F410117

General Info

Members Datasets Scaffolds Average Seq Length
330 210 330 109

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10203782|Ga0207650_102037822
Length 106
Sequence VSEDEPLDEFEALVADSIDGLPEEFRKLLEKVPVVVSDLGTEAHAYGQYFGDGDFYEDRIVIYRDTLERDFGHDRTLLAREVDRTLRHELAHLLGWDEGGVGGLGL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
114 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 7.88
Rhizosphere 86.06
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1004942 3300000546 Unclassified 1465
2 JGI24740J21852_10007036 3300001979 Bacteria 4612
3 JGI24750J21931_1024613 3300002070 Bacteria 859
4 JGI25404J52841_10008844 3300003659 Unclassified 2149
5 Ga0070683_100494526 3300005329 Bacteria 1168
6 Ga0070683_100565196 3300005329 Bacteria 1088
7 Ga0070670_101246038 3300005331 Unclassified 680
8 Ga0070682_100000011 3300005337 Bacteria 266253
9 Ga0068868_100000141 3300005338 Bacteria 46406
10 Ga0068868_100004956 3300005338 Bacteria 9351
11 Ga0070689_100359338 3300005340 Bacteria 1223
12 Ga0070692_10491787 3300005345 Unclassified 793
13 Ga0070668_100039582 3300005347 Bacteria 3605
14 Ga0070674_100000012 3300005356 Bacteria 130773
15 Ga0070674_100157297 3300005356 Bacteria 1721
16 Ga0070688_100000171 3300005365 Bacteria 34942
17 Ga0070688_100002878 3300005365 Bacteria 8779
18 Ga0070659_100454293 3300005366 Bacteria 1087
19 Ga0070667_100001076 3300005367 Bacteria 24988
20 Ga0070667_100045073 3300005367 Bacteria 3707
21 Ga0070714_100018857 3300005435 Bacteria 5612
22 Ga0070713_100000047 3300005436 Bacteria 76760
23 Ga0070663_100274100 3300005455 Bacteria 1342
24 Ga0070678_100093782 3300005456 Bacteria 2309
25 Ga0070678_100392260 3300005456 Bacteria 1204
26 Ga0070662_100000002 3300005457 Bacteria 253208
27 Ga0068867_100005826 3300005459 Bacteria 8739
28 Ga0070685_10000019 3300005466 Bacteria 105881
29 Ga0070685_10000139 3300005466 Bacteria 46837
30 Ga0070685_10104398 3300005466 Unclassified 1735
31 Ga0070684_100050413 3300005535 Bacteria 3616
32 Ga0070684_100264123 3300005535 Bacteria 1575
33 Ga0068853_100077830 3300005539 Bacteria 2898
34 Ga0070672_100000001 3300005543 Bacteria 204624
35 Ga0070686_100049495 3300005544 Bacteria 2667
36 Ga0070665_100001462 3300005548 Bacteria 27694
37 Ga0070665_100677787 3300005548 Unclassified 1044
38 Ga0070664_100042988 3300005564 Bacteria 3812
39 Ga0070664_100122207 3300005564 Bacteria 2281
40 Ga0068854_100003343 3300005578 Bacteria 9998
41 Ga0068856_100584465 3300005614 Unclassified 1138
42 Ga0068852_100155458 3300005616 Bacteria 2130
43 Ga0068852_101278786 3300005616 Bacteria 755
44 Ga0068866_10000582 3300005718 Bacteria 16610
45 Ga0068861_100252955 3300005719 Unclassified 1504
46 Ga0068851_10000911 3300005834 Bacteria 12735
47 Ga0068870_10049175 3300005840 Bacteria 2223
48 Ga0068863_100131471 3300005841 Bacteria 2390
49 Ga0068863_101676412 3300005841 Bacteria 645
50 Ga0068858_100000508 3300005842 Bacteria 40801
51 Ga0068860_102267187 3300005843 Bacteria 564
52 Ga0068862_100000943 3300005844 Bacteria 28026
53 Ga0081455_10025195 3300005937 Bacteria 5495
54 Ga0081540_1000100 3300005983 Bacteria 91640
55 Ga0081540_1051579 3300005983 Bacteria 2032
56 Ga0081539_10002227 3300005985 Bacteria 28283
57 Ga0075365_10350721 3300006038 Bacteria 1040
58 Ga0075364_10018552 3300006051 Bacteria 4356
59 Ga0070716_100724781 3300006173 Bacteria 762
60 Ga0070712_100189902 3300006175 Unclassified 1607
61 Ga0070712_101815601 3300006175 Unclassified 534
62 Ga0075367_10069774 3300006178 Bacteria 2111
63 Ga0097621_100748902 3300006237 Bacteria 902
64 Ga0075370_10132679 3300006353 Bacteria 1454
65 Ga0068871_100103497 3300006358 Bacteria 2387
66 Ga0068871_100710745 3300006358 Unclassified 921
67 Ga0075430_100061085 3300006846 Bacteria 3167
68 Ga0075433_10000861 3300006852 Bacteria 21257
69 Ga0075435_100515520 3300007076 Bacteria 1034
70 Ga0105245_10002945 3300009098 Bacteria 15274
71 Ga0105245_10789744 3300009098 Bacteria 987
72 Ga0105245_11027193 3300009098 Unclassified 869
73 Ga0105247_10074726 3300009101 Bacteria 2126
74 Ga0105243_10200131 3300009148 Unclassified 1751
75 Ga0105241_10134807 3300009174 Bacteria 2003
76 Ga0105242_10000931 3300009176 Bacteria 22774
77 Ga0105242_10174560 3300009176 Bacteria 1891
78 Ga0105242_10212791 3300009176 Unclassified 1724
79 Ga0105248_10640819 3300009177 Unclassified 1199
80 Ga0105249_10003509 3300009553 Bacteria 13564
81 Ga0105239_10200296 3300010375 Bacteria 2237
82 Ga0105246_10853755 3300011119 Unclassified 812
83 Ga0157370_10014884 3300013104 Bacteria 7936
84 Ga0157369_10000078 3300013105 Bacteria 135173
85 Ga0157374_10000268 3300013296 Bacteria 48268
86 Ga0157374_10031973 3300013296 Bacteria 4788
87 Ga0157378_10124575 3300013297 Bacteria 2379
88 Ga0163162_12377438 3300013306 Bacteria 609
89 Ga0157372_10000053 3300013307 Bacteria 128824
90 Ga0157375_10001535 3300013308 Bacteria 19883
91 Ga0157375_10002514 3300013308 Bacteria 15910
92 Ga0157375_10232664 3300013308 Bacteria 2002
93 Ga0157375_10427492 3300013308 Bacteria 1490
94 Ga0157375_10850846 3300013308 Bacteria 1059
95 Ga0157375_11414283 3300013308 Bacteria 820
96 Ga0163163_10117944 3300014325 Bacteria 2686
97 Ga0157380_10000236 3300014326 Bacteria 33220
98 Ga0157380_10160394 3300014326 Bacteria 1954
99 Ga0157379_10011155 3300014968 Bacteria 7832
100 Ga0157379_10237100 3300014968 Unclassified 1654
101 Ga0157379_12032548 3300014968 Bacteria 568
102 Ga0157376_10905059 3300014969 Bacteria 900
103 Ga0206356_10871592 3300020070 Bacteria 877
104 Ga0207642_10000038 3300025899 Bacteria 38220
105 Ga0207642_10005688 3300025899 Bacteria 4085
106 Ga0207710_10002648 3300025900 Bacteria 8254
107 Ga0207685_10509259 3300025905 Bacteria 634
108 Ga0207643_10144126 3300025908 Unclassified 1424
109 Ga0207650_10203782 3300025925 Bacteria 1586
110 Ga0207687_10003165 3300025927 Bacteria 11169
111 Ga0207687_11325914 3300025927 Unclassified 619
112 Ga0207700_10000033 3300025928 Bacteria 123113
113 Ga0207664_10148735 3300025929 Bacteria 1988
114 Ga0207690_10006710 3300025932 Bacteria 6820
115 Ga0207706_10000001 3300025933 Bacteria 423014
116 Ga0207686_10000116 3300025934 Bacteria 64638
117 Ga0207686_10002477 3300025934 Bacteria 10029
118 Ga0207686_10125231 3300025934 Unclassified 1755
119 Ga0207709_10023528 3300025935 Bacteria 3508
120 Ga0207669_10000838 3300025937 Bacteria 13148
121 Ga0207665_10467518 3300025939 Bacteria 970
122 Ga0207691_10000017 3300025940 Bacteria 134441
123 Ga0207661_10030943 3300025944 Bacteria 4128
124 Ga0207661_10035786 3300025944 Bacteria 3872
125 Ga0207679_10145928 3300025945 Bacteria 1919
126 Ga0207651_10001845 3300025960 Bacteria 9894
127 Ga0207668_10235495 3300025972 Viruses 1478
128 Ga0207640_10000370 3300025981 Bacteria 29030
129 Ga0207658_10128190 3300025986 Bacteria 2034
130 Ga0207677_10002708 3300026023 Bacteria 9342
131 Ga0207703_10000385 3300026035 Bacteria 47298
132 Ga0207639_10047903 3300026041 Bacteria 3233
133 Ga0207678_10311541 3300026067 Bacteria 1353
134 Ga0207708_10065517 3300026075 Bacteria 2777
135 Ga0207708_10094074 3300026075 Bacteria 2313
136 Ga0207702_10481341 3300026078 Unclassified 1208
137 Ga0207702_10766355 3300026078 Bacteria 953
138 Ga0207648_10000499 3300026089 Bacteria 43734
139 Ga0207676_10000018 3300026095 Bacteria 306375
140 Ga0207675_100166673 3300026118 Unclassified 2104
141 Ga0207683_10116961 3300026121 Bacteria 2391
142 Ga0207698_10000042 3300026142 Bacteria 97349
143 Ga0207698_10078878 3300026142 Bacteria 2646
144 Ga0268266_10000601 3300028379 Bacteria 49250
145 Ga0268266_10847898 3300028379 Unclassified 883
146 Ga0373924_0248294 3300035410 Bacteria 788
147 Ga0373937_0147574 3300036401 Bacteria 2202
148 Ga0373937_0426907 3300036401 Bacteria 1258
149 Ga0373937_0837958 3300036401 Bacteria 868
150 Ga0451800_1641900 3300041459 Bacteria 1725
151 Ga0451807_2604067 3300041486 Bacteria 1147
152 Ga0451833_0014308 3300041491 Bacteria 1874
153 Ga0451835_0340765 3300041492 Unclassified 960
154 Ga0451845_0891493 3300041501 Unclassified 1275
155 Ga0451853_0410190 3300041512 Bacteria 1210
156 Ga0451853_3689137 3300041512 Bacteria 686
157 Ga0466963_0056177 3300044694 Bacteria 2619
158 Ga0466963_0063126 3300044694 Bacteria 2479
159 Ga0466957_0026137 3300044842 Bacteria 3462
160 Ga0466957_1339419 3300044842 Bacteria 520
161 Ga0466967_0196401 3300045976 Bacteria 1909
162 Ga0495592_0073862 3300046454 Bacteria 2478
163 Ga0495603_0000302 3300046455 Bacteria 26272
164 Ga0495629_0000487 3300046459 Bacteria 33176
165 Ga0495629_0106270 3300046459 Bacteria 1958
166 Ga0495638_0023872 3300046460 Bacteria 3994
167 Ga0495641_0031790 3300046461 Bacteria 2519
168 Ga0495641_0033104 3300046461 Bacteria 2456
169 Ga0495641_0127014 3300046461 Bacteria 1138
170 Ga0495641_0273676 3300046461 Bacteria 760
171 Ga0495641_0498171 3300046461 Bacteria 555
172 Ga0495651_0083655 3300046462 Bacteria 2406
173 Ga0495651_0113412 3300046462 Bacteria 2001
174 Ga0495651_0124408 3300046462 Unclassified 1890
175 Ga0495651_0289249 3300046462 Bacteria 1104
176 Ga0495651_0799970 3300046462 Bacteria 582
177 Ga0495651_1016507 3300046462 Bacteria 502
178 Ga0495653_0026952 3300046463 Bacteria 4603
179 Ga0495582_0000001 3300046473 Bacteria 252434
180 Ga0495662_0007575 3300046476 Bacteria 5358
181 Ga0495662_0051629 3300046476 Bacteria 1985
182 Ga0495662_0093988 3300046476 Bacteria 1464
183 Ga0495664_0124514 3300046477 Bacteria 1559
184 Ga0495664_0722859 3300046477 Bacteria 588
185 Ga0495594_0000089 3300046499 Bacteria 41876
186 Ga0495608_0011845 3300046511 Bacteria 6068
187 Ga0495620_0065395 3300046515 Bacteria 1501
188 Ga0495628_0000859 3300046516 Bacteria 28076
189 Ga0495628_0053629 3300046516 Bacteria 3181
190 Ga0495628_0083251 3300046516 Bacteria 2484
191 Ga0495628_0651957 3300046516 Bacteria 747
192 Ga0495630_0000256 3300046517 Bacteria 42987
193 Ga0495630_0006055 3300046517 Bacteria 8568
194 Ga0495630_0345636 3300046517 Bacteria 1138
195 Ga0495652_0000010 3300046529 Bacteria 261584
196 Ga0495652_0003765 3300046529 Bacteria 14828
197 Ga0495640_0016919 3300046533 Bacteria 5446
198 Ga0495640_0165004 3300046533 Bacteria 1417
199 Ga0495586_0000083 3300046535 Bacteria 57851
200 Ga0495586_0931888 3300046535 Bacteria 500
201 Ga0495587_0000618 3300046536 Bacteria 24150
202 Ga0495587_0052265 3300046536 Bacteria 2411
203 Ga0495587_0073665 3300046536 Bacteria 1984
204 Ga0495587_0331494 3300046536 Bacteria 849
205 Ga0495587_0501792 3300046536 Bacteria 671
206 Ga0495598_0000128 3300046537 Bacteria 12760
207 Ga0495645_0003378 3300046543 Bacteria 10817
208 Ga0495645_0004552 3300046543 Bacteria 9457
209 Ga0495622_0000218 3300046557 Bacteria 45469
210 Ga0495633_0132823 3300046558 Bacteria 1152
211 Ga0495656_0000876 3300046615 Bacteria 9730
212 Ga0495668_0102561 3300046616 Unclassified 1565
213 Ga0495634_0000344 3300046642 Bacteria 45125
214 Ga0495634_0017049 3300046642 Bacteria 5189
215 Ga0495634_0046465 3300046642 Bacteria 2930
216 Ga0495625_0000688 3300046660 Bacteria 48233
217 Ga0495625_0606308 3300046660 Bacteria 657
218 Ga0495635_0000031 3300046663 Bacteria 110244
219 Ga0495635_0024141 3300046663 Bacteria 4239
220 Ga0495588_0000338 3300046674 Bacteria 30480
221 Ga0495657_0004304 3300046675 Bacteria 11367
222 Ga0495657_0285796 3300046675 Unclassified 986
223 Ga0495599_0674033 3300046678 Bacteria 598
224 Ga0495623_0292948 3300046679 Bacteria 902
225 Ga0495646_0231581 3300046680 Bacteria 996
226 Ga0495647_0000001 3300046681 Bacteria 222371
227 Ga0495647_0002290 3300046681 Bacteria 6005
228 Ga0495658_0000002 3300046683 Bacteria 309651
229 Ga0495658_0001180 3300046683 Bacteria 13784
230 Ga0495658_0667868 3300046683 Bacteria 666
231 Ga0495669_0009965 3300046684 Bacteria 4017
232 Ga0495613_0000005 3300046689 Bacteria 222558
233 Ga0495613_0000041 3300046689 Bacteria 130784
234 Ga0495624_0000019 3300046690 Bacteria 102237
235 Ga0495624_0017885 3300046690 Bacteria 4749
236 Ga0495624_0264776 3300046690 Bacteria 1038
237 Ga0495670_0037981 3300046691 Bacteria 2400
238 Ga0495600_0022722 3300046809 Bacteria 4030
239 Ga0495600_0415800 3300046809 Unclassified 835
240 Ga0495660_0147982 3300046810 Bacteria 1162
241 Ga0495604_0000089 3300047317 Bacteria 77741
242 Ga0495604_0000239 3300047317 Bacteria 49113
243 Ga0495604_0076323 3300047317 Bacteria 2521
244 Ga0495604_0081455 3300047317 Bacteria 2423
245 Ga0495674_0002248 3300047319 Bacteria 18976
246 Ga0495676_0134957 3300047321 Bacteria 1776
247 Ga0495676_0792899 3300047321 Bacteria 610
248 Ga0495680_0050706 3300047322 Bacteria 3244
249 Ga0495680_0486415 3300047322 Bacteria 840
250 Ga0495679_007847 3300047446 Bacteria 4400
251 Ga0495685_007983 3300047447 Bacteria 3506
252 Ga0495673_0233619 3300047469 Unclassified 676
253 Ga0495684_0185963 3300047471 Bacteria 1538
254 Ga0495684_0276495 3300047471 Bacteria 1213
255 Ga0495686_0010748 3300047472 Bacteria 6492
256 Ga0495686_0247990 3300047472 Bacteria 1001
257 Ga0495593_0019459 3300047673 Bacteria 3806
258 Ga0495593_0078493 3300047673 Bacteria 1710
259 Ga0495602_0000611 3300048088 Bacteria 33553
260 Ga0495602_1107523 3300048088 Bacteria 519
261 Ga0496102_0279428 3300048905 Bacteria 1574
262 Ga0496103_0000159 3300048906 Bacteria 71148
263 Ga0496104_0000015 3300048907 Bacteria 374530
264 Ga0496104_0013014 3300048907 Bacteria 7492
265 Ga0496105_0000004 3300048908 Bacteria 475798
266 Ga0496107_0015789 3300048910 Bacteria 5297
267 Ga0496108_0000397 3300048911 Bacteria 35950
268 Ga0496108_0018710 3300048911 Bacteria 5677
269 Ga0496109_0000803 3300048912 Bacteria 26180
270 Ga0496109_0300282 3300048912 Bacteria 1514
271 Ga0496109_0457690 3300048912 Bacteria 1205
272 Ga0496109_0787663 3300048912 Bacteria 889
273 Ga0496109_1375379 3300048912 Bacteria 641
274 Ga0496110_0002711 3300048913 Bacteria 13381
275 Ga0496111_0000035 3300048914 Bacteria 54459
276 Ga0496111_0072347 3300048914 Bacteria 2510
277 Ga0496112_0000002 3300048915 Bacteria 782039
278 Ga0496112_0029205 3300048915 Bacteria 5331
279 Ga0496112_0142430 3300048915 Bacteria 2367
280 Ga0496113_0000026 3300048916 Bacteria 63999
281 Ga0496113_0023696 3300048916 Bacteria 4355
282 Ga0496113_0975442 3300048916 Bacteria 668
283 Ga0496114_0081322 3300048917 Bacteria 2737
284 Ga0496115_0000011 3300048918 Bacteria 222529
285 Ga0496117_0593094 3300048920 Bacteria 520
286 Ga0496119_0027404 3300048922 Bacteria 3916
287 Ga0496120_0040557 3300048923 Bacteria 2735
288 Ga0501041_0102450 3300049577 Bacteria 1773
289 Ga0501042_0077286 3300049578 Unclassified 2383
290 Ga0501042_1032383 3300049578 Unclassified 599
291 Ga0501046_0515553 3300049580 Bacteria 855
292 Ga0501048_1040750 3300049582 Bacteria 589
293 Ga0501068_0433486 3300049584 Bacteria 849
294 Ga0501070_0008842 3300049586 Bacteria 8513
295 Ga0501072_0051109 3300049588 Bacteria 3255
296 Ga0501072_0814964 3300049588 Bacteria 731
297 Ga0501075_0001595 3300049591 Bacteria 14844
298 Ga0501075_0737920 3300049591 Bacteria 750
299 Ga0501076_0229240 3300049592 Bacteria 1518
300 Ga0501083_0871886 3300049744 Bacteria 586
301 nmdc:mga00v17_852408_c1 3300050491 Bacteria 579
302 nmdc:mga0yw44_218388_c1 3300050492 Bacteria 1263
303 nmdc:mga0yw44_255831_c1 3300050492 Bacteria 1166
304 nmdc:mga06z11_136717_c1 3300050494 Bacteria 1381
305 nmdc:mga07m45_126642_c1 3300050496 Bacteria 1477
306 nmdc:mga0qj67_63264_c1 3300050509 Bacteria 2942
307 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
308 Ga0495601_0000038 3300053077 Bacteria 81122
309 Ga0495601_0022468 3300053077 Unclassified 3872
310 Ga0495601_0023674 3300053077 Bacteria 3775
311 Ga0495601_0079417 3300053077 Bacteria 2104
312 Ga0495601_0102190 3300053077 Bacteria 1852
313 Ga0495601_0125697 3300053077 Bacteria 1668
314 Ga0495601_0130073 3300053077 Bacteria 1639
315 Ga0495612_0000767 3300053078 Bacteria 13097
316 Ga0495595_0002837 3300053084 Bacteria 6820
317 Ga0495595_0043383 3300053084 Bacteria 2063
318 Ga0495619_0000008 3300053085 Bacteria 305999
319 Ga0495619_0000102 3300053085 Bacteria 64345
320 Ga0495619_0001946 3300053085 Bacteria 13764
321 Ga0495619_0002409 3300053085 Bacteria 12283
322 Ga0495619_0006201 3300053085 Bacteria 7576
323 Ga0495619_0011670 3300053085 Bacteria 5535
324 Ga0495619_0032617 3300053085 Bacteria 3380
325 Ga0495619_0398426 3300053085 Bacteria 951
326 Ga0495619_0804454 3300053085 Bacteria 636
327 Ga0500566_0000683 3300053094 Bacteria 19070
328 Ga0500641_0002034 3300053096 Bacteria 7181
329 Ga0500628_000001 3300053129 Bacteria 564074
330 Ga0501084_0827813 3300054114 Bacteria 779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005456 Ga0070678_100392260 Ga0070678_1003922603 96
2 3300006038 Ga0075365_10350721 Ga0075365_103507212 100
3 3300006051 Ga0075364_10018552 Ga0075364_100185524 100
4 3300006178 Ga0075367_10069774 Ga0075367_100697743 100
5 3300006353 Ga0075370_10132679 Ga0075370_101326792 100
6 3300025925 Ga0207650_10203782 Ga0207650_102037822 100
7 3300050491 nmdc:mga00v17_852408_c1 nmdc:mga00v17_852408_c1_243_569 100
8 3300050492 nmdc:mga0yw44_218388_c1 nmdc:mga0yw44_218388_c1_376_702 100
9 3300050494 nmdc:mga06z11_136717_c1 nmdc:mga06z11_136717_c1_656_982 100
10 3300050496 nmdc:mga07m45_126642_c1 nmdc:mga07m45_126642_c1_401_727 100
11 3300046459 Ga0495629_0106270 Ga0495629_0106270_1373_1696 102
12 3300046461 Ga0495641_0033104 Ga0495641_0033104_1345_1668 102
13 3300047317 Ga0495604_0081455 Ga0495604_0081455_1776_2102 102
14 3300000546 LJNas_1004942 LJNas_10049422 103
15 3300001979 JGI24740J21852_10007036 JGI24740J21852_100070364 103
16 3300002070 JGI24750J21931_1024613 JGI24750J21931_10246132 103
17 3300003659 JGI25404J52841_10008844 JGI25404J52841_100088443 103
18 3300005329 Ga0070683_100494526 Ga0070683_1004945262 103
19 3300005329 Ga0070683_100565196 Ga0070683_1005651961 103
20 3300005331 Ga0070670_101246038 Ga0070670_1012460382 103
21 3300005337 Ga0070682_100000011 Ga0070682_10000001134 103
22 3300005338 Ga0068868_100000141 Ga0068868_1000001412 103
23 3300005338 Ga0068868_100004956 Ga0068868_1000049563 103
24 3300005340 Ga0070689_100359338 Ga0070689_1003593383 103
25 3300005345 Ga0070692_10491787 Ga0070692_104917872 103
26 3300005347 Ga0070668_100039582 Ga0070668_1000395823 103
27 3300005356 Ga0070674_100000012 Ga0070674_1000000123 103
28 3300005356 Ga0070674_100157297 Ga0070674_1001572971 103
29 3300005365 Ga0070688_100000171 Ga0070688_10000017113 103
30 3300005365 Ga0070688_100002878 Ga0070688_1000028784 103
31 3300005366 Ga0070659_100454293 Ga0070659_1004542931 103
32 3300005367 Ga0070667_100001076 Ga0070667_10000107617 103
33 3300005367 Ga0070667_100045073 Ga0070667_1000450732 103
34 3300005435 Ga0070714_100018857 Ga0070714_1000188572 103
35 3300005436 Ga0070713_100000047 Ga0070713_10000004750 103
36 3300005455 Ga0070663_100274100 Ga0070663_1002741002 103
37 3300005456 Ga0070678_100093782 Ga0070678_1000937822 103
38 3300005457 Ga0070662_100000002 Ga0070662_100000002195 103
39 3300005459 Ga0068867_100005826 Ga0068867_1000058267 103
40 3300005466 Ga0070685_10000019 Ga0070685_1000001968 103
41 3300005466 Ga0070685_10000139 Ga0070685_1000013929 103
42 3300005466 Ga0070685_10104398 Ga0070685_101043983 103
43 3300005535 Ga0070684_100050413 Ga0070684_1000504132 103
44 3300005535 Ga0070684_100264123 Ga0070684_1002641232 103
45 3300005539 Ga0068853_100077830 Ga0068853_1000778302 103
46 3300005543 Ga0070672_100000001 Ga0070672_100000001130 103
47 3300005544 Ga0070686_100049495 Ga0070686_1000494954 103
48 3300005548 Ga0070665_100001462 Ga0070665_10000146228 103
49 3300005548 Ga0070665_100677787 Ga0070665_1006777872 103
50 3300005564 Ga0070664_100042988 Ga0070664_1000429884 103
51 3300005564 Ga0070664_100122207 Ga0070664_1001222072 103
52 3300005578 Ga0068854_100003343 Ga0068854_10000334310 103
53 3300005614 Ga0068856_100584465 Ga0068856_1005844652 103
54 3300005616 Ga0068852_100155458 Ga0068852_1001554582 103
55 3300005616 Ga0068852_101278786 Ga0068852_1012787862 103
56 3300005718 Ga0068866_10000582 Ga0068866_1000058221 103
57 3300005719 Ga0068861_100252955 Ga0068861_1002529552 103
58 3300005834 Ga0068851_10000911 Ga0068851_1000091113 103
59 3300005840 Ga0068870_10049175 Ga0068870_100491753 103
60 3300005841 Ga0068863_100131471 Ga0068863_1001314713 103
61 3300005841 Ga0068863_101676412 Ga0068863_1016764122 103
62 3300005842 Ga0068858_100000508 Ga0068858_10000050825 103
63 3300005843 Ga0068860_102267187 Ga0068860_1022671871 103
64 3300005844 Ga0068862_100000943 Ga0068862_10000094323 103
65 3300005937 Ga0081455_10025195 Ga0081455_100251957 103
66 3300005983 Ga0081540_1000100 Ga0081540_100010038 103
67 3300005983 Ga0081540_1051579 Ga0081540_10515793 103
68 3300005985 Ga0081539_10002227 Ga0081539_1000222718 103
69 3300006173 Ga0070716_100724781 Ga0070716_1007247811 103
70 3300006175 Ga0070712_100189902 Ga0070712_1001899023 103
71 3300006175 Ga0070712_101815601 Ga0070712_1018156011 103
72 3300006237 Ga0097621_100748902 Ga0097621_1007489022 103
73 3300006358 Ga0068871_100103497 Ga0068871_1001034973 103
74 3300006358 Ga0068871_100710745 Ga0068871_1007107452 103
75 3300006846 Ga0075430_100061085 Ga0075430_1000610853 103
76 3300006852 Ga0075433_10000861 Ga0075433_1000086114 103
77 3300007076 Ga0075435_100515520 Ga0075435_1005155203 103
78 3300009098 Ga0105245_10002945 Ga0105245_100029456 103
79 3300009098 Ga0105245_10789744 Ga0105245_107897441 103
80 3300009098 Ga0105245_11027193 Ga0105245_110271931 103
81 3300009101 Ga0105247_10074726 Ga0105247_100747263 103
82 3300009148 Ga0105243_10200131 Ga0105243_102001313 103
83 3300009174 Ga0105241_10134807 Ga0105241_101348072 103
84 3300009176 Ga0105242_10000931 Ga0105242_1000093114 103
85 3300009176 Ga0105242_10174560 Ga0105242_101745602 103
86 3300009176 Ga0105242_10212791 Ga0105242_102127912 103
87 3300009177 Ga0105248_10640819 Ga0105248_106408192 103
88 3300009553 Ga0105249_10003509 Ga0105249_1000350918 103
89 3300010375 Ga0105239_10200296 Ga0105239_102002963 103
90 3300011119 Ga0105246_10853755 Ga0105246_108537552 103
91 3300013104 Ga0157370_10014884 Ga0157370_100148846 103
92 3300013105 Ga0157369_10000078 Ga0157369_1000007840 103
93 3300013296 Ga0157374_10000268 Ga0157374_1000026838 103
94 3300013296 Ga0157374_10031973 Ga0157374_100319734 103
95 3300013297 Ga0157378_10124575 Ga0157378_101245752 103
96 3300013306 Ga0163162_12377438 Ga0163162_123774381 103
97 3300013307 Ga0157372_10000053 Ga0157372_1000005393 103
98 3300013308 Ga0157375_10001535 Ga0157375_100015357 103
99 3300013308 Ga0157375_10002514 Ga0157375_100025144 103
100 3300013308 Ga0157375_10232664 Ga0157375_102326643 103
101 3300013308 Ga0157375_10427492 Ga0157375_104274922 103
102 3300013308 Ga0157375_10850846 Ga0157375_108508461 103
103 3300013308 Ga0157375_11414283 Ga0157375_114142831 103
104 3300014325 Ga0163163_10117944 Ga0163163_101179443 103
105 3300014326 Ga0157380_10000236 Ga0157380_1000023629 103
106 3300014326 Ga0157380_10160394 Ga0157380_101603943 103
107 3300014968 Ga0157379_10011155 Ga0157379_100111556 103
108 3300014968 Ga0157379_10237100 Ga0157379_102371001 103
109 3300014968 Ga0157379_12032548 Ga0157379_120325481 103
110 3300014969 Ga0157376_10905059 Ga0157376_109050592 103
111 3300020070 Ga0206356_10871592 Ga0206356_108715922 103
112 3300025899 Ga0207642_10000038 Ga0207642_1000003821 103
113 3300025899 Ga0207642_10005688 Ga0207642_100056885 103
114 3300025900 Ga0207710_10002648 Ga0207710_100026488 103
115 3300025905 Ga0207685_10509259 Ga0207685_105092592 103
116 3300025908 Ga0207643_10144126 Ga0207643_101441263 103
117 3300025927 Ga0207687_10003165 Ga0207687_100031656 103
118 3300025927 Ga0207687_11325914 Ga0207687_113259141 103
119 3300025928 Ga0207700_10000033 Ga0207700_1000003357 103
120 3300025929 Ga0207664_10148735 Ga0207664_101487352 103
121 3300025932 Ga0207690_10006710 Ga0207690_100067104 103
122 3300025933 Ga0207706_10000001 Ga0207706_10000001376 103
123 3300025934 Ga0207686_10000116 Ga0207686_1000011666 103
124 3300025934 Ga0207686_10002477 Ga0207686_1000247714 103
125 3300025934 Ga0207686_10125231 Ga0207686_101252312 103
126 3300025935 Ga0207709_10023528 Ga0207709_100235282 103
127 3300025937 Ga0207669_10000838 Ga0207669_100008386 103
128 3300025939 Ga0207665_10467518 Ga0207665_104675182 103
129 3300025940 Ga0207691_10000017 Ga0207691_1000001757 103
130 3300025944 Ga0207661_10030943 Ga0207661_100309432 103
131 3300025944 Ga0207661_10035786 Ga0207661_100357864 103
132 3300025945 Ga0207679_10145928 Ga0207679_101459282 103
133 3300025960 Ga0207651_10001845 Ga0207651_1000184512 103
134 3300025972 Ga0207668_10235495 Ga0207668_102354953 103
135 3300025981 Ga0207640_10000370 Ga0207640_1000037028 103
136 3300025986 Ga0207658_10128190 Ga0207658_101281902 103
137 3300026023 Ga0207677_10002708 Ga0207677_100027083 103
138 3300026035 Ga0207703_10000385 Ga0207703_1000038531 103
139 3300026041 Ga0207639_10047903 Ga0207639_100479033 103
140 3300026067 Ga0207678_10311541 Ga0207678_103115412 103
141 3300026075 Ga0207708_10065517 Ga0207708_100655174 103
142 3300026075 Ga0207708_10094074 Ga0207708_100940743 103
143 3300026078 Ga0207702_10481341 Ga0207702_104813412 103
144 3300026078 Ga0207702_10766355 Ga0207702_107663553 103
145 3300026089 Ga0207648_10000499 Ga0207648_1000049943 103
146 3300026095 Ga0207676_10000018 Ga0207676_10000018135 103
147 3300026118 Ga0207675_100166673 Ga0207675_1001666732 103
148 3300026121 Ga0207683_10116961 Ga0207683_101169613 103
149 3300026142 Ga0207698_10000042 Ga0207698_1000004223 103
150 3300026142 Ga0207698_10078878 Ga0207698_100788783 103
151 3300028379 Ga0268266_10000601 Ga0268266_1000060127 103
152 3300028379 Ga0268266_10847898 Ga0268266_108478982 103
153 3300035410 Ga0373924_0248294 Ga0373924_0248294_252_581 103
154 3300036401 Ga0373937_0147574 Ga0373937_0147574_851_1180 103
155 3300036401 Ga0373937_0426907 Ga0373937_0426907_91_426 103
156 3300036401 Ga0373937_0837958 Ga0373937_0837958_349_678 103
157 3300041459 Ga0451800_1641900 Ga0451800_1641900_1107_1439 103
158 3300041486 Ga0451807_2604067 Ga0451807_2604067_137_469 103
159 3300041491 Ga0451833_0014308 Ga0451833_0014308_122_451 103
160 3300041492 Ga0451835_0340765 Ga0451835_0340765_571_900 103
161 3300041501 Ga0451845_0891493 Ga0451845_0891493_13_345 103
162 3300041512 Ga0451853_0410190 Ga0451853_0410190_687_1019 103
163 3300041512 Ga0451853_3689137 Ga0451853_3689137_11_343 103
164 3300044694 Ga0466963_0056177 Ga0466963_0056177_1694_2023 103
165 3300044694 Ga0466963_0063126 Ga0466963_0063126_367_687 103
166 3300044842 Ga0466957_0026137 Ga0466957_0026137_2913_3242 103
167 3300044842 Ga0466957_1339419 Ga0466957_1339419_133_459 103
168 3300045976 Ga0466967_0196401 Ga0466967_0196401_1278_1598 103
169 3300046454 Ga0495592_0073862 Ga0495592_0073862_1126_1455 103
170 3300046455 Ga0495603_0000302 Ga0495603_0000302_18820_19149 103
171 3300046459 Ga0495629_0000487 Ga0495629_0000487_12988_13314 103
172 3300046460 Ga0495638_0023872 Ga0495638_0023872_3108_3437 103
173 3300046461 Ga0495641_0031790 Ga0495641_0031790_1352_1699 103
174 3300046461 Ga0495641_0127014 Ga0495641_0127014_662_997 103
175 3300046461 Ga0495641_0273676 Ga0495641_0273676_202_531 103
176 3300046461 Ga0495641_0498171 Ga0495641_0498171_107_442 103
177 3300046462 Ga0495651_0083655 Ga0495651_0083655_1944_2273 103
178 3300046462 Ga0495651_0113412 Ga0495651_0113412_1075_1404 103
179 3300046462 Ga0495651_0124408 Ga0495651_0124408_145_474 103
180 3300046462 Ga0495651_0289249 Ga0495651_0289249_588_917 103
181 3300046462 Ga0495651_0799970 Ga0495651_0799970_16_342 103
182 3300046462 Ga0495651_1016507 Ga0495651_1016507_110_439 103
183 3300046463 Ga0495653_0026952 Ga0495653_0026952_4218_4547 103
184 3300046473 Ga0495582_0000001 Ga0495582_0000001_45269_45601 103
185 3300046476 Ga0495662_0007575 Ga0495662_0007575_2933_3259 103
186 3300046476 Ga0495662_0051629 Ga0495662_0051629_1367_1708 103
187 3300046476 Ga0495662_0093988 Ga0495662_0093988_1073_1399 103
188 3300046477 Ga0495664_0124514 Ga0495664_0124514_1047_1373 103
189 3300046477 Ga0495664_0722859 Ga0495664_0722859_77_406 103
190 3300046499 Ga0495594_0000089 Ga0495594_0000089_4311_4637 103
191 3300046511 Ga0495608_0011845 Ga0495608_0011845_5449_5778 103
192 3300046515 Ga0495620_0065395 Ga0495620_0065395_646_975 103
193 3300046516 Ga0495628_0000859 Ga0495628_0000859_22000_22329 103
194 3300046516 Ga0495628_0053629 Ga0495628_0053629_55_384 103
195 3300046516 Ga0495628_0083251 Ga0495628_0083251_628_957 103
196 3300046516 Ga0495628_0651957 Ga0495628_0651957_21_350 103
197 3300046517 Ga0495630_0000256 Ga0495630_0000256_14177_14506 103
198 3300046517 Ga0495630_0006055 Ga0495630_0006055_8158_8487 103
199 3300046517 Ga0495630_0345636 Ga0495630_0345636_622_951 103
200 3300046529 Ga0495652_0000010 Ga0495652_0000010_243549_243878 103
201 3300046529 Ga0495652_0003765 Ga0495652_0003765_14188_14517 103
202 3300046533 Ga0495640_0016919 Ga0495640_0016919_511_840 103
203 3300046533 Ga0495640_0165004 Ga0495640_0165004_116_445 103
204 3300046535 Ga0495586_0000083 Ga0495586_0000083_22055_22384 103
205 3300046535 Ga0495586_0931888 Ga0495586_0931888_11_340 103
206 3300046536 Ga0495587_0000618 Ga0495587_0000618_6664_6993 103
207 3300046536 Ga0495587_0052265 Ga0495587_0052265_1458_1787 103
208 3300046536 Ga0495587_0073665 Ga0495587_0073665_50_379 103
209 3300046536 Ga0495587_0331494 Ga0495587_0331494_15_344 103
210 3300046536 Ga0495587_0501792 Ga0495587_0501792_235_564 103
211 3300046537 Ga0495598_0000128 Ga0495598_0000128_4655_4984 103
212 3300046543 Ga0495645_0003378 Ga0495645_0003378_2503_2832 103
213 3300046543 Ga0495645_0004552 Ga0495645_0004552_8677_9006 103
214 3300046557 Ga0495622_0000218 Ga0495622_0000218_19747_20073 103
215 3300046558 Ga0495633_0132823 Ga0495633_0132823_651_980 103
216 3300046615 Ga0495656_0000876 Ga0495656_0000876_1400_1729 103
217 3300046616 Ga0495668_0102561 Ga0495668_0102561_409_738 103
218 3300046642 Ga0495634_0000344 Ga0495634_0000344_43971_44300 103
219 3300046642 Ga0495634_0017049 Ga0495634_0017049_515_856 103
220 3300046642 Ga0495634_0046465 Ga0495634_0046465_1388_1717 103
221 3300046660 Ga0495625_0000688 Ga0495625_0000688_17838_18167 103
222 3300046660 Ga0495625_0606308 Ga0495625_0606308_206_556 103
223 3300046663 Ga0495635_0000031 Ga0495635_0000031_76493_76822 103
224 3300046663 Ga0495635_0024141 Ga0495635_0024141_1473_1802 103
225 3300046674 Ga0495588_0000338 Ga0495588_0000338_21818_22144 103
226 3300046675 Ga0495657_0004304 Ga0495657_0004304_9866_10195 103
227 3300046675 Ga0495657_0285796 Ga0495657_0285796_280_609 103
228 3300046678 Ga0495599_0674033 Ga0495599_0674033_122_451 103
229 3300046679 Ga0495623_0292948 Ga0495623_0292948_51_401 103
230 3300046680 Ga0495646_0231581 Ga0495646_0231581_144_473 103
231 3300046681 Ga0495647_0000001 Ga0495647_0000001_32634_32963 103
232 3300046681 Ga0495647_0002290 Ga0495647_0002290_2280_2609 103
233 3300046683 Ga0495658_0000002 Ga0495658_0000002_168875_169207 103
234 3300046683 Ga0495658_0001180 Ga0495658_0001180_4825_5154 103
235 3300046683 Ga0495658_0667868 Ga0495658_0667868_305_634 103
236 3300046684 Ga0495669_0009965 Ga0495669_0009965_3362_3703 103
237 3300046689 Ga0495613_0000005 Ga0495613_0000005_137924_138253 103
238 3300046689 Ga0495613_0000041 Ga0495613_0000041_23035_23361 103
239 3300046690 Ga0495624_0000019 Ga0495624_0000019_22541_22870 103
240 3300046690 Ga0495624_0017885 Ga0495624_0017885_2169_2498 103
241 3300046690 Ga0495624_0264776 Ga0495624_0264776_658_987 103
242 3300046691 Ga0495670_0037981 Ga0495670_0037981_1051_1380 103
243 3300046809 Ga0495600_0022722 Ga0495600_0022722_3237_3563 103
244 3300046809 Ga0495600_0415800 Ga0495600_0415800_191_520 103
245 3300046810 Ga0495660_0147982 Ga0495660_0147982_12_338 103
246 3300047317 Ga0495604_0000089 Ga0495604_0000089_12435_12764 103
247 3300047317 Ga0495604_0000239 Ga0495604_0000239_34478_34825 103
248 3300047317 Ga0495604_0076323 Ga0495604_0076323_1195_1524 103
249 3300047319 Ga0495674_0002248 Ga0495674_0002248_18093_18422 103
250 3300047321 Ga0495676_0134957 Ga0495676_0134957_509_838 103
251 3300047321 Ga0495676_0792899 Ga0495676_0792899_59_385 103
252 3300047322 Ga0495680_0050706 Ga0495680_0050706_2405_2734 103
253 3300047322 Ga0495680_0486415 Ga0495680_0486415_462_791 103
254 3300047446 Ga0495679_007847 Ga0495679_007847_3928_4257 103
255 3300047447 Ga0495685_007983 Ga0495685_007983_3148_3477 103
256 3300047469 Ga0495673_0233619 Ga0495673_0233619_175_507 103
257 3300047471 Ga0495684_0185963 Ga0495684_0185963_747_1076 103
258 3300047471 Ga0495684_0276495 Ga0495684_0276495_847_1176 103
259 3300047472 Ga0495686_0010748 Ga0495686_0010748_900_1229 103
260 3300047472 Ga0495686_0247990 Ga0495686_0247990_444_773 103
261 3300047673 Ga0495593_0019459 Ga0495593_0019459_3013_3342 103
262 3300047673 Ga0495593_0078493 Ga0495593_0078493_1186_1515 103
263 3300048088 Ga0495602_0000611 Ga0495602_0000611_21037_21366 103
264 3300048088 Ga0495602_1107523 Ga0495602_1107523_94_423 103
265 3300048905 Ga0496102_0279428 Ga0496102_0279428_568_897 103
266 3300048906 Ga0496103_0000159 Ga0496103_0000159_55638_55976 103
267 3300048907 Ga0496104_0000015 Ga0496104_0000015_193424_193759 103
268 3300048907 Ga0496104_0013014 Ga0496104_0013014_184_531 103
269 3300048908 Ga0496105_0000004 Ga0496105_0000004_282040_282375 103
270 3300048910 Ga0496107_0015789 Ga0496107_0015789_3458_3787 103
271 3300048911 Ga0496108_0000397 Ga0496108_0000397_23259_23588 103
272 3300048911 Ga0496108_0018710 Ga0496108_0018710_2546_2875 103
273 3300048912 Ga0496109_0000803 Ga0496109_0000803_17273_17602 103
274 3300048912 Ga0496109_0300282 Ga0496109_0300282_696_1025 103
275 3300048912 Ga0496109_0457690 Ga0496109_0457690_694_1035 103
276 3300048912 Ga0496109_0787663 Ga0496109_0787663_415_747 103
277 3300048912 Ga0496109_1375379 Ga0496109_1375379_130_456 103
278 3300048913 Ga0496110_0002711 Ga0496110_0002711_5525_5851 103
279 3300048914 Ga0496111_0000035 Ga0496111_0000035_8206_8532 103
280 3300048914 Ga0496111_0072347 Ga0496111_0072347_191_520 103
281 3300048915 Ga0496112_0000002 Ga0496112_0000002_506128_506457 103
282 3300048915 Ga0496112_0029205 Ga0496112_0029205_268_594 103
283 3300048915 Ga0496112_0142430 Ga0496112_0142430_1201_1542 103
284 3300048916 Ga0496113_0000026 Ga0496113_0000026_45869_46195 103
285 3300048916 Ga0496113_0023696 Ga0496113_0023696_3398_3739 103
286 3300048916 Ga0496113_0975442 Ga0496113_0975442_266_595 103
287 3300048917 Ga0496114_0081322 Ga0496114_0081322_847_1200 103
288 3300048918 Ga0496115_0000011 Ga0496115_0000011_132222_132575 103
289 3300048920 Ga0496117_0593094 Ga0496117_0593094_79_408 103
290 3300048922 Ga0496119_0027404 Ga0496119_0027404_2396_2731 103
291 3300048923 Ga0496120_0040557 Ga0496120_0040557_1241_1576 103
292 3300049577 Ga0501041_0102450 Ga0501041_0102450_17_343 103
293 3300049578 Ga0501042_0077286 Ga0501042_0077286_899_1228 103
294 3300049578 Ga0501042_1032383 Ga0501042_1032383_70_408 103
295 3300049580 Ga0501046_0515553 Ga0501046_0515553_115_453 103
296 3300049582 Ga0501048_1040750 Ga0501048_1040750_169_498 103
297 3300049584 Ga0501068_0433486 Ga0501068_0433486_431_757 103
298 3300049586 Ga0501070_0008842 Ga0501070_0008842_82_408 103
299 3300049588 Ga0501072_0051109 Ga0501072_0051109_1660_1986 103
300 3300049588 Ga0501072_0814964 Ga0501072_0814964_328_657 103
301 3300049591 Ga0501075_0001595 Ga0501075_0001595_3809_4159 103
302 3300049591 Ga0501075_0737920 Ga0501075_0737920_190_528 103
303 3300049592 Ga0501076_0229240 Ga0501076_0229240_49_375 103
304 3300049744 Ga0501083_0871886 Ga0501083_0871886_202_531 103
305 3300050492 nmdc:mga0yw44_255831_c1 nmdc:mga0yw44_255831_c1_320_649 103
306 3300050509 nmdc:mga0qj67_63264_c1 nmdc:mga0qj67_63264_c1_421_753 103
307 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_16174_16503 103
308 3300053077 Ga0495601_0000038 Ga0495601_0000038_1768_2094 103
309 3300053077 Ga0495601_0022468 Ga0495601_0022468_3013_3342 103
310 3300053077 Ga0495601_0023674 Ga0495601_0023674_2281_2610 103
311 3300053077 Ga0495601_0079417 Ga0495601_0079417_701_1036 103
312 3300053077 Ga0495601_0102190 Ga0495601_0102190_1332_1661 103
313 3300053077 Ga0495601_0125697 Ga0495601_0125697_470_799 103
314 3300053077 Ga0495601_0130073 Ga0495601_0130073_181_510 103
315 3300053078 Ga0495612_0000767 Ga0495612_0000767_4105_4434 103
316 3300053084 Ga0495595_0002837 Ga0495595_0002837_4407_4754 103
317 3300053084 Ga0495595_0043383 Ga0495595_0043383_1404_1733 103
318 3300053085 Ga0495619_0000008 Ga0495619_0000008_162474_162803 103
319 3300053085 Ga0495619_0000102 Ga0495619_0000102_17999_18325 103
320 3300053085 Ga0495619_0001946 Ga0495619_0001946_436_765 103
321 3300053085 Ga0495619_0002409 Ga0495619_0002409_5471_5800 103
322 3300053085 Ga0495619_0006201 Ga0495619_0006201_3610_3939 103
323 3300053085 Ga0495619_0011670 Ga0495619_0011670_3364_3693 103
324 3300053085 Ga0495619_0032617 Ga0495619_0032617_1258_1587 103
325 3300053085 Ga0495619_0398426 Ga0495619_0398426_546_875 103
326 3300053085 Ga0495619_0804454 Ga0495619_0804454_188_517 103
327 3300053094 Ga0500566_0000683 Ga0500566_0000683_10793_11143 103
328 3300053096 Ga0500641_0002034 Ga0500641_0002034_6230_6559 103
329 3300053129 Ga0500628_000001 Ga0500628_000001_216290_216640 103
330 3300054114 Ga0501084_0827813 Ga0501084_0827813_60_386 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

22

105

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7725 4 103
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7461 4 103
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6678 4 92
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.5965 5 94
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.583 4 92
ID Description Score Start End Superfamily
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7641 3 96 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7544 4 103 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7289 4 103 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6956 3 96 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6678 4 92 3.30.2010.20
ID Description Score Start End GO Terms
AF-D3FA17-F1-model_v4 Metallopeptidase family protein 0.9159 4 103 GO:0016020
AF-A0A7W0AQ37-F1-model_v4 Metallopeptidase family protein 0.9154 2 103
AF-A0A7W0LYN1-F1-model_v4 Metallopeptidase family protein 0.9102 2 103 GO:0016020
AF-A0A1Q3NK99-F1-model_v4 deleted 0.9089 4 103
AF-A0A7W0AQ37-F1-model_v4 Metallopeptidase family protein 0.8984 2 103

Feature Viewer

pLDDT pTM Quality
85.47 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map