F410135

General Info

Members Datasets Scaffolds Average Seq Length
330 189 660 219

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10398709|Ga0207674_103987092
Length 259
Sequence MLSVDKTIAGEPVATVNSRAMVYQGTRHSVSEWHILRAAAPNLLITGVPDAVEQYLAGLNRGSDAVLDDITRQNAQRGLPLVDAEVGALLRVLATAIGAARILEIGTAIGYSGIWLAGALPPHGTLLTMEVKPERARIARENFARSGLAERVSVIVGDAQRMLAKVSGPFDLIFQDGDKPQYLTQLDRLVDLLRPGGLLVTDNVLWDGEVVPGFLASPKRNDTDTRAIAEYNERINHHPQLMTVIVPLRDGVAISVKKP

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2738543017 Bacillus sp. OV186 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.21
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.76
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 13.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10398709 3300026116 Bacteria 1330
2 Ga0065712_10094851 3300005290 Bacteria 2239
3 Ga0065707_10309674 3300005295 Bacteria 987
4 Ga0065707_10323254 3300005295 Bacteria 962
5 Ga0070676_10006032 3300005328 Bacteria 6469
6 Ga0070683_100032468 3300005329 Bacteria 4754
7 Ga0070683_100185504 3300005329 Bacteria 1975
8 Ga0070670_100118502 3300005331 Bacteria 2283
9 Ga0068869_100824020 3300005334 Bacteria 799
10 Ga0070666_10022615 3300005335 Bacteria 4085
11 Ga0070666_10259056 3300005335 Unclassified 1233
12 Ga0070682_100122207 3300005337 Bacteria 1750
13 Ga0068868_100054349 3300005338 Bacteria 3155
14 Ga0068868_100169146 3300005338 Bacteria 1809
15 Ga0070689_100114146 3300005340 Bacteria 2152
16 Ga0070668_100071196 3300005347 Bacteria 2708
17 Ga0070669_100054530 3300005353 Bacteria 2928
18 Ga0070669_100133480 3300005353 Bacteria 1907
19 Ga0070675_100008173 3300005354 Bacteria 8110
20 Ga0070671_100339722 3300005355 Bacteria 1281
21 Ga0070674_100220929 3300005356 Bacteria 1474
22 Ga0070674_100259586 3300005356 Bacteria 1368
23 Ga0070673_100019988 3300005364 Bacteria 4821
24 Ga0070673_100100589 3300005364 Bacteria 2380
25 Ga0070688_100302240 3300005365 Unclassified 1157
26 Ga0070703_10244783 3300005406 Bacteria 725
27 Ga0070709_10008290 3300005434 Bacteria 5707
28 Ga0070710_10148899 3300005437 Unclassified 1442
29 Ga0070701_10263761 3300005438 Bacteria 1045
30 Ga0070705_100119604 3300005440 Bacteria 1698
31 Ga0070705_100817351 3300005440 Bacteria 743
32 Ga0070700_100001951 3300005441 Bacteria 10464
33 Ga0070700_100654418 3300005441 Bacteria 830
34 Ga0070694_100028208 3300005444 Bacteria 3650
35 Ga0070694_100189450 3300005444 Bacteria 1527
36 Ga0070662_100036423 3300005457 Bacteria 3480
37 Ga0070662_100077040 3300005457 Bacteria 2474
38 Ga0070681_10005027 3300005458 Bacteria 12748
39 Ga0068867_100139495 3300005459 Bacteria 1894
40 Ga0068867_100182401 3300005459 Bacteria 1670
41 Ga0068867_100214768 3300005459 Unclassified 1547
42 Ga0070707_101220904 3300005468 Bacteria 718
43 Ga0070698_100074937 3300005471 Bacteria 3389
44 Ga0070698_100178079 3300005471 Bacteria 2065
45 Ga0070699_100142014 3300005518 Bacteria 2121
46 Ga0070699_100197138 3300005518 Bacteria 1790
47 Ga0070699_100243245 3300005518 Bacteria 1607
48 Ga0070684_100190456 3300005535 Bacteria 1866
49 Ga0070697_100033666 3300005536 Bacteria 4128
50 Ga0070697_100119190 3300005536 Bacteria 2206
51 Ga0070686_100051702 3300005544 Bacteria 2617
52 Ga0070695_100001702 3300005545 Bacteria 12373
53 Ga0070695_100186440 3300005545 Bacteria 1473
54 Ga0070695_100195799 3300005545 Bacteria 1441
55 Ga0070665_100018557 3300005548 Bacteria 6971
56 Ga0070665_100023225 3300005548 Bacteria 6245
57 Ga0070665_100636297 3300005548 Unclassified 1080
58 Ga0070704_100013395 3300005549 Bacteria 5088
59 Ga0070704_100065016 3300005549 Bacteria 2624
60 Ga0070704_100237671 3300005549 Bacteria 1490
61 Ga0070704_100240365 3300005549 Bacteria 1482
62 Ga0070704_100347377 3300005549 Bacteria 1251
63 Ga0070704_100367433 3300005549 Unclassified 1219
64 Ga0068855_100291777 3300005563 Bacteria 1808
65 Ga0068855_100742819 3300005563 Bacteria 1047
66 Ga0068857_100193245 3300005577 Unclassified 1854
67 Ga0068857_101208920 3300005577 Bacteria 732
68 Ga0068854_100542518 3300005578 Bacteria 985
69 Ga0068856_100012722 3300005614 Bacteria 8148
70 Ga0070702_100016693 3300005615 Bacteria 3772
71 Ga0068859_100170268 3300005617 Bacteria 2259
72 Ga0068864_100006498 3300005618 Bacteria 9578
73 Ga0068866_10051070 3300005718 Bacteria 2103
74 Ga0068861_100018542 3300005719 Bacteria 4958
75 Ga0068861_100902327 3300005719 Unclassified 837
76 Ga0068851_10247695 3300005834 Bacteria 1010
77 Ga0068863_100047664 3300005841 Bacteria 4064
78 Ga0068863_100199793 3300005841 Bacteria 1923
79 Ga0068858_100001195 3300005842 Bacteria 26893
80 Ga0068858_100017067 3300005842 Bacteria 6814
81 Ga0068858_100039189 3300005842 Bacteria 4394
82 Ga0068858_100133957 3300005842 Bacteria 2324
83 Ga0068858_100389646 3300005842 Bacteria 1338
84 Ga0068860_100301163 3300005843 Bacteria 1570
85 Ga0068860_100359551 3300005843 Bacteria 1434
86 Ga0068860_100422504 3300005843 Bacteria 1322
87 Ga0068860_101024829 3300005843 Bacteria 844
88 Ga0068862_100051707 3300005844 Bacteria 3514
89 Ga0068862_100686339 3300005844 Unclassified 991
90 Ga0081455_10117576 3300005937 Bacteria 2101
91 Ga0081455_10374302 3300005937 Bacteria 997
92 Ga0097621_100001981 3300006237 Bacteria 13957
93 Ga0097621_100026980 3300006237 Bacteria 4512
94 Ga0097621_100157064 3300006237 Unclassified 1953
95 Ga0097621_100336962 3300006237 Bacteria 1339
96 Ga0068871_100106790 3300006358 Bacteria 2350
97 Ga0075428_100379445 3300006844 Bacteria 1515
98 Ga0075428_100383623 3300006844 Bacteria 1506
99 Ga0075433_10356364 3300006852 Bacteria 1292
100 Ga0075434_100124392 3300006871 Bacteria 2596
101 Ga0068865_100015969 3300006881 Bacteria 4794
102 Ga0068865_100141073 3300006881 Bacteria 1817
103 Ga0068865_100269568 3300006881 Bacteria 1351
104 Ga0097620_100170275 3300006931 Bacteria 2259
105 Ga0075435_100002333 3300007076 Bacteria 12568
106 Ga0075435_100002895 3300007076 Bacteria 11519
107 Ga0105240_10082523 3300009093 Bacteria 3947
108 Ga0105240_10140985 3300009093 Bacteria 2882
109 Ga0111539_10000935 3300009094 Bacteria 38232
110 Ga0111539_10008540 3300009094 Bacteria 13012
111 Ga0111539_10455093 3300009094 Bacteria 1490
112 Ga0105245_10015905 3300009098 Bacteria 6556
113 Ga0105245_10089696 3300009098 Bacteria 2827
114 Ga0105245_10423919 3300009098 Unclassified 1334
115 Ga0105247_10002020 3300009101 Bacteria 14051
116 Ga0105247_10147047 3300009101 Bacteria 1550
117 Ga0114129_10007867 3300009147 Bacteria 15167
118 Ga0114129_10013657 3300009147 Bacteria 11571
119 Ga0114129_10117078 3300009147 Bacteria 3672
120 Ga0114129_10189994 3300009147 Bacteria 2790
121 Ga0114129_10349607 3300009147 Bacteria 1959
122 Ga0114129_10885939 3300009147 Bacteria 1132
123 Ga0105243_10006691 3300009148 Bacteria 8900
124 Ga0105243_10028042 3300009148 Bacteria 4320
125 Ga0105242_10001497 3300009176 Bacteria 18385
126 Ga0105242_10010723 3300009176 Bacteria 7035
127 Ga0105242_10155440 3300009176 Bacteria 1998
128 Ga0105242_10263817 3300009176 Bacteria 1557
129 Ga0105242_10666029 3300009176 Unclassified 1014
130 Ga0105242_10844516 3300009176 Unclassified 911
131 Ga0105248_10004967 3300009177 Bacteria 14695
132 Ga0105248_10032316 3300009177 Bacteria 5850
133 Ga0105248_10085025 3300009177 Bacteria 3560
134 Ga0105248_10347109 3300009177 Bacteria 1671
135 Ga0105238_10238899 3300009551 Bacteria 1794
136 Ga0105238_10485749 3300009551 Bacteria 1235
137 Ga0105249_10759647 3300009553 Bacteria 1032
138 Ga0105239_10579638 3300010375 Bacteria 1279
139 Ga0157374_10005500 3300013296 Bacteria 10642
140 Ga0157374_10473334 3300013296 Bacteria 1255
141 Ga0157374_11277879 3300013296 Bacteria 756
142 Ga0163162_10194211 3300013306 Unclassified 2158
143 Ga0157375_10252470 3300013308 Bacteria 1924
144 Ga0163163_10021113 3300014325 Bacteria 6142
145 Ga0163163_10638183 3300014325 Bacteria 1128
146 Ga0163163_11359286 3300014325 Bacteria 772
147 Ga0157379_10285364 3300014968 Bacteria 1503
148 Ga0157376_10052476 3300014969 Bacteria 3391
149 Ga0157376_10152202 3300014969 Bacteria 2087
150 Ga0163161_10125570 3300017792 Bacteria 1932
151 Ga0197907_11211912 3300020069 Bacteria 902
152 Ga0206350_10454947 3300020080 Bacteria 1209
153 Ga0206353_10024490 3300020082 Bacteria 1039
154 Ga0213873_10019005 3300021358 Unclassified 1588
155 Ga0224712_10050333 3300022467 Bacteria 1618
156 Ga0207692_10125469 3300025898 Unclassified 1443
157 Ga0207642_10126994 3300025899 Unclassified 1325
158 Ga0207710_10050873 3300025900 Unclassified 1860
159 Ga0207710_10095975 3300025900 Bacteria 1394
160 Ga0207680_10131563 3300025903 Bacteria 1650
161 Ga0207680_10332932 3300025903 Bacteria 1064
162 Ga0207699_10030395 3300025906 Unclassified 3022
163 Ga0207645_10005347 3300025907 Bacteria 9335
164 Ga0207645_10360318 3300025907 Bacteria 974
165 Ga0207654_10584914 3300025911 Unclassified 795
166 Ga0207707_10182425 3300025912 Unclassified 1832
167 Ga0207695_10094368 3300025913 Bacteria 2999
168 Ga0207660_10181277 3300025917 Bacteria 1636
169 Ga0207652_10061637 3300025921 Unclassified 3239
170 Ga0207681_10018066 3300025923 Bacteria 4438
171 Ga0207681_10178358 3300025923 Bacteria 1616
172 Ga0207694_10251393 3300025924 Bacteria 1446
173 Ga0207650_10087970 3300025925 Bacteria 2368
174 Ga0207650_10166488 3300025925 Bacteria 1749
175 Ga0207650_10551692 3300025925 Bacteria 966
176 Ga0207687_10009905 3300025927 Bacteria 6241
177 Ga0207700_10261374 3300025928 Bacteria 1482
178 Ga0207644_10306702 3300025931 Bacteria 1281
179 Ga0207706_10016243 3300025933 Bacteria 6725
180 Ga0207706_10336123 3300025933 Bacteria 1314
181 Ga0207686_10029858 3300025934 Bacteria 3221
182 Ga0207686_10061276 3300025934 Bacteria 2385
183 Ga0207686_10086370 3300025934 Bacteria 2060
184 Ga0207686_10284344 3300025934 Bacteria 1222
185 Ga0207686_10635729 3300025934 Bacteria 843
186 Ga0207669_10171872 3300025937 Unclassified 1543
187 Ga0207669_10301934 3300025937 Bacteria 1217
188 Ga0207704_10004730 3300025938 Bacteria 6248
189 Ga0207704_10273290 3300025938 Bacteria 1281
190 Ga0207704_10281146 3300025938 Bacteria 1265
191 Ga0207691_10217365 3300025940 Unclassified 1658
192 Ga0207691_10567035 3300025940 Unclassified 962
193 Ga0207711_10010415 3300025941 Bacteria 7720
194 Ga0207711_10181558 3300025941 Unclassified 1914
195 Ga0207711_10366320 3300025941 Bacteria 1336
196 Ga0207689_10531834 3300025942 Unclassified 986
197 Ga0207661_10359781 3300025944 Unclassified 1314
198 Ga0207661_10478204 3300025944 Bacteria 1137
199 Ga0207651_10077219 3300025960 Bacteria 2384
200 Ga0207712_10044402 3300025961 Bacteria 3072
201 Ga0207668_10053925 3300025972 Bacteria 2789
202 Ga0207668_10071244 3300025972 Bacteria 2482
203 Ga0207668_10308822 3300025972 Bacteria 1308
204 Ga0207668_11071834 3300025972 Bacteria 722
205 Ga0207640_10019514 3300025981 Bacteria 4007
206 Ga0207658_10333916 3300025986 Bacteria 1316
207 Ga0207677_10033620 3300026023 Bacteria 3311
208 Ga0207677_10097404 3300026023 Bacteria 2155
209 Ga0207677_10298850 3300026023 Unclassified 1329
210 Ga0207703_10097906 3300026035 Bacteria 2480
211 Ga0207703_10107221 3300026035 Bacteria 2378
212 Ga0207703_10366665 3300026035 Bacteria 1329
213 Ga0207703_10513686 3300026035 Bacteria 1126
214 Ga0207639_10262798 3300026041 Unclassified 1510
215 Ga0207708_10001028 3300026075 Bacteria 20878
216 Ga0207708_10142201 3300026075 Bacteria 1883
217 Ga0207641_10000305 3300026088 Bacteria 61185
218 Ga0207641_10095485 3300026088 Bacteria 2610
219 Ga0207641_10532593 3300026088 Bacteria 1144
220 Ga0207648_10096299 3300026089 Bacteria 2590
221 Ga0207648_10199875 3300026089 Bacteria 1773
222 Ga0207648_10441313 3300026089 Unclassified 1184
223 Ga0207648_10787460 3300026089 Unclassified 885
224 Ga0207648_10851253 3300026089 Bacteria 850
225 Ga0207674_10219352 3300026116 Unclassified 1850
226 Ga0207675_100011386 3300026118 Bacteria 8325
227 Ga0207675_100181525 3300026118 Bacteria 2015
228 Ga0207675_100994141 3300026118 Unclassified 857
229 Ga0207675_101233577 3300026118 Bacteria 768
230 Ga0207683_10085574 3300026121 Bacteria 2802
231 Ga0207428_10005438 3300027907 Bacteria 11878
232 Ga0207428_10032249 3300027907 Bacteria 4311
233 Ga0268266_10016288 3300028379 Bacteria 6355
234 Ga0268265_10036294 3300028380 Bacteria 3609
235 Ga0268265_10063859 3300028380 Bacteria 2834
236 Ga0268265_10856793 3300028380 Unclassified 889
237 Ga0268265_10965150 3300028380 Bacteria 840
238 Ga0268264_10088941 3300028381 Bacteria 2659
239 Ga0268264_10094529 3300028381 Bacteria 2584
240 Ga0268264_10199463 3300028381 Bacteria 1830
241 Ga0268264_10906155 3300028381 Bacteria 885
242 Ga0265332_10085280 3300031238 Bacteria 1338
243 Ga0307413_10175509 3300031824 Bacteria 1522
244 Ga0307416_100758104 3300032002 Unclassified 1064
245 Ga0373926_0065460 3300035083 Unclassified 1329
246 Ga0373949_0072588 3300035090 Bacteria 904
247 Ga0373945_0020076 3300035116 Bacteria 2284
248 Ga0373954_0107071 3300035118 Bacteria 1351
249 Ga0373943_0001265 3300035170 Bacteria 11318
250 Ga0373946_0000555 3300035171 Bacteria 12327
251 Ga0373955_0020699 3300035172 Bacteria 3311
252 Ga0373955_0123927 3300035172 Bacteria 1504
253 Ga0373955_0412024 3300035172 Unclassified 822
254 Ga0373931_0407253 3300035691 Bacteria 862
255 Ga0373935_0005913 3300035692 Bacteria 7251
256 Ga0373927_0034823 3300035695 Bacteria 3275
257 Ga0373927_0445839 3300035695 Unclassified 855
258 Ga0373937_0686653 3300036401 Bacteria 970
259 Ga0373925_0000774 3300037068 Bacteria 29390
260 Ga0466966_0195211 3300044684 Bacteria 1226
261 Ga0453684_1290499 3300044712 Unclassified 762
262 Ga0451576_0295135 3300045051 Bacteria 1695
263 Ga0451576_0585851 3300045051 Unclassified 1172
264 Ga0495592_0060529 3300046454 Bacteria 2785
265 Ga0495653_0280387 3300046463 Bacteria 1094
266 Ga0495608_0081441 3300046511 Bacteria 2103
267 Ga0495628_0349219 3300046516 Bacteria 1088
268 Ga0495630_0001845 3300046517 Bacteria 14790
269 Ga0495586_0047807 3300046535 Bacteria 2311
270 Ga0495621_0197798 3300046539 Unclassified 808
271 Ga0495645_0020630 3300046543 Bacteria 4758
272 Ga0495645_0465443 3300046543 Bacteria 795
273 Ga0495667_0354449 3300046559 Unclassified 927
274 Ga0495659_0146697 3300046664 Bacteria 945
275 Ga0495657_0120142 3300046675 Bacteria 1656
276 Ga0495599_0158568 3300046678 Bacteria 1399
277 Ga0495647_0058399 3300046681 Bacteria 1516
278 Ga0495658_0089146 3300046683 Bacteria 1824
279 Ga0495613_0000507 3300046689 Bacteria 32852
280 Ga0495600_0426617 3300046809 Bacteria 822
281 Ga0495674_0071627 3300047319 Bacteria 2991
282 Ga0495684_0000188 3300047471 Bacteria 47553
283 Ga0495684_0622149 3300047471 Bacteria 726
284 Ga0496100_0000448 3300048903 Bacteria 19914
285 Ga0496101_0002514 3300048904 Bacteria 11257
286 Ga0496102_0060758 3300048905 Bacteria 3457
287 Ga0496104_0031992 3300048907 Bacteria 4895
288 Ga0496104_0241341 3300048907 Bacteria 1719
289 Ga0496105_0067097 3300048908 Bacteria 2962
290 Ga0496106_0050432 3300048909 Bacteria 3137
291 Ga0496107_0019653 3300048910 Bacteria 4766
292 Ga0496107_0166783 3300048910 Unclassified 1633
293 Ga0496108_0006500 3300048911 Bacteria 9482
294 Ga0496112_0015766 3300048915 Bacteria 7060
295 Ga0496112_0646786 3300048915 Bacteria 987
296 Ga0496112_0720724 3300048915 Viruses 925
297 Ga0496113_0074457 3300048916 Bacteria 2589
298 Ga0496114_0003658 3300048917 Bacteria 11830
299 Ga0496114_0037122 3300048917 Bacteria 4030
300 Ga0496114_0090296 3300048917 Bacteria 2600
301 Ga0496114_0169819 3300048917 Bacteria 1900
302 Ga0496115_0279086 3300048918 Unclassified 1372
303 Ga0501034_0010792 3300049571 Bacteria 9491
304 Ga0501047_0005626 3300049581 Bacteria 11805
305 Ga0501070_0523468 3300049586 Bacteria 951
306 Ga0501073_0431609 3300049589 Bacteria 910
307 Ga0501044_0002807 3300049823 Bacteria 19856
308 nmdc:mga05p37_128988_c1 3300050507 Bacteria 3104
309 nmdc:mga05p37_14746_c1 3300050507 Bacteria 9387
310 nmdc:mga05p37_210080_c1 3300050507 Bacteria 1467
311 nmdc:mga05p37_26826_c1 3300050507 Bacteria 7008
312 nmdc:mga05p37_510556_c1 3300050507 Bacteria 1377
313 nmdc:mga05p37_7460_c1 3300050507 Bacteria 12894
314 nmdc:mga05p37_95774_c1 3300050507 Bacteria 3657
315 nmdc:mga08y16_147131_c1 3300050511 Bacteria 2449
316 nmdc:mga08y16_7610_c1 3300050511 Bacteria 11336
317 nmdc:mga0n895_298033_c1 3300050512 Bacteria 1635
318 nmdc:mga0rr50_159189_c1 3300050513 Bacteria 1831
319 nmdc:mga0rr50_77501_c1 3300050513 Bacteria 2555
320 nmdc:mga08x19_146440_c1 3300050514 Bacteria 1597
321 nmdc:mga0a205_118986_c1 3300050515 Bacteria 2540
322 nmdc:mga0a205_144117_c1 3300050515 Bacteria 2282
323 nmdc:mga0a205_209839_c1 3300050515 Bacteria 1836
324 nmdc:mga0a205_3450_c1 3300050515 Bacteria 14113
325 Ga0495601_0004328 3300053077 Bacteria 8203
326 Ga0495595_0022747 3300053084 Bacteria 2754
327 Ga0495619_0058652 3300053085 Bacteria 2556
328 Ga0495619_0187352 3300053085 Unclassified 1432
329 Ga0501082_0160734 3300060353 Bacteria 1952
330 2739269281 2738543017 Bacteria 4271950
331 Ga0207674_10398709
332 Ga0065712_10094851
333 Ga0065707_10309674
334 Ga0065707_10323254
335 Ga0070676_10006032
336 Ga0070683_100032468
337 Ga0070683_100185504
338 Ga0070670_100118502
339 Ga0068869_100824020
340 Ga0070666_10022615
341 Ga0070666_10259056
342 Ga0070682_100122207
343 Ga0068868_100054349
344 Ga0068868_100169146
345 Ga0070689_100114146
346 Ga0070668_100071196
347 Ga0070669_100054530
348 Ga0070669_100133480
349 Ga0070675_100008173
350 Ga0070671_100339722
351 Ga0070674_100220929
352 Ga0070674_100259586
353 Ga0070673_100019988
354 Ga0070673_100100589
355 Ga0070688_100302240
356 Ga0070703_10244783
357 Ga0070709_10008290
358 Ga0070710_10148899
359 Ga0070701_10263761
360 Ga0070705_100119604
361 Ga0070705_100817351
362 Ga0070700_100001951
363 Ga0070700_100654418
364 Ga0070694_100028208
365 Ga0070694_100189450
366 Ga0070662_100036423
367 Ga0070662_100077040
368 Ga0070681_10005027
369 Ga0068867_100139495
370 Ga0068867_100182401
371 Ga0068867_100214768
372 Ga0070707_101220904
373 Ga0070698_100074937
374 Ga0070698_100178079
375 Ga0070699_100142014
376 Ga0070699_100197138
377 Ga0070699_100243245
378 Ga0070684_100190456
379 Ga0070697_100033666
380 Ga0070697_100119190
381 Ga0070686_100051702
382 Ga0070695_100001702
383 Ga0070695_100186440
384 Ga0070695_100195799
385 Ga0070665_100018557
386 Ga0070665_100023225
387 Ga0070665_100636297
388 Ga0070704_100013395
389 Ga0070704_100065016
390 Ga0070704_100237671
391 Ga0070704_100240365
392 Ga0070704_100347377
393 Ga0070704_100367433
394 Ga0068855_100291777
395 Ga0068855_100742819
396 Ga0068857_100193245
397 Ga0068857_101208920
398 Ga0068854_100542518
399 Ga0068856_100012722
400 Ga0070702_100016693
401 Ga0068859_100170268
402 Ga0068864_100006498
403 Ga0068866_10051070
404 Ga0068861_100018542
405 Ga0068861_100902327
406 Ga0068851_10247695
407 Ga0068863_100047664
408 Ga0068863_100199793
409 Ga0068858_100001195
410 Ga0068858_100017067
411 Ga0068858_100039189
412 Ga0068858_100133957
413 Ga0068858_100389646
414 Ga0068860_100301163
415 Ga0068860_100359551
416 Ga0068860_100422504
417 Ga0068860_101024829
418 Ga0068862_100051707
419 Ga0068862_100686339
420 Ga0081455_10117576
421 Ga0081455_10374302
422 Ga0097621_100001981
423 Ga0097621_100026980
424 Ga0097621_100157064
425 Ga0097621_100336962
426 Ga0068871_100106790
427 Ga0075428_100379445
428 Ga0075428_100383623
429 Ga0075433_10356364
430 Ga0075434_100124392
431 Ga0068865_100015969
432 Ga0068865_100141073
433 Ga0068865_100269568
434 Ga0097620_100170275
435 Ga0075435_100002333
436 Ga0075435_100002895
437 Ga0105240_10082523
438 Ga0105240_10140985
439 Ga0111539_10000935
440 Ga0111539_10008540
441 Ga0111539_10455093
442 Ga0105245_10015905
443 Ga0105245_10089696
444 Ga0105245_10423919
445 Ga0105247_10002020
446 Ga0105247_10147047
447 Ga0114129_10007867
448 Ga0114129_10013657
449 Ga0114129_10117078
450 Ga0114129_10189994
451 Ga0114129_10349607
452 Ga0114129_10885939
453 Ga0105243_10006691
454 Ga0105243_10028042
455 Ga0105242_10001497
456 Ga0105242_10010723
457 Ga0105242_10155440
458 Ga0105242_10263817
459 Ga0105242_10666029
460 Ga0105242_10844516
461 Ga0105248_10004967
462 Ga0105248_10032316
463 Ga0105248_10085025
464 Ga0105248_10347109
465 Ga0105238_10238899
466 Ga0105238_10485749
467 Ga0105249_10759647
468 Ga0105239_10579638
469 Ga0157374_10005500
470 Ga0157374_10473334
471 Ga0157374_11277879
472 Ga0163162_10194211
473 Ga0157375_10252470
474 Ga0163163_10021113
475 Ga0163163_10638183
476 Ga0163163_11359286
477 Ga0157379_10285364
478 Ga0157376_10052476
479 Ga0157376_10152202
480 Ga0163161_10125570
481 Ga0197907_11211912
482 Ga0206350_10454947
483 Ga0206353_10024490
484 Ga0213873_10019005
485 Ga0224712_10050333
486 Ga0207692_10125469
487 Ga0207642_10126994
488 Ga0207710_10050873
489 Ga0207710_10095975
490 Ga0207680_10131563
491 Ga0207680_10332932
492 Ga0207699_10030395
493 Ga0207645_10005347
494 Ga0207645_10360318
495 Ga0207654_10584914
496 Ga0207707_10182425
497 Ga0207695_10094368
498 Ga0207660_10181277
499 Ga0207652_10061637
500 Ga0207681_10018066
501 Ga0207681_10178358
502 Ga0207694_10251393
503 Ga0207650_10087970
504 Ga0207650_10166488
505 Ga0207650_10551692
506 Ga0207687_10009905
507 Ga0207700_10261374
508 Ga0207644_10306702
509 Ga0207706_10016243
510 Ga0207706_10336123
511 Ga0207686_10029858
512 Ga0207686_10061276
513 Ga0207686_10086370
514 Ga0207686_10284344
515 Ga0207686_10635729
516 Ga0207669_10171872
517 Ga0207669_10301934
518 Ga0207704_10004730
519 Ga0207704_10273290
520 Ga0207704_10281146
521 Ga0207691_10217365
522 Ga0207691_10567035
523 Ga0207711_10010415
524 Ga0207711_10181558
525 Ga0207711_10366320
526 Ga0207689_10531834
527 Ga0207661_10359781
528 Ga0207661_10478204
529 Ga0207651_10077219
530 Ga0207712_10044402
531 Ga0207668_10053925
532 Ga0207668_10071244
533 Ga0207668_10308822
534 Ga0207668_11071834
535 Ga0207640_10019514
536 Ga0207658_10333916
537 Ga0207677_10033620
538 Ga0207677_10097404
539 Ga0207677_10298850
540 Ga0207703_10097906
541 Ga0207703_10107221
542 Ga0207703_10366665
543 Ga0207703_10513686
544 Ga0207639_10262798
545 Ga0207708_10001028
546 Ga0207708_10142201
547 Ga0207641_10000305
548 Ga0207641_10095485
549 Ga0207641_10532593
550 Ga0207648_10096299
551 Ga0207648_10199875
552 Ga0207648_10441313
553 Ga0207648_10787460
554 Ga0207648_10851253
555 Ga0207674_10219352
556 Ga0207675_100011386
557 Ga0207675_100181525
558 Ga0207675_100994141
559 Ga0207675_101233577
560 Ga0207683_10085574
561 Ga0207428_10005438
562 Ga0207428_10032249
563 Ga0268266_10016288
564 Ga0268265_10036294
565 Ga0268265_10063859
566 Ga0268265_10856793
567 Ga0268265_10965150
568 Ga0268264_10088941
569 Ga0268264_10094529
570 Ga0268264_10199463
571 Ga0268264_10906155
572 Ga0265332_10085280
573 Ga0307413_10175509
574 Ga0307416_100758104
575 Ga0373926_0065460
576 Ga0373949_0072588
577 Ga0373945_0020076
578 Ga0373954_0107071
579 Ga0373943_0001265
580 Ga0373946_0000555
581 Ga0373955_0020699
582 Ga0373955_0123927
583 Ga0373955_0412024
584 Ga0373931_0407253
585 Ga0373935_0005913
586 Ga0373927_0034823
587 Ga0373927_0445839
588 Ga0373937_0686653
589 Ga0373925_0000774
590 Ga0466966_0195211
591 Ga0453684_1290499
592 Ga0451576_0295135
593 Ga0451576_0585851
594 Ga0495592_0060529
595 Ga0495653_0280387
596 Ga0495608_0081441
597 Ga0495628_0349219
598 Ga0495630_0001845
599 Ga0495586_0047807
600 Ga0495621_0197798
601 Ga0495645_0020630
602 Ga0495645_0465443
603 Ga0495667_0354449
604 Ga0495659_0146697
605 Ga0495657_0120142
606 Ga0495599_0158568
607 Ga0495647_0058399
608 Ga0495658_0089146
609 Ga0495613_0000507
610 Ga0495600_0426617
611 Ga0495674_0071627
612 Ga0495684_0000188
613 Ga0495684_0622149
614 Ga0496100_0000448
615 Ga0496101_0002514
616 Ga0496102_0060758
617 Ga0496104_0031992
618 Ga0496104_0241341
619 Ga0496105_0067097
620 Ga0496106_0050432
621 Ga0496107_0019653
622 Ga0496107_0166783
623 Ga0496108_0006500
624 Ga0496112_0015766
625 Ga0496112_0646786
626 Ga0496112_0720724
627 Ga0496113_0074457
628 Ga0496114_0003658
629 Ga0496114_0037122
630 Ga0496114_0090296
631 Ga0496114_0169819
632 Ga0496115_0279086
633 Ga0501034_0010792
634 Ga0501047_0005626
635 Ga0501070_0523468
636 Ga0501073_0431609
637 Ga0501044_0002807
638 nmdc:mga05p37_128988_c1
639 nmdc:mga05p37_14746_c1
640 nmdc:mga05p37_210080_c1
641 nmdc:mga05p37_26826_c1
642 nmdc:mga05p37_510556_c1
643 nmdc:mga05p37_7460_c1
644 nmdc:mga05p37_95774_c1
645 nmdc:mga08y16_147131_c1
646 nmdc:mga08y16_7610_c1
647 nmdc:mga0n895_298033_c1
648 nmdc:mga0rr50_159189_c1
649 nmdc:mga0rr50_77501_c1
650 nmdc:mga08x19_146440_c1
651 nmdc:mga0a205_118986_c1
652 nmdc:mga0a205_144117_c1
653 nmdc:mga0a205_209839_c1
654 nmdc:mga0a205_3450_c1
655 Ga0495601_0004328
656 Ga0495595_0022747
657 Ga0495619_0058652
658 Ga0495619_0187352
659 Ga0501082_0160734
660 2739269281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

103

204

0.91

PF13649

Methyltransf_25

Methyltransferase domain

102

197

0.91

PF01596

Methyltransf_3

O-methyltransferase

61

258

0.87

PF08704

GCD14

tRNA methyltransferase complex GCD14 subunit

79

199

0.86

PF13847

Methyltransf_31

Methyltransferase domain

98

234

0.85

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

69

203

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c3p-assembly1.cif.gz_B crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.944 43 248
5lhm-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus apo-form 0.9363 46 248
3c3p-assembly2.cif.gz_C-2 crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.9354 41 247
5zw4-assembly1.cif.gz_A crystal structure of trna bound trmr 0.9331 46 248
5zw3-assembly1.cif.gz_B crystal structure of trmr from b. subtilis 0.9311 46 248
ID Description Score Start End Superfamily
5lhmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9363 46 248 3.40.50.150
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9353 77 246 3.40.50.150
3c3pB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 43 248 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9296 81 247 3.40.50.150
5x7fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9288 45 248 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8L8J5-F1-model_v4 Methyltransferase 0.9886 76 247 GO:0008171
GO:0008757
GO:0032259
AF-A0A7X6I983-F1-model_v4 O-methyltransferase 0.9852 41 248 GO:0008171
GO:0008757
GO:0032259
AF-A0A2V8P8W2-F1-model_v4 O-methyltransferase 0.9841 158 247 GO:0008171
GO:0008757
GO:0032259
AF-A0A3N5J047-F1-model_v4 O-methyltransferase 0.9835 46 248 GO:0008171
GO:0008757
GO:0032259
AF-A0A2H5WW56-F1-model_v4 O-methyltransferase (EC 2.1.1.-) 0.9778 42 248 GO:0008171
GO:0032259

Map