 6575
26 Ga0070671_100072957 3300005355 Bacteria 2867
27 Ga0070674_100000836 3300005356 Bacteria 15930
28 Ga0070673_100000861 3300005364 Bacteria 17035
29 Ga0070673_100022262 3300005364 Bacteria 4611
30 Ga0070673_100577940 3300005364 Bacteria 1023
31 Ga0070688_100001279 3300005365 Bacteria 12535
32 Ga0070688_100031714 3300005365 Bacteria 3181
33 Ga0070659_100457120 3300005366 Bacteria 1084
34 Ga0070701_10002249 3300005438 Bacteria 7388
35 Ga0070705_100200822 3300005440 Unclassified 1367
36 Ga0070678_100063893 3300005456 Bacteria 2726
37 Ga0070678_100072434 3300005456 Bacteria 2583
38 Ga0070681_10035634 3300005458 Unclassified 4998
39 Ga0070681_10264780 3300005458 Bacteria 1631
40 Ga0068867_100005695 3300005459 Bacteria 8830
41 Ga0070685_10006313 3300005466 Bacteria 6042
42 Ga0070685_10030120 3300005466 Bacteria 3021
43 Ga0070685_10400262 3300005466 Bacteria 951
44 Ga0070679_100004512 3300005530 Bacteria 12859
45 Ga0070679_100145462 3300005530 Bacteria 2348
46 Ga0070679_100413415 3300005530 Unclassified 1294
47 Ga0070684_100003348 3300005535 Bacteria 12005
48 Ga0070684_100099015 3300005535 Bacteria 2601
49 Ga0070684_100210478 3300005535 Bacteria 1772
50 Ga0068853_100130074 3300005539 Bacteria 2253
51 Ga0070672_100626989 3300005543 Unclassified 938
52 Ga0070686_100001630 3300005544 Bacteria 12545
53 Ga0070686_100002915 3300005544 Bacteria 9390
54 Ga0070686_100062255 3300005544 Bacteria 2414
55 Ga0070686_100146498 3300005544 Unclassified 1649
56 Ga0070693_100599326 3300005547 Unclassified 795
57 Ga0068855_100060104 3300005563 Bacteria 4445
58 Ga0068855_100330934 3300005563 Unclassified 1681
59 Ga0068857_100458723 3300005577 Bacteria 1192
60 Ga0068854_100149641 3300005578 Bacteria 1799
61 Ga0068856_100172656 3300005614 Bacteria 2174
62 Ga0068856_100216656 3300005614 Bacteria 1930
63 Ga0068856_100666311 3300005614 Bacteria 1061
64 Ga0070702_100135221 3300005615 Bacteria 1563
65 Ga0070702_100141999 3300005615 Bacteria 1531
66 Ga0070702_100172384 3300005615 Bacteria 1409
67 Ga0068852_100056707 3300005616 Bacteria 3387
68 Ga0068859_100027947 3300005617 Bacteria 5656
69 Ga0068859_100655644 3300005617 Bacteria 1141
70 Ga0068861_100048052 3300005719 Bacteria 3224
71 Ga0068861_100154386 3300005719 Bacteria 1887
72 Ga0068863_100146105 3300005841 Bacteria 2262
73 Ga0068863_100379899 3300005841 Unclassified 1379
74 Ga0068863_100725104 3300005841 Bacteria 989
75 Ga0068858_100606531 3300005842 Bacteria 1062
76 Ga0068860_100158870 3300005843 Unclassified 2179
77 Ga0068860_100248666 3300005843 Bacteria 1731
78 Ga0070717_10403112 3300006028 Bacteria 1229
79 Ga0070717_10425893 3300006028 Unclassified 1194
80 Ga0070715_10141485 3300006163 Bacteria 1169
81 Ga0097621_100496307 3300006237 Bacteria 1105
82 Ga0097621_100564971 3300006237 Bacteria 1037
83 Ga0068865_100003670 3300006881 Bacteria 9219
84 Ga0097620_100027947 3300006931 Bacteria 5656
85 Ga0097620_100655631 3300006931 Bacteria 1141
86 Ga0105240_10008377 3300009093 Bacteria 14797
87 Ga0105240_10201567 3300009093 Bacteria 2331
88 Ga0111539_10104188 3300009094 Bacteria 3329
89 Ga0105243_10126716 3300009148 Bacteria 2161
90 Ga0105237_10000048 3300009545 Bacteria 165532
91 Ga0105237_10144128 3300009545 Unclassified 2376
92 Ga0105238_10008555 3300009551 Bacteria 10238
93 Ga0105238_10043069 3300009551 Unclassified 4568
94 Ga0105239_10050903 3300010375 Bacteria 4542
95 Ga0157378_10038505 3300013297 Bacteria 4238
96 Ga0157378_10908577 3300013297 Bacteria 911
97 Ga0163163_10137685 3300014325 Bacteria 2483
98 Ga0206354_10231809 3300020081 Bacteria 847
99 Ga0207697_10153646 3300025315 Bacteria 1002
100 Ga0207692_10148870 3300025898 Bacteria 1339
101 Ga0207680_10038957 3300025903 Unclassified 2754
102 Ga0207645_10003202 3300025907 Bacteria 12515
103 Ga0207707_10477095 3300025912 Unclassified 1066
104 Ga0207695_10006131 3300025913 Bacteria 15681
105 Ga0207695_10582764 3300025913 Bacteria 1000
106 Ga0207671_10000117 3300025914 Bacteria 122575
107 Ga0207671_10136016 3300025914 Unclassified 1889
108 Ga0207671_10736330 3300025914 Bacteria 783
109 Ga0207660_10091173 3300025917 Unclassified 2260
110 Ga0207662_10070417 3300025918 Bacteria 2115
111 Ga0207662_10450858 3300025918 Bacteria 879
112 Ga0207652_10001389 3300025921 Bacteria 21539
113 Ga0207652_10006514 3300025921 Bacteria 9414
114 Ga0207652_10103927 3300025921 Bacteria 2512
115 Ga0207681_10003873 3300025923 Bacteria 9291
116 Ga0207694_10023589 3300025924 Bacteria 4671
117 Ga0207694_10075006 3300025924 Bacteria 2647
118 Ga0207694_10198986 3300025924 Bacteria 1630
119 Ga0207694_10336432 3300025924 Bacteria 1248
120 Ga0207650_10092682 3300025925 Unclassified 2311
121 Ga0207644_10196121 3300025931 Bacteria 1590
122 Ga0207690_10329056 3300025932 Bacteria 1203
123 Ga0207709_10062665 3300025935 Bacteria 2328
124 Ga0207670_10000016 3300025936 Bacteria 166872
125 Ga0207670_10004106 3300025936 Bacteria 7798
126 Ga0207669_10010418 3300025937 Bacteria 4475
127 Ga0207704_10000520 3300025938 Bacteria 17149
128 Ga0207704_10402525 3300025938 Bacteria 1080
129 Ga0207691_10017362 3300025940 Bacteria 6826
130 Ga0207689_10147869 3300025942 Unclassified 1936
131 Ga0207661_10003822 3300025944 Bacteria 10501
132 Ga0207661_10122485 3300025944 Bacteria 2216
133 Ga0207661_10787811 3300025944 Bacteria 875
134 Ga0207661_10954595 3300025944 Archaea 790
135 Ga0207667_10023412 3300025949 Bacteria 6801
136 Ga0207651_10002694 3300025960 Bacteria 8506
137 Ga0207651_10005076 3300025960 Bacteria 6717
138 Ga0207677_10238883 3300026023 Bacteria 1468
139 Ga0207703_10232703 3300026035 Bacteria 1653
140 Ga0207639_10142767 3300026041 Bacteria 1997
141 Ga0207678_11100941 3300026067 Bacteria 703
142 Ga0207708_10008328 3300026075 Bacteria 7678
143 Ga0207702_10254647 3300026078 Bacteria 1650
144 Ga0207641_10331424 3300026088 Unclassified 1446
145 Ga0207648_10007096 3300026089 Bacteria 11057
146 Ga0207674_10095624 3300026116 Unclassified 2956
147 Ga0207675_100388761 3300026118 Bacteria 1373
148 Ga0207683_10086136 3300026121 Bacteria 2793
149 Ga0207683_10263085 3300026121 Bacteria 1575
150 Ga0207698_10414886 3300026142 Bacteria 1290
151 Ga0268266_11124765 3300028379 Unclassified 760
152 Ga0268264_10012835 3300028381 Bacteria 6895
153 Ga0268264_10266724 3300028381 Unclassified 1598
154 Ga0265319_1011341 3300028563 Bacteria 3655
155 Ga0265334_10055835 3300028573 Bacteria 1501
156 Ga0265318_10000011 3300028577 Bacteria 231078
157 Ga0265318_10002958 3300028577 Bacteria 8798
158 Ga0265323_10000223 3300028653 Bacteria 33336
159 Ga0265323_10019843 3300028653 Unclassified 2591
160 Ga0265323_10024265 3300028653 Bacteria 2307
161 Ga0265323_10027053 3300028653 Bacteria 2157
162 Ga0265338_10002989 3300028800 Bacteria 24499
163 Ga0265338_10005603 3300028800 Bacteria 16319
164 Ga0265338_10015938 3300028800 Bacteria 8219
165 Ga0265338_10065645 3300028800 Unclassified 3146
166 Ga0265338_10175022 3300028800 Bacteria 1641
167 Ga0265324_10000477 3300029957 Bacteria 28101
168 Ga0265330_10000017 3300031235 Bacteria 166302
169 Ga0265330_10000669 3300031235 Bacteria 21995
170 Ga0265330_10001489 3300031235 Bacteria 13609
171 Ga0265330_10012058 3300031235 Bacteria 4041
172 Ga0265330_10012193 3300031235 Bacteria 4022
173 Ga0265330_10038179 3300031235 Unclassified 2135
174 Ga0265330_10050119 3300031235 Unclassified 1831
175 Ga0265330_10051015 3300031235 Bacteria 1814
176 Ga0265332_10000205 3300031238 Bacteria 48001
177 Ga0265332_10001380 3300031238 Bacteria 13704
178 Ga0265332_10041074 3300031238 Bacteria 2002
179 Ga0265332_10109427 3300031238 Unclassified 1164
180 Ga0265332_10154914 3300031238 Bacteria 958
181 Ga0265328_10001804 3300031239 Bacteria 9774
182 Ga0265328_10005437 3300031239 Bacteria 5455
183 Ga0265328_10028054 3300031239 Bacteria 2108
184 Ga0265328_10062994 3300031239 Bacteria 1362
185 Ga0265320_10000005 3300031240 Bacteria 354422
186 Ga0265320_10001572 3300031240 Bacteria 16403
187 Ga0265320_10001809 3300031240 Bacteria 15167
188 Ga0265320_10006233 3300031240 Bacteria 7537
189 Ga0265320_10068350 3300031240 Bacteria 1679
190 Ga0265320_10126708 3300031240 Bacteria 1161
191 Ga0265325_10002593 3300031241 Bacteria 12119
192 Ga0265329_10000429 3300031242 Bacteria 22117
193 Ga0265329_10001313 3300031242 Bacteria 12076
194 Ga0265329_10002541 3300031242 Bacteria 8235
195 Ga0265329_10003367 3300031242 Bacteria 6984
196 Ga0265340_10000378 3300031247 Bacteria 23665
197 Ga0265340_10207232 3300031247 Unclassified 881
198 Ga0265339_10000059 3300031249 Bacteria 98287
199 Ga0265339_10013349 3300031249 Bacteria 4980
200 Ga0265339_10016043 3300031249 Bacteria 4474
201 Ga0265339_10023568 3300031249 Bacteria 3556
202 Ga0265339_10302289 3300031249 Bacteria 763
203 Ga0265331_10000013 3300031250 Bacteria 296011
204 Ga0265331_10005636 3300031250 Bacteria 7528
205 Ga0265331_10015784 3300031250 Bacteria 3979
206 Ga0265316_10000442 3300031344 Bacteria 47118
207 Ga0265316_10001987 3300031344 Bacteria 21533
208 Ga0265316_10002057 3300031344 Bacteria 21182
209 Ga0265316_10003209 3300031344 Bacteria 16618
210 Ga0265316_10004194 3300031344 Bacteria 14409
211 Ga0265316_10005648 3300031344 Bacteria 12104
212 Ga0265316_10009988 3300031344 Bacteria 8686
213 Ga0265316_10047102 3300031344 Bacteria 3412
214 Ga0265316_10132889 3300031344 Bacteria 1873
215 Ga0265313_10000019 3300031595 Bacteria 149106
216 Ga0265313_10005293 3300031595 Bacteria 9542
217 Ga0265313_10013080 3300031595 Bacteria 5011
218 Ga0265313_10037762 3300031595 Bacteria 2411
219 Ga0265313_10040312 3300031595 Bacteria 2310
220 Ga0265313_10171941 3300031595 Bacteria 915
221 Ga0265313_10180242 3300031595 Unclassified 888
222 Ga0265313_10209721 3300031595 Bacteria 807
223 Ga0265314_10000024 3300031711 Bacteria 295216
224 Ga0265314_10000409 3300031711 Bacteria 57963
225 Ga0265314_10002658 3300031711 Bacteria 17930
226 Ga0265314_10006774 3300031711 Bacteria 10051
227 Ga0265314_10007440 3300031711 Bacteria 9498
228 Ga0265314_10015540 3300031711 Bacteria 6039
229 Ga0265314_10018656 3300031711 Bacteria 5402
230 Ga0265314_10028348 3300031711 Bacteria 4176
231 Ga0265342_10000071 3300031712 Bacteria 107578
232 Ga0265342_10000121 3300031712 Bacteria 87591
233 Ga0265342_10001446 3300031712 Bacteria 22113
234 Ga0265342_10001621 3300031712 Bacteria 20771
235 Ga0265342_10002966 3300031712 Bacteria 14252
236 Ga0265342_10005473 3300031712 Bacteria 9667
237 Ga0265342_10017869 3300031712 Bacteria 4604
238 Ga0265342_10031483 3300031712 Bacteria 3279
239 Ga0265342_10047003 3300031712 Bacteria 2592
240 Ga0265342_10051033 3300031712 Unclassified 2469
241 Ga0265342_10127746 3300031712 Bacteria 1426
242 Ga0373950_0000046 3300034818 Bacteria 97127
243 Ga0373953_0081855 3300035117 Bacteria 1343
244 Ga0373953_0207047 3300035117 Bacteria 849
245 Ga0373956_0068700 3300035119 Unclassified 1614
246 Ga0373957_0037827 3300035120 Unclassified 1804
247 Ga0373943_0120754 3300035170 Unclassified 1392
248 Ga0373955_0120873 3300035172 Bacteria 1523
249 Ga0373962_0237198 3300035242 Unclassified 629
250 Ga0373935_0032958 3300035692 Bacteria 3222
251 Ga0373935_0667888 3300035692 Unclassified 763
252 Ga0373933_0004159 3300035724 Bacteria 7972
253 Ga0373937_0007689 3300036401 Bacteria 9342
254 Ga0373937_0016663 3300036401 Bacteria 6529
255 Ga0373937_1298839 3300036401 Bacteria 676
256 Ga0373925_0066551 3300037068 Bacteria 2716
257 Ga0373925_0268055 3300037068 Bacteria 1373
258 Ga0373925_0679929 3300037068 Bacteria 848
259 Ga0436363_0631840 3300039450 Bacteria 939
260 Ga0451807_2330270 3300041486 Unclassified 970
261 Ga0451577_0115409 3300042876 Bacteria 2404
262 Ga0453684_0111790 3300044712 Bacteria 3317
263 Ga0453684_0209871 3300044712 Unclassified 2264
264 Ga0453684_0233786 3300044712 Unclassified 2120
265 Ga0453684_1030505 3300044712 Bacteria 873
266 Ga0451576_0008397 3300045051 Bacteria 12123
267 Ga0451576_2015212 3300045051 Unclassified 594
268 Ga0466967_0222659 3300045976 Bacteria 1794
269 Ga0495664_0002420 3300046477 Bacteria 10032
270 Ga0495586_0018174 3300046535 Bacteria 3741
271 Ga0495667_0107900 3300046559 Bacteria 1799
272 Ga0495634_0001254 3300046642 Bacteria 23321
273 Ga0495604_0137286 3300047317 Unclassified 1751
274 Ga0495674_0039987 3300047319 Bacteria 4198
275 Ga0495680_0074031 3300047322 Bacteria 2587
276 Ga0496100_0106615 3300048903 Bacteria 1940
277 Ga0496101_0011014 3300048904 Bacteria 5989
278 Ga0496104_0172140 3300048907 Bacteria 2076
279 Ga0496106_0341946 3300048909 Bacteria 1202
280 Ga0496106_0445714 3300048909 Bacteria 1040
281 Ga0496107_0043486 3300048910 Bacteria 3228
282 Ga0496108_0057023 3300048911 Bacteria 3282
283 Ga0496109_0107368 3300048912 Bacteria 2593
284 Ga0496112_1019485 3300048915 Bacteria 747
285 Ga0496114_0003278 3300048917 Bacteria 12420
286 Ga0496114_0026961 3300048917 Bacteria 4706
287 Ga0496114_0297506 3300048917 Unclassified 1425
288 Ga0496115_0006412 3300048918 Bacteria 8620
289 Ga0496115_0420520 3300048918 Bacteria 1083
290 Ga0501036_0031989 3300049572 Bacteria 4445
291 Ga0501036_0082319 3300049572 Bacteria 2720
292 Ga0501043_0002643 3300049579 Bacteria 15064
293 Ga0501043_0734475 3300049579 Bacteria 719
294 Ga0501046_0000912 3300049580 Bacteria 28899
295 Ga0501047_0000053 3300049581 Bacteria 150440
296 Ga0501048_0001945 3300049582 Bacteria 15681
297 Ga0501067_0000012 3300049583 Bacteria 113542
298 Ga0501067_0018937 3300049583 Bacteria 3808
299 Ga0501068_0053183 3300049584 Bacteria 2450
300 Ga0501068_0177488 3300049584 Unclassified 1346
301 Ga0501069_0001849 3300049585 Bacteria 10564
302 Ga0501069_0013443 3300049585 Bacteria 4365
303 Ga0501069_0443192 3300049585 Unclassified 771
304 Ga0501070_0000196 3300049586 Bacteria 56282
305 Ga0501070_0001152 3300049586 Bacteria 23678
306 Ga0501070_0145922 3300049586 Bacteria 1953
307 Ga0501070_0307215 3300049586 Bacteria 1291
308 Ga0501072_0000065 3300049588 Bacteria 76372
309 Ga0501073_0000342 3300049589 Bacteria 31262
310 Ga0501073_0002134 3300049589 Bacteria 14802
311 Ga0501073_0004428 3300049589 Bacteria 10550
312 Ga0501073_0011979 3300049589 Bacteria 6332
313 Ga0501073_0013009 3300049589 Bacteria 6067
314 Ga0501074_0009864 3300049590 Bacteria 6936
315 Ga0501074_0083080 3300049590 Bacteria 2296
316 Ga0501074_0142054 3300049590 Unclassified 1717
317 Ga0501077_0112859 3300049593 Unclassified 1723
318 Ga0501080_0009789 3300049742 Bacteria 8758
319 Ga0501080_0010016 3300049742 Bacteria 8665
320 Ga0501080_0142062 3300049742 Bacteria 2219
321 Ga0501080_0307994 3300049742 Bacteria 1436
322 Ga0501083_0002129 3300049744 Bacteria 13581
323 Ga0501083_0002477 3300049744 Bacteria 12662
324 Ga0501083_0006909 3300049744 Bacteria 8058
325 Ga0495619_0127872 3300053085 Unclassified 1745
326 Ga0495619_0163575 3300053085 Unclassified 1537
327 Ga0501084_0000022 3300054114 Bacteria 145804
328 Ga0501084_0405328 3300054114 Bacteria 1152
329 Ga0501082_0020702 3300060353 Bacteria 5670
330 Ga0501082_0024962 3300060353 Bacteria 5149
331 Ga0373957_0100658
332 rootH1_10012560
333 rootH1_10084932
334 Ga0070658_10000207
335 Ga0070676_10044108
336 Ga0070676_10608397
337 Ga0070683_100001679
338 Ga0070683_100089034
339 Ga0070690_100064776
340 Ga0070690_100065274
341 Ga0070670_100073087
342 Ga0070670_100085754
343 Ga0070677_10082615
344 Ga0068869_100474153
345 Ga0068869_100930159
346 Ga0070666_10082351
347 Ga0070680_100079192
348 Ga0070680_100085241
349 Ga0070682_100009200
350 Ga0070689_100062789
351 Ga0070689_100071174
352 Ga0070687_100034417
353 Ga0070687_100217915
354 Ga0070668_100030228
355 Ga0070669_100010506
356 Ga0070671_100072957
357 Ga0070674_100000836
358 Ga0070673_100000861
359 Ga0070673_100022262
360 Ga0070673_100577940
361 Ga0070688_100001279
362 Ga0070688_100031714
363 Ga0070659_100457120
364 Ga0070701_10002249
365 Ga0070705_100200822
366 Ga0070678_100063893
367 Ga0070678_100072434
368 Ga0070681_10035634
369 Ga0070681_10264780
370 Ga0068867_100005695
371 Ga0070685_10006313
372 Ga0070685_10030120
373 Ga0070685_10400262
374 Ga0070679_100004512
375 Ga0070679_100145462
376 Ga0070679_100413415
377 Ga0070684_100003348
378 Ga0070684_100099015
379 Ga0070684_100210478
380 Ga0068853_100130074
381 Ga0070672_100626989
382 Ga0070686_100001630
383 Ga0070686_100002915
384 Ga0070686_100062255
385 Ga0070686_100146498
386 Ga0070693_100599326
387 Ga0068855_100060104
388 Ga0068855_100330934
389 Ga0068857_100458723
390 Ga0068854_100149641
391 Ga0068856_100172656
392 Ga0068856_100216656
393 Ga0068856_100666311
394 Ga0070702_100135221
395 Ga0070702_100141999
396 Ga0070702_100172384
397 Ga0068852_100056707
398 Ga0068859_100027947
399 Ga0068859_100655644
400 Ga0068861_100048052
401 Ga0068861_100154386
402 Ga0068863_100146105
403 Ga0068863_100379899
404 Ga0068863_100725104
405 Ga0068858_100606531
406 Ga0068860_100158870
407 Ga0068860_100248666
408 Ga0070717_10403112
409 Ga0070717_10425893
410 Ga0070715_10141485
411 Ga0097621_100496307
412 Ga0097621_100564971
413 Ga0068865_100003670
414 Ga0097620_100027947
415 Ga0097620_100655631
416 Ga0105240_10008377
417 Ga0105240_10201567
418 Ga0111539_10104188
419 Ga0105243_10126716
420 Ga0105237_10000048
421 Ga0105237_10144128
422 Ga0105238_10008555
423 Ga0105238_10043069
424 Ga0105239_10050903
425 Ga0157378_10038505
426 Ga0157378_10908577
427 Ga0163163_10137685
428 Ga0206354_10231809
429 Ga0207697_10153646
430 Ga0207692_10148870
431 Ga0207680_10038957
432 Ga0207645_10003202
433 Ga0207707_10477095
434 Ga0207695_10006131
435 Ga0207695_10582764
436 Ga0207671_10000117
437 Ga0207671_10136016
438 Ga0207671_10736330
439 Ga0207660_10091173
440 Ga0207662_10070417
441 Ga0207662_10450858
442 Ga0207652_10001389
443 Ga0207652_10006514
444 Ga0207652_10103927
445 Ga0207681_10003873
446 Ga0207694_10023589
447 Ga0207694_10075006
448 Ga0207694_10198986
449 Ga0207694_10336432
450 Ga0207650_10092682
451 Ga0207644_10196121
452 Ga0207690_10329056
453 Ga0207709_10062665
454 Ga0207670_10000016
455 Ga0207670_10004106
456 Ga0207669_10010418
457 Ga0207704_10000520
458 Ga0207704_10402525
459 Ga0207691_10017362
460 Ga0207689_10147869
461 Ga0207661_10003822
462 Ga0207661_10122485
463 Ga0207661_10787811
464 Ga0207661_10954595
465 Ga0207667_10023412
466 Ga0207651_10002694
467 Ga0207651_10005076
468 Ga0207677_10238883
469 Ga0207703_10232703
470 Ga0207639_10142767
471 Ga0207678_11100941
472 Ga0207708_10008328
473 Ga0207702_10254647
474 Ga0207641_10331424
475 Ga0207648_10007096
476 Ga0207674_10095624
477 Ga0207675_100388761
478 Ga0207683_10086136
479 Ga0207683_10263085
480 Ga0207698_10414886
481 Ga0268266_11124765
482 Ga0268264_10012835
483 Ga0268264_10266724
484 Ga0265319_1011341
485 Ga0265334_10055835
486 Ga0265318_10000011
487 Ga0265318_10002958
488 Ga0265323_10000223
489 Ga0265323_10019843
490 Ga0265323_10024265
491 Ga0265323_10027053
492 Ga0265338_10002989
493 Ga0265338_10005603
494 Ga0265338_10015938
495 Ga0265338_10065645
496 Ga0265338_10175022
497 Ga0265324_10000477
498 Ga0265330_10000017
499 Ga0265330_10000669
500 Ga0265330_10001489
501 Ga0265330_10012058
502 Ga0265330_10012193
503 Ga0265330_10038179
504 Ga0265330_10050119
505 Ga0265330_10051015
506 Ga0265332_10000205
507 Ga0265332_10001380
508 Ga0265332_10041074
509 Ga0265332_10109427
510 Ga0265332_10154914
511 Ga0265328_10001804
512 Ga0265328_10005437
513 Ga0265328_10028054
514 Ga0265328_10062994
515 Ga0265320_10000005
516 Ga0265320_10001572
517 Ga0265320_10001809
518 Ga0265320_10006233
519 Ga0265320_10068350
520 Ga0265320_10126708
521 Ga0265325_10002593
522 Ga0265329_10000429
523 Ga0265329_10001313
524 Ga0265329_10002541
525 Ga0265329_10003367
526 Ga0265340_10000378
527 Ga0265340_10207232
528 Ga0265339_10000059
529 Ga0265339_10013349
530 Ga0265339_10016043
531 Ga0265339_10023568
532 Ga0265339_10302289
533 Ga0265331_10000013
534 Ga0265331_10005636
535 Ga0265331_10015784
536 Ga0265316_10000442
537 Ga0265316_10001987
538 Ga0265316_10002057
539 Ga0265316_10003209
540 Ga0265316_10004194
541 Ga0265316_10005648
542 Ga0265316_10009988
543 Ga0265316_10047102
544 Ga0265316_10132889
545 Ga0265313_10000019
546 Ga0265313_10005293
547 Ga0265313_10013080
548 Ga0265313_10037762
549 Ga0265313_10040312
550 Ga0265313_10171941
551 Ga0265313_10180242
552 Ga0265313_10209721
553 Ga0265314_10000024
554 Ga0265314_10000409
555 Ga0265314_10002658
556 Ga0265314_10006774
557 Ga0265314_10007440
558 Ga0265314_10015540
559 Ga0265314_10018656
560 Ga0265314_10028348
561 Ga0265342_10000071
562 Ga0265342_10000121
563 Ga0265342_10001446
564 Ga0265342_10001621
565 Ga0265342_10002966
566 Ga0265342_10005473
567 Ga0265342_10017869
568 Ga0265342_10031483
569 Ga0265342_10047003
570 Ga0265342_10051033
571 Ga0265342_10127746
572 Ga0373950_0000046
573 Ga0373953_0081855
574 Ga0373953_0207047
575 Ga0373956_0068700
576 Ga0373957_0037827
577 Ga0373943_0120754
578 Ga0373955_0120873
579 Ga0373962_0237198
580 Ga0373935_0032958
581 Ga0373935_0667888
582 Ga0373933_0004159
583 Ga0373937_0007689
584 Ga0373937_0016663
585 Ga0373937_1298839
586 Ga0373925_0066551
587 Ga0373925_0268055
588 Ga0373925_0679929
589 Ga0436363_0631840
590 Ga0451807_2330270
591 Ga0451577_0115409
592 Ga0453684_0111790
593 Ga0453684_0209871
594 Ga0453684_0233786
595 Ga0453684_1030505
596 Ga0451576_0008397
597 Ga0451576_2015212
598 Ga0466967_0222659
599 Ga0495664_0002420
600 Ga0495586_0018174
601 Ga0495667_0107900
602 Ga0495634_0001254
603 Ga0495604_0137286
604 Ga0495674_0039987
605 Ga0495680_0074031
606 Ga0496100_0106615
607 Ga0496101_0011014
608 Ga0496104_0172140
609 Ga0496106_0341946
610 Ga0496106_0445714
611 Ga0496107_0043486
612 Ga0496108_0057023
613 Ga0496109_0107368
614 Ga0496112_1019485
615 Ga0496114_0003278
616 Ga0496114_0026961
617 Ga0496114_0297506
618 Ga0496115_0006412
619 Ga0496115_0420520
620 Ga0501036_0031989
621 Ga0501036_0082319
622 Ga0501043_0002643
623 Ga0501043_0734475
624 Ga0501046_0000912
625 Ga0501047_0000053
626 Ga0501048_0001945
627 Ga0501067_0000012
628 Ga0501067_0018937
629 Ga0501068_0053183
630 Ga0501068_0177488
631 Ga0501069_0001849
632 Ga0501069_0013443
633 Ga0501069_0443192
634 Ga0501070_0000196
635 Ga0501070_0001152
636 Ga0501070_0145922
637 Ga0501070_0307215
638 Ga0501072_0000065
639 Ga0501073_0000342
640 Ga0501073_0002134
641 Ga0501073_0004428
642 Ga0501073_0011979
643 Ga0501073_0013009
644 Ga0501074_0009864
645 Ga0501074_0083080
646 Ga0501074_0142054
647 Ga0501077_0112859
648 Ga0501080_0009789
649 Ga0501080_0010016
650 Ga0501080_0142062
651 Ga0501080_0307994
652 Ga0501083_0002129
653 Ga0501083_0002477
654 Ga0501083_0006909
655 Ga0495619_0127872
656 Ga0495619_0163575
657 Ga0501084_0000022
658 Ga0501084_0405328
659 Ga0501082_0020702
660 Ga0501082_0024962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13489

Methyltransf_23

Methyltransferase domain

61

208

0.89

PF08241

Methyltransf_11

Methyltransferase domain

79

172

0.87

PF13649

Methyltransf_25

Methyltransferase domain

78

168

0.87

PF08242

Methyltransf_12

Methyltransferase domain

79

170

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qpn-assembly1.cif.gz_A crystal structure of human methyltransferase-like protein 21b 0.7942 49 213
4isc-assembly1.cif.gz_A crystal structure of a putative methyltransferase from pseudomonas syringae 0.7581 36 215
4isc-assembly1.cif.gz_A crystal structure of a putative methyltransferase from pseudomonas syringae 0.7498 36 215
3ofj-assembly1.cif.gz_A crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 0.7478 29 214
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.7475 52 213
ID Description Score Start End Superfamily
af_Q9VIK9_9_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8001 49 149 3.40.50.150
4qpnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7942 49 213 3.40.50.150
af_A0A1D6NER7_20_250_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7882 31 214 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7845 50 214 3.40.50.150
1y8cA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7823 54 215 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V4L8T1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9809 8 214 GO:0008168
GO:0032259
AF-A0A7V4L8T1-F1-model_v4 Class I SAM-dependent methyltransferase 0.958 8 214 GO:0008168
GO:0032259
AF-A0A7X8PLL9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9383 4 215 GO:0008168
GO:0032259
AF-A0A6P0TEY7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9303 5 215 GO:0008757
GO:0032259
AF-A0A0G0AR40-F1-model_v4 Methylase involved in ubiquinone/menaquinone biosynthesis 0.9255 5 214 GO:0008757
GO:0032259

Map