F410093
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 189 | 328 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10006889|Ga0157379_100068892 |
| Length | 330 |
| Sequence | MLEIVADFKTARVRFRTERAVRLRLKPTRRIHGRPHDIIRALVSQITTVGGAAWDAPDASPGLMPALEGGDVLFLPALAFDVAPSELRLFSPDLVGAAKNVSFDPRSGRLGGTSLDGADRACLRDLLARFSVSASALVGRVLPAYRDRFELGRTSFRPVEIAGRASSWRKDDTRLHVDSFPATPVRGKRILRVFSNVNPDARPRTWRLGEDFESVARRFGGLIRVPLPGSALFLRLLRVTKSRRSPFDALMLQLHDRMKADADYQTQTPQLRVDFPAGSTWIAFTDQVSHAAMAGQYQLEQTFLVPLSAMLDEQRSPLRVLERLIGRPLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 2 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 42 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 114 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 118 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 120 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 121 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 123 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 124 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 128 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 129 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 137 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 166 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 4.55 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10120017 | 3300005290 | Bacteria | 1684 |
| 2 | Ga0070676_10206629 | 3300005328 | Bacteria | 1290 |
| 3 | Ga0070683_100077116 | 3300005329 | Bacteria | 3116 |
| 4 | Ga0070690_100032101 | 3300005330 | Bacteria | 3277 |
| 5 | Ga0070670_100405385 | 3300005331 | Bacteria | 1204 |
| 6 | Ga0070666_10013407 | 3300005335 | Bacteria | 5200 |
| 7 | Ga0070666_10208466 | 3300005335 | Bacteria | 1376 |
| 8 | Ga0068868_100029223 | 3300005338 | Bacteria | 4221 |
| 9 | Ga0068868_100098080 | 3300005338 | Bacteria | 2369 |
| 10 | Ga0070660_100084685 | 3300005339 | Bacteria | 2492 |
| 11 | Ga0070661_100073418 | 3300005344 | Bacteria | 2519 |
| 12 | Ga0070675_100003651 | 3300005354 | Bacteria | 11706 |
| 13 | Ga0070675_100215689 | 3300005354 | Bacteria | 1670 |
| 14 | Ga0070675_100547403 | 3300005354 | Bacteria | 1046 |
| 15 | Ga0070674_100363759 | 3300005356 | Bacteria | 1172 |
| 16 | Ga0070667_100016949 | 3300005367 | Bacteria | 6030 |
| 17 | Ga0070714_100008199 | 3300005435 | Bacteria | 8143 |
| 18 | Ga0070713_100019508 | 3300005436 | Bacteria | 5180 |
| 19 | Ga0070713_100619813 | 3300005436 | Bacteria | 1029 |
| 20 | Ga0070710_10033183 | 3300005437 | Bacteria | 2802 |
| 21 | Ga0070710_10121602 | 3300005437 | Unclassified | 1581 |
| 22 | Ga0070705_100014828 | 3300005440 | Bacteria | 4019 |
| 23 | Ga0070705_100098606 | 3300005440 | Unclassified | 1839 |
| 24 | Ga0070708_100108315 | 3300005445 | Bacteria | 2552 |
| 25 | Ga0068867_100127480 | 3300005459 | Bacteria | 1974 |
| 26 | Ga0070698_100119444 | 3300005471 | Bacteria | 2597 |
| 27 | Ga0070698_100363025 | 3300005471 | Unclassified | 1380 |
| 28 | Ga0070679_100161166 | 3300005530 | Bacteria | 2217 |
| 29 | Ga0068853_100074611 | 3300005539 | Bacteria | 2959 |
| 30 | Ga0070686_100196144 | 3300005544 | Unclassified | 1444 |
| 31 | Ga0070695_100013253 | 3300005545 | Bacteria | 4952 |
| 32 | Ga0070665_100005072 | 3300005548 | Bacteria | 13665 |
| 33 | Ga0070665_100091352 | 3300005548 | Bacteria | 3050 |
| 34 | Ga0070704_100002954 | 3300005549 | Bacteria | 9667 |
| 35 | Ga0070664_100106339 | 3300005564 | Bacteria | 2444 |
| 36 | Ga0068854_100005386 | 3300005578 | Bacteria | 8076 |
| 37 | Ga0068854_100224214 | 3300005578 | Bacteria | 1489 |
| 38 | Ga0068859_100022461 | 3300005617 | Bacteria | 6326 |
| 39 | Ga0068864_100008953 | 3300005618 | Bacteria | 8252 |
| 40 | Ga0068863_100001403 | 3300005841 | Bacteria | 23884 |
| 41 | Ga0068863_100394653 | 3300005841 | Bacteria | 1352 |
| 42 | Ga0068858_100003488 | 3300005842 | Bacteria | 15596 |
| 43 | Ga0068858_100007706 | 3300005842 | Bacteria | 10392 |
| 44 | Ga0068858_100049964 | 3300005842 | Bacteria | 3872 |
| 45 | Ga0068858_100057426 | 3300005842 | Bacteria | 3597 |
| 46 | Ga0068858_100361214 | 3300005842 | Bacteria | 1392 |
| 47 | Ga0068860_100025023 | 3300005843 | Bacteria | 5762 |
| 48 | Ga0068860_100102901 | 3300005843 | Bacteria | 2726 |
| 49 | Ga0068860_100169756 | 3300005843 | Unclassified | 2107 |
| 50 | Ga0068860_100227363 | 3300005843 | Bacteria | 1813 |
| 51 | Ga0068862_100013820 | 3300005844 | Bacteria | 6691 |
| 52 | Ga0081455_10342925 | 3300005937 | Bacteria | 1056 |
| 53 | Ga0070716_100075836 | 3300006173 | Unclassified | 1991 |
| 54 | Ga0070716_100209850 | 3300006173 | Unclassified | 1301 |
| 55 | Ga0097621_100000385 | 3300006237 | Bacteria | 30766 |
| 56 | Ga0097621_100021983 | 3300006237 | Bacteria | 4944 |
| 57 | Ga0097621_100057602 | 3300006237 | Bacteria | 3178 |
| 58 | Ga0097621_100098204 | 3300006237 | Bacteria | 2460 |
| 59 | Ga0097621_100113425 | 3300006237 | Bacteria | 2293 |
| 60 | Ga0097621_100139462 | 3300006237 | Bacteria | 2071 |
| 61 | Ga0068871_100000835 | 3300006358 | Bacteria | 20626 |
| 62 | Ga0068871_100033405 | 3300006358 | Bacteria | 4074 |
| 63 | Ga0068871_100043347 | 3300006358 | Bacteria | 3614 |
| 64 | Ga0075428_100004272 | 3300006844 | Bacteria | 15725 |
| 65 | Ga0075431_100130157 | 3300006847 | Bacteria | 2596 |
| 66 | Ga0075431_100207797 | 3300006847 | Unclassified | 2001 |
| 67 | Ga0075433_10051746 | 3300006852 | Bacteria | 3578 |
| 68 | Ga0075434_100000633 | 3300006871 | Bacteria | 27175 |
| 69 | Ga0075434_100012244 | 3300006871 | Bacteria | 8128 |
| 70 | Ga0075434_100019776 | 3300006871 | Bacteria | 6519 |
| 71 | Ga0075434_100021400 | 3300006871 | Bacteria | 6284 |
| 72 | Ga0075434_100073836 | 3300006871 | Bacteria | 3404 |
| 73 | Ga0075429_100014777 | 3300006880 | Bacteria | 6766 |
| 74 | Ga0075429_100198459 | 3300006880 | Unclassified | 1758 |
| 75 | Ga0068865_100048233 | 3300006881 | Bacteria | 2930 |
| 76 | Ga0075436_100001697 | 3300006914 | Bacteria | 15078 |
| 77 | Ga0075436_100003168 | 3300006914 | Bacteria | 11285 |
| 78 | Ga0097620_100022461 | 3300006931 | Bacteria | 6326 |
| 79 | Ga0075435_100000285 | 3300007076 | Bacteria | 31543 |
| 80 | Ga0075435_100004978 | 3300007076 | Bacteria | 9222 |
| 81 | Ga0075435_100008435 | 3300007076 | Bacteria | 7392 |
| 82 | Ga0075435_100110762 | 3300007076 | Unclassified | 2283 |
| 83 | Ga0075435_100527106 | 3300007076 | Unclassified | 1022 |
| 84 | Ga0105251_10000571 | 3300009011 | Bacteria | 34449 |
| 85 | Ga0105250_10001563 | 3300009092 | Bacteria | 12305 |
| 86 | Ga0105240_10029923 | 3300009093 | Bacteria | 7085 |
| 87 | Ga0105240_10033900 | 3300009093 | Bacteria | 6592 |
| 88 | Ga0105240_10081619 | 3300009093 | Bacteria | 3973 |
| 89 | Ga0105240_10246290 | 3300009093 | Bacteria | 2069 |
| 90 | Ga0105240_10517767 | 3300009093 | Bacteria | 1324 |
| 91 | Ga0111539_10007387 | 3300009094 | Bacteria | 14076 |
| 92 | Ga0111539_10030361 | 3300009094 | Bacteria | 6570 |
| 93 | Ga0111539_10056277 | 3300009094 | Unclassified | 4674 |
| 94 | Ga0111539_10068760 | 3300009094 | Bacteria | 4182 |
| 95 | Ga0111539_10171939 | 3300009094 | Bacteria | 2531 |
| 96 | Ga0111539_10220803 | 3300009094 | Bacteria | 2207 |
| 97 | Ga0111539_10649254 | 3300009094 | Bacteria | 1229 |
| 98 | Ga0105245_10014576 | 3300009098 | Bacteria | 6845 |
| 99 | Ga0105245_10020995 | 3300009098 | Bacteria | 5727 |
| 100 | Ga0105247_10021797 | 3300009101 | Bacteria | 3854 |
| 101 | Ga0114129_10002032 | 3300009147 | Bacteria | 27742 |
| 102 | Ga0114129_10005371 | 3300009147 | Bacteria | 18085 |
| 103 | Ga0114129_10008522 | 3300009147 | Bacteria | 14615 |
| 104 | Ga0114129_10087029 | 3300009147 | Unclassified | 4333 |
| 105 | Ga0105241_10053120 | 3300009174 | Bacteria | 3097 |
| 106 | Ga0105242_10022146 | 3300009176 | Bacteria | 4993 |
| 107 | Ga0105242_10107164 | 3300009176 | Bacteria | 2376 |
| 108 | Ga0105248_10036561 | 3300009177 | Bacteria | 5493 |
| 109 | Ga0105248_10042788 | 3300009177 | Bacteria | 5079 |
| 110 | Ga0105248_10110704 | 3300009177 | Bacteria | 3097 |
| 111 | Ga0105248_10134805 | 3300009177 | Bacteria | 2786 |
| 112 | Ga0105248_10148934 | 3300009177 | Bacteria | 2640 |
| 113 | Ga0105248_10312011 | 3300009177 | Bacteria | 1771 |
| 114 | Ga0105248_10424805 | 3300009177 | Bacteria | 1497 |
| 115 | Ga0105237_10061179 | 3300009545 | Bacteria | 3766 |
| 116 | Ga0105238_10020723 | 3300009551 | Bacteria | 6696 |
| 117 | Ga0105238_10495861 | 3300009551 | Bacteria | 1221 |
| 118 | Ga0105238_10560552 | 3300009551 | Bacteria | 1147 |
| 119 | Ga0157374_10081555 | 3300013296 | Bacteria | 3070 |
| 120 | Ga0157378_10263824 | 3300013297 | Unclassified | 1654 |
| 121 | Ga0157378_10407454 | 3300013297 | Bacteria | 1341 |
| 122 | Ga0157378_10431944 | 3300013297 | Unclassified | 1304 |
| 123 | Ga0163162_10180334 | 3300013306 | Bacteria | 2238 |
| 124 | Ga0157375_10106042 | 3300013308 | Bacteria | 2901 |
| 125 | Ga0157375_10268848 | 3300013308 | Bacteria | 1867 |
| 126 | Ga0163163_10001113 | 3300014325 | Bacteria | 22847 |
| 127 | Ga0163163_10051217 | 3300014325 | Bacteria | 4071 |
| 128 | Ga0163163_10113432 | 3300014325 | Unclassified | 2741 |
| 129 | Ga0163163_10290864 | 3300014325 | Bacteria | 1686 |
| 130 | Ga0157380_10077667 | 3300014326 | Bacteria | 2706 |
| 131 | Ga0157380_10520041 | 3300014326 | Bacteria | 1160 |
| 132 | Ga0157377_10040240 | 3300014745 | Bacteria | 2587 |
| 133 | Ga0157379_10006889 | 3300014968 | Bacteria | 9827 |
| 134 | Ga0157379_10010079 | 3300014968 | Bacteria | 8238 |
| 135 | Ga0157379_10021615 | 3300014968 | Bacteria | 5698 |
| 136 | Ga0157379_10057716 | 3300014968 | Bacteria | 3469 |
| 137 | Ga0157376_10049877 | 3300014969 | Bacteria | 3469 |
| 138 | Ga0157376_10105764 | 3300014969 | Bacteria | 2468 |
| 139 | Ga0157376_10119441 | 3300014969 | Bacteria | 2334 |
| 140 | Ga0157376_10254615 | 3300014969 | Bacteria | 1641 |
| 141 | Ga0157376_10279156 | 3300014969 | Bacteria | 1573 |
| 142 | Ga0209256_1016029 | 3300025299 | Unclassified | 2580 |
| 143 | Ga0207696_1000460 | 3300025711 | Bacteria | 35536 |
| 144 | Ga0207713_1000061 | 3300025735 | Bacteria | 209289 |
| 145 | Ga0207692_10144602 | 3300025898 | Unclassified | 1356 |
| 146 | Ga0207688_10152213 | 3300025901 | Bacteria | 1367 |
| 147 | Ga0207680_10015719 | 3300025903 | Bacteria | 3957 |
| 148 | Ga0207684_10127359 | 3300025910 | Bacteria | 2185 |
| 149 | Ga0207695_10079377 | 3300025913 | Bacteria | 3326 |
| 150 | Ga0207695_10084535 | 3300025913 | Bacteria | 3204 |
| 151 | Ga0207695_10097103 | 3300025913 | Bacteria | 2947 |
| 152 | Ga0207695_10336833 | 3300025913 | Bacteria | 1397 |
| 153 | Ga0207671_10032551 | 3300025914 | Bacteria | 3880 |
| 154 | Ga0207660_10364976 | 3300025917 | Bacteria | 1159 |
| 155 | Ga0207652_10151631 | 3300025921 | Bacteria | 2076 |
| 156 | Ga0207694_10039783 | 3300025924 | Bacteria | 3619 |
| 157 | Ga0207694_10373929 | 3300025924 | Bacteria | 1182 |
| 158 | Ga0207650_10009438 | 3300025925 | Bacteria | 6668 |
| 159 | Ga0207659_10001563 | 3300025926 | Bacteria | 13586 |
| 160 | Ga0207659_10188388 | 3300025926 | Bacteria | 1640 |
| 161 | Ga0207659_10239254 | 3300025926 | Bacteria | 1468 |
| 162 | Ga0207687_10036613 | 3300025927 | Bacteria | 3343 |
| 163 | Ga0207687_10060788 | 3300025927 | Bacteria | 2666 |
| 164 | Ga0207644_10027600 | 3300025931 | Bacteria | 3923 |
| 165 | Ga0207690_10235617 | 3300025932 | Bacteria | 1407 |
| 166 | Ga0207670_10084702 | 3300025936 | Unclassified | 2226 |
| 167 | Ga0207704_10137185 | 3300025938 | Bacteria | 1705 |
| 168 | Ga0207665_10049235 | 3300025939 | Bacteria | 2830 |
| 169 | Ga0207691_10122288 | 3300025940 | Bacteria | 2305 |
| 170 | Ga0207691_10137602 | 3300025940 | Bacteria | 2153 |
| 171 | Ga0207691_10189895 | 3300025940 | Bacteria | 1792 |
| 172 | Ga0207711_10013243 | 3300025941 | Bacteria | 6853 |
| 173 | Ga0207711_10022028 | 3300025941 | Bacteria | 5325 |
| 174 | Ga0207711_10197247 | 3300025941 | Bacteria | 1836 |
| 175 | Ga0207711_10240509 | 3300025941 | Bacteria | 1660 |
| 176 | Ga0207711_10258598 | 3300025941 | Unclassified | 1600 |
| 177 | Ga0207711_10343832 | 3300025941 | Bacteria | 1381 |
| 178 | Ga0207661_10187164 | 3300025944 | Bacteria | 1813 |
| 179 | Ga0207661_10677331 | 3300025944 | Bacteria | 948 |
| 180 | Ga0207679_10141856 | 3300025945 | Bacteria | 1943 |
| 181 | Ga0207679_10495891 | 3300025945 | Bacteria | 1089 |
| 182 | Ga0207651_10017850 | 3300025960 | Unclassified | 4205 |
| 183 | Ga0207651_10301355 | 3300025960 | Bacteria | 1333 |
| 184 | Ga0207668_10094877 | 3300025972 | Bacteria | 2201 |
| 185 | Ga0207640_10101997 | 3300025981 | Bacteria | 2015 |
| 186 | Ga0207640_10264347 | 3300025981 | Bacteria | 1342 |
| 187 | Ga0207658_10030857 | 3300025986 | Bacteria | 3800 |
| 188 | Ga0207677_10041065 | 3300026023 | Bacteria | 3055 |
| 189 | Ga0207677_10066158 | 3300026023 | Bacteria | 2526 |
| 190 | Ga0207703_10027233 | 3300026035 | Bacteria | 4501 |
| 191 | Ga0207703_10029699 | 3300026035 | Bacteria | 4315 |
| 192 | Ga0207703_10085657 | 3300026035 | Bacteria | 2638 |
| 193 | Ga0207703_10200956 | 3300026035 | Bacteria | 1771 |
| 194 | Ga0207639_10020788 | 3300026041 | Bacteria | 4705 |
| 195 | Ga0207639_10023244 | 3300026041 | Bacteria | 4475 |
| 196 | Ga0207639_10524686 | 3300026041 | Bacteria | 1085 |
| 197 | Ga0207641_10000722 | 3300026088 | Bacteria | 35493 |
| 198 | Ga0207641_10332961 | 3300026088 | Bacteria | 1443 |
| 199 | Ga0207648_10051027 | 3300026089 | Bacteria | 3616 |
| 200 | Ga0207648_10239927 | 3300026089 | Bacteria | 1614 |
| 201 | Ga0207648_10435143 | 3300026089 | Unclassified | 1192 |
| 202 | Ga0207676_10020126 | 3300026095 | Bacteria | 4878 |
| 203 | Ga0207676_10078882 | 3300026095 | Unclassified | 2668 |
| 204 | Ga0207683_10047226 | 3300026121 | Bacteria | 3770 |
| 205 | Ga0207428_10011564 | 3300027907 | Bacteria | 7794 |
| 206 | Ga0207428_10016228 | 3300027907 | Bacteria | 6413 |
| 207 | Ga0207428_10039514 | 3300027907 | Bacteria | 3831 |
| 208 | Ga0268266_10026665 | 3300028379 | Bacteria | 4916 |
| 209 | Ga0268266_10117997 | 3300028379 | Bacteria | 2358 |
| 210 | Ga0268265_10024854 | 3300028380 | Unclassified | 4244 |
| 211 | Ga0268264_10020538 | 3300028381 | Bacteria | 5397 |
| 212 | Ga0268264_10108277 | 3300028381 | Bacteria | 2429 |
| 213 | Ga0265325_10124913 | 3300031241 | Bacteria | 1237 |
| 214 | Ga0307416_100131123 | 3300032002 | Bacteria | 2256 |
| 215 | Ga0373958_0000815 | 3300034819 | Bacteria | 3989 |
| 216 | Ga0373928_0009111 | 3300035084 | Bacteria | 1937 |
| 217 | Ga0373929_0002170 | 3300035085 | Unclassified | 3638 |
| 218 | Ga0373934_0087802 | 3300035086 | Bacteria | 1252 |
| 219 | Ga0373940_0006580 | 3300035088 | Bacteria | 2584 |
| 220 | Ga0373949_0003502 | 3300035090 | Bacteria | 3720 |
| 221 | Ga0373952_0002110 | 3300035092 | Bacteria | 3578 |
| 222 | Ga0373932_0000672 | 3300035112 | Bacteria | 10375 |
| 223 | Ga0373936_0181489 | 3300035113 | Unclassified | 924 |
| 224 | Ga0373939_0003558 | 3300035114 | Bacteria | 3656 |
| 225 | Ga0373954_0180648 | 3300035118 | Bacteria | 1035 |
| 226 | Ga0373956_0103557 | 3300035119 | Unclassified | 1322 |
| 227 | Ga0373960_0004430 | 3300035121 | Bacteria | 3217 |
| 228 | Ga0373943_0008594 | 3300035170 | Unclassified | 4578 |
| 229 | Ga0373946_0124981 | 3300035171 | Unclassified | 1178 |
| 230 | Ga0373955_0030041 | 3300035172 | Bacteria | 2833 |
| 231 | Ga0373962_0053379 | 3300035242 | Bacteria | 1169 |
| 232 | Ga0373924_0021967 | 3300035410 | Unclassified | 2491 |
| 233 | Ga0373931_0002139 | 3300035691 | Bacteria | 8705 |
| 234 | Ga0373931_0041443 | 3300035691 | Bacteria | 2419 |
| 235 | Ga0373935_0030680 | 3300035692 | Bacteria | 3333 |
| 236 | Ga0373935_0304645 | 3300035692 | Bacteria | 1127 |
| 237 | Ga0373947_0014521 | 3300035725 | Bacteria | 4520 |
| 238 | Ga0373947_0043902 | 3300035725 | Unclassified | 2671 |
| 239 | Ga0373947_0152033 | 3300035725 | Bacteria | 1491 |
| 240 | Ga0373937_0094584 | 3300036401 | Bacteria | 2771 |
| 241 | Ga0373937_0095523 | 3300036401 | Bacteria | 2756 |
| 242 | Ga0373937_0181756 | 3300036401 | Unclassified | 1975 |
| 243 | Ga0373937_0582330 | 3300036401 | Bacteria | 1063 |
| 244 | Ga0373925_0035706 | 3300037068 | Unclassified | 3669 |
| 245 | Ga0395899_0000013 | 3300037312 | Bacteria | 510397 |
| 246 | Ga0436364_0405699 | 3300037853 | Archaea | 1500 |
| 247 | Ga0436363_0614991 | 3300039450 | Bacteria | 2540 |
| 248 | Ga0436363_0894936 | 3300039450 | Bacteria | 7892 |
| 249 | Ga0451853_1317456 | 3300041512 | Unclassified | 877 |
| 250 | Ga0466966_0112643 | 3300044684 | Bacteria | 1676 |
| 251 | Ga0495629_0355212 | 3300046459 | Unclassified | 999 |
| 252 | Ga0495651_0076640 | 3300046462 | Bacteria | 2533 |
| 253 | Ga0495580_0008181 | 3300046472 | Bacteria | 8325 |
| 254 | Ga0495580_0190943 | 3300046472 | Bacteria | 1413 |
| 255 | Ga0495608_0016263 | 3300046511 | Bacteria | 5145 |
| 256 | Ga0495628_0033269 | 3300046516 | Bacteria | 4156 |
| 257 | Ga0495630_0005352 | 3300046517 | Bacteria | 9053 |
| 258 | Ga0495652_0137443 | 3300046529 | Bacteria | 1926 |
| 259 | Ga0495652_0259037 | 3300046529 | Bacteria | 1285 |
| 260 | Ga0495652_0343199 | 3300046529 | Bacteria | 1072 |
| 261 | Ga0495586_0171296 | 3300046535 | Bacteria | 1227 |
| 262 | Ga0495667_0034587 | 3300046559 | Bacteria | 3378 |
| 263 | Ga0495599_0130627 | 3300046678 | Bacteria | 1560 |
| 264 | Ga0495647_0091936 | 3300046681 | Bacteria | 1245 |
| 265 | Ga0495669_0003009 | 3300046684 | Bacteria | 6926 |
| 266 | Ga0495613_0000620 | 3300046689 | Bacteria | 28244 |
| 267 | Ga0495613_0002710 | 3300046689 | Bacteria | 13296 |
| 268 | Ga0495674_0042947 | 3300047319 | Bacteria | 4028 |
| 269 | Ga0495684_0006698 | 3300047471 | Bacteria | 8939 |
| 270 | Ga0496100_0361040 | 3300048903 | Bacteria | 1099 |
| 271 | Ga0496101_0024713 | 3300048904 | Bacteria | 4161 |
| 272 | Ga0496102_0085625 | 3300048905 | Bacteria | 2910 |
| 273 | Ga0496102_0334131 | 3300048905 | Bacteria | 1427 |
| 274 | Ga0496104_0043685 | 3300048907 | Bacteria | 4209 |
| 275 | Ga0496107_0142776 | 3300048910 | Bacteria | 1770 |
| 276 | Ga0496108_0002194 | 3300048911 | Bacteria | 15633 |
| 277 | Ga0496111_0091833 | 3300048914 | Unclassified | 2225 |
| 278 | Ga0496112_0003322 | 3300048915 | Bacteria | 13273 |
| 279 | Ga0496112_0097296 | 3300048915 | Bacteria | 2914 |
| 280 | Ga0496112_0421288 | 3300048915 | Bacteria | 1274 |
| 281 | Ga0496113_0085349 | 3300048916 | Unclassified | 2425 |
| 282 | Ga0496114_0001268 | 3300048917 | Bacteria | 19064 |
| 283 | Ga0496114_0308549 | 3300048917 | Bacteria | 1397 |
| 284 | Ga0496115_0082984 | 3300048918 | Bacteria | 2612 |
| 285 | Ga0496117_0079219 | 3300048920 | Bacteria | 2166 |
| 286 | Ga0501033_0203116 | 3300049570 | Bacteria | 1415 |
| 287 | Ga0501034_0022355 | 3300049571 | Bacteria | 6445 |
| 288 | Ga0501047_0050845 | 3300049581 | Bacteria | 4002 |
| 289 | Ga0501047_0072732 | 3300049581 | Bacteria | 3309 |
| 290 | Ga0501069_0139535 | 3300049585 | Bacteria | 1390 |
| 291 | Ga0501070_0063685 | 3300049586 | Bacteria | 3054 |
| 292 | Ga0501070_0202860 | 3300049586 | Unclassified | 1628 |
| 293 | Ga0501070_0293240 | 3300049586 | Bacteria | 1326 |
| 294 | Ga0501071_0210117 | 3300049587 | Bacteria | 1463 |
| 295 | Ga0501073_0095360 | 3300049589 | Bacteria | 2066 |
| 296 | Ga0501073_0236705 | 3300049589 | Unclassified | 1261 |
| 297 | Ga0501074_0097943 | 3300049590 | Bacteria | 2099 |
| 298 | Ga0501075_0084377 | 3300049591 | Bacteria | 2406 |
| 299 | Ga0501077_0137777 | 3300049593 | Bacteria | 1547 |
| 300 | Ga0501080_0013019 | 3300049742 | Bacteria | 7638 |
| 301 | Ga0501080_0106495 | 3300049742 | Bacteria | 2598 |
| 302 | Ga0501080_0298925 | 3300049742 | Bacteria | 1460 |
| 303 | Ga0501044_0044631 | 3300049823 | Bacteria | 4599 |
| 304 | nmdc:mga05p37_113107_c1 | 3300050507 | Bacteria | 3338 |
| 305 | nmdc:mga05p37_14078_c1 | 3300050507 | Bacteria | 9599 |
| 306 | nmdc:mga05p37_4667_c1 | 3300050507 | Bacteria | 16014 |
| 307 | nmdc:mga05p37_64023_c1 | 3300050507 | Unclassified | 4524 |
| 308 | nmdc:mga05p37_95048_c1 | 3300050507 | Bacteria | 3672 |
| 309 | nmdc:mga09592_105806_c1 | 3300050508 | Bacteria | 2413 |
| 310 | nmdc:mga06r32_195888_c1 | 3300050510 | Bacteria | 2008 |
| 311 | nmdc:mga08y16_15263_c1 | 3300050511 | Bacteria | 8081 |
| 312 | nmdc:mga08y16_44068_c1 | 3300050511 | Unclassified | 4674 |
| 313 | nmdc:mga0n895_112855_c1 | 3300050512 | Bacteria | 2735 |
| 314 | nmdc:mga0n895_11_c1 | 3300050512 | Bacteria | 112540 |
| 315 | nmdc:mga0n895_65864_c1 | 3300050512 | Bacteria | 3587 |
| 316 | nmdc:mga0n895_8923_c1 | 3300050512 | Bacteria | 8737 |
| 317 | nmdc:mga0rr50_1831_c1 | 3300050513 | Bacteria | 11765 |
| 318 | nmdc:mga0rr50_19_c1 | 3300050513 | Bacteria | 158236 |
| 319 | nmdc:mga08x19_1370_c1 | 3300050514 | Bacteria | 15085 |
| 320 | nmdc:mga08x19_156291_c1 | 3300050514 | Bacteria | 1547 |
| 321 | nmdc:mga08x19_97488_c1 | 3300050514 | Bacteria | 1947 |
| 322 | nmdc:mga0a205_1769_c1 | 3300050515 | Bacteria | 6946 |
| 323 | nmdc:mga0a205_201471_c1 | 3300050515 | Bacteria | 1881 |
| 324 | nmdc:mga0a205_55025_c1 | 3300050515 | Bacteria | 3843 |
| 325 | Ga0495601_0006744 | 3300053077 | Bacteria | 6724 |
| 326 | Ga0495595_0066983 | 3300053084 | Bacteria | 1692 |
| 327 | Ga0495619_0002028 | 3300053085 | Bacteria | 13458 |
| 328 | Ga0530510_0188862 | 3300061734 | Bacteria | 1529 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0079219 | Ga0496117_0079219_1329_2111 | 259 |
| 2 | 3300005435 | Ga0070714_100008199 | Ga0070714_1000081996 | 265 |
| 3 | 3300005548 | Ga0070665_100091352 | Ga0070665_1000913523 | 265 |
| 4 | 3300005843 | Ga0068860_100102901 | Ga0068860_1001029013 | 265 |
| 5 | 3300006237 | Ga0097621_100139462 | Ga0097621_1001394623 | 265 |
| 6 | 3300009093 | Ga0105240_10246290 | Ga0105240_102462902 | 265 |
| 7 | 3300014325 | Ga0163163_10290864 | Ga0163163_102908643 | 265 |
| 8 | 3300025926 | Ga0207659_10188388 | Ga0207659_101883882 | 265 |
| 9 | 3300025944 | Ga0207661_10187164 | Ga0207661_101871642 | 265 |
| 10 | 3300028381 | Ga0268264_10108277 | Ga0268264_101082771 | 265 |
| 11 | 3300049593 | Ga0501077_0137777 | Ga0501077_0137777_709_1506 | 265 |
| 12 | 3300009093 | Ga0105240_10033900 | Ga0105240_100339002 | 266 |
| 13 | 3300025913 | Ga0207695_10084535 | Ga0207695_100845353 | 266 |
| 14 | 3300032002 | Ga0307416_100131123 | Ga0307416_1001311231 | 266 |
| 15 | 3300014326 | Ga0157380_10077667 | Ga0157380_100776672 | 271 |
| 16 | 3300041512 | Ga0451853_1317456 | Ga0451853_1317456_47_862 | 271 |
| 17 | 3300006852 | Ga0075433_10051746 | Ga0075433_100517462 | 274 |
| 18 | 3300006871 | Ga0075434_100019776 | Ga0075434_1000197765 | 274 |
| 19 | 3300050512 | nmdc:mga0n895_8923_c1 | nmdc:mga0n895_8923_c1_7277_8155 | 274 |
| 20 | 3300050515 | nmdc:mga0a205_55025_c1 | nmdc:mga0a205_55025_c1_2088_2966 | 274 |
| 21 | 3300005471 | Ga0070698_100119444 | Ga0070698_1001194441 | 279 |
| 22 | 3300009094 | Ga0111539_10056277 | Ga0111539_100562772 | 279 |
| 23 | 3300050511 | nmdc:mga08y16_44068_c1 | nmdc:mga08y16_44068_c1_3299_4144 | 279 |
| 24 | 3300006847 | Ga0075431_100207797 | Ga0075431_1002077972 | 280 |
| 25 | 3300046529 | Ga0495652_0259037 | Ga0495652_0259037_38_928 | 280 |
| 26 | 3300046689 | Ga0495613_0002710 | Ga0495613_0002710_251_1141 | 280 |
| 27 | 3300005329 | Ga0070683_100077116 | Ga0070683_1000771163 | 281 |
| 28 | 3300005338 | Ga0068868_100029223 | Ga0068868_1000292233 | 281 |
| 29 | 3300005459 | Ga0068867_100127480 | Ga0068867_1001274801 | 281 |
| 30 | 3300005544 | Ga0070686_100196144 | Ga0070686_1001961442 | 281 |
| 31 | 3300005843 | Ga0068860_100227363 | Ga0068860_1002273631 | 281 |
| 32 | 3300006237 | Ga0097621_100000385 | Ga0097621_10000038536 | 281 |
| 33 | 3300006237 | Ga0097621_100021983 | Ga0097621_1000219833 | 281 |
| 34 | 3300006237 | Ga0097621_100057602 | Ga0097621_1000576023 | 281 |
| 35 | 3300006358 | Ga0068871_100000835 | Ga0068871_1000008355 | 281 |
| 36 | 3300006358 | Ga0068871_100033405 | Ga0068871_1000334053 | 281 |
| 37 | 3300006881 | Ga0068865_100048233 | Ga0068865_1000482335 | 281 |
| 38 | 3300009094 | Ga0111539_10030361 | Ga0111539_100303614 | 281 |
| 39 | 3300009098 | Ga0105245_10020995 | Ga0105245_100209953 | 281 |
| 40 | 3300009177 | Ga0105248_10134805 | Ga0105248_101348052 | 281 |
| 41 | 3300009177 | Ga0105248_10424805 | Ga0105248_104248052 | 281 |
| 42 | 3300013296 | Ga0157374_10081555 | Ga0157374_100815553 | 281 |
| 43 | 3300014969 | Ga0157376_10049877 | Ga0157376_100498772 | 281 |
| 44 | 3300014969 | Ga0157376_10254615 | Ga0157376_102546152 | 281 |
| 45 | 3300025927 | Ga0207687_10060788 | Ga0207687_100607882 | 281 |
| 46 | 3300025940 | Ga0207691_10122288 | Ga0207691_101222883 | 281 |
| 47 | 3300025941 | Ga0207711_10343832 | Ga0207711_103438321 | 281 |
| 48 | 3300025944 | Ga0207661_10677331 | Ga0207661_106773311 | 281 |
| 49 | 3300026023 | Ga0207677_10041065 | Ga0207677_100410653 | 281 |
| 50 | 3300026035 | Ga0207703_10085657 | Ga0207703_100856572 | 281 |
| 51 | 3300026089 | Ga0207648_10051027 | Ga0207648_100510273 | 281 |
| 52 | 3300026121 | Ga0207683_10047226 | Ga0207683_100472263 | 281 |
| 53 | 3300027907 | Ga0207428_10016228 | Ga0207428_100162284 | 281 |
| 54 | 3300035113 | Ga0373936_0181489 | Ga0373936_0181489_32_880 | 281 |
| 55 | 3300035118 | Ga0373954_0180648 | Ga0373954_0180648_128_973 | 281 |
| 56 | 3300035170 | Ga0373943_0008594 | Ga0373943_0008594_1387_2235 | 281 |
| 57 | 3300035171 | Ga0373946_0124981 | Ga0373946_0124981_35_886 | 281 |
| 58 | 3300035172 | Ga0373955_0030041 | Ga0373955_0030041_693_1544 | 281 |
| 59 | 3300035410 | Ga0373924_0021967 | Ga0373924_0021967_645_1493 | 281 |
| 60 | 3300035692 | Ga0373935_0304645 | Ga0373935_0304645_244_1095 | 281 |
| 61 | 3300035725 | Ga0373947_0014521 | Ga0373947_0014521_3051_3899 | 281 |
| 62 | 3300036401 | Ga0373937_0181756 | Ga0373937_0181756_123_968 | 281 |
| 63 | 3300036401 | Ga0373937_0582330 | Ga0373937_0582330_126_971 | 281 |
| 64 | 3300037068 | Ga0373925_0035706 | Ga0373925_0035706_1101_1949 | 281 |
| 65 | 3300046462 | Ga0495651_0076640 | Ga0495651_0076640_1245_2096 | 281 |
| 66 | 3300046511 | Ga0495608_0016263 | Ga0495608_0016263_2128_2979 | 281 |
| 67 | 3300046516 | Ga0495628_0033269 | Ga0495628_0033269_2275_3126 | 281 |
| 68 | 3300046517 | Ga0495630_0005352 | Ga0495630_0005352_2926_3777 | 281 |
| 69 | 3300046529 | Ga0495652_0343199 | Ga0495652_0343199_160_1011 | 281 |
| 70 | 3300046559 | Ga0495667_0034587 | Ga0495667_0034587_2237_3088 | 281 |
| 71 | 3300046678 | Ga0495599_0130627 | Ga0495599_0130627_324_1175 | 281 |
| 72 | 3300046684 | Ga0495669_0003009 | Ga0495669_0003009_72_923 | 281 |
| 73 | 3300046689 | Ga0495613_0000620 | Ga0495613_0000620_25017_25868 | 281 |
| 74 | 3300047319 | Ga0495674_0042947 | Ga0495674_0042947_2893_3744 | 281 |
| 75 | 3300047471 | Ga0495684_0006698 | Ga0495684_0006698_5354_6205 | 281 |
| 76 | 3300048904 | Ga0496101_0024713 | Ga0496101_0024713_363_1208 | 281 |
| 77 | 3300048905 | Ga0496102_0085625 | Ga0496102_0085625_604_1449 | 281 |
| 78 | 3300048915 | Ga0496112_0097296 | Ga0496112_0097296_1147_1992 | 281 |
| 79 | 3300048917 | Ga0496114_0001268 | Ga0496114_0001268_16156_17001 | 281 |
| 80 | 3300048918 | Ga0496115_0082984 | Ga0496115_0082984_1561_2406 | 281 |
| 81 | 3300050511 | nmdc:mga08y16_15263_c1 | nmdc:mga08y16_15263_c1_5145_6008 | 281 |
| 82 | 3300053077 | Ga0495601_0006744 | Ga0495601_0006744_263_1114 | 281 |
| 83 | 3300053084 | Ga0495595_0066983 | Ga0495595_0066983_567_1418 | 281 |
| 84 | 3300053085 | Ga0495619_0002028 | Ga0495619_0002028_2131_2982 | 281 |
| 85 | 3300005539 | Ga0068853_100074611 | Ga0068853_1000746113 | 282 |
| 86 | 3300006237 | Ga0097621_100098204 | Ga0097621_1000982042 | 282 |
| 87 | 3300009093 | Ga0105240_10029923 | Ga0105240_100299233 | 282 |
| 88 | 3300009545 | Ga0105237_10061179 | Ga0105237_100611791 | 282 |
| 89 | 3300025913 | Ga0207695_10097103 | Ga0207695_100971031 | 282 |
| 90 | 3300025914 | Ga0207671_10032551 | Ga0207671_100325513 | 282 |
| 91 | 3300026041 | Ga0207639_10020788 | Ga0207639_100207883 | 282 |
| 92 | 3300035725 | Ga0373947_0043902 | Ga0373947_0043902_903_1760 | 285 |
| 93 | 3300046459 | Ga0495629_0355212 | Ga0495629_0355212_13_870 | 285 |
| 94 | 3300009094 | Ga0111539_10007387 | Ga0111539_100073872 | 287 |
| 95 | 3300049742 | Ga0501080_0106495 | Ga0501080_0106495_1545_2420 | 287 |
| 96 | 3300050508 | nmdc:mga09592_105806_c1 | nmdc:mga09592_105806_c1_561_1424 | 287 |
| 97 | iso_pu_bacteria | 2883291878 | 2883294290 | 287 |
| 98 | iso_pu_bacteria | 2883354860 | 2883357186 | 287 |
| 99 | 3300005436 | Ga0070713_100019508 | Ga0070713_1000195085 | 288 |
| 100 | 3300005437 | Ga0070710_10033183 | Ga0070710_100331832 | 288 |
| 101 | 3300006173 | Ga0070716_100209850 | Ga0070716_1002098501 | 288 |
| 102 | 3300037312 | Ga0395899_0000013 | Ga0395899_0000013_91738_92628 | 288 |
| 103 | 3300039450 | Ga0436363_0614991 | Ga0436363_0614991_1326_2198 | 288 |
| 104 | 3300044684 | Ga0466966_0112643 | Ga0466966_0112643_733_1623 | 288 |
| 105 | 3300048905 | Ga0496102_0334131 | Ga0496102_0334131_371_1237 | 288 |
| 106 | 3300009176 | Ga0105242_10107164 | Ga0105242_101071642 | 289 |
| 107 | 3300046535 | Ga0495586_0171296 | Ga0495586_0171296_306_1175 | 289 |
| 108 | 3300048917 | Ga0496114_0308549 | Ga0496114_0308549_372_1241 | 289 |
| 109 | 3300049570 | Ga0501033_0203116 | Ga0501033_0203116_523_1392 | 289 |
| 110 | 3300049571 | Ga0501034_0022355 | Ga0501034_0022355_1629_2498 | 289 |
| 111 | 3300049581 | Ga0501047_0050845 | Ga0501047_0050845_2967_3836 | 289 |
| 112 | 3300049823 | Ga0501044_0044631 | Ga0501044_0044631_2775_3644 | 289 |
| 113 | 3300005331 | Ga0070670_100405385 | Ga0070670_1004053852 | 290 |
| 114 | 3300005338 | Ga0068868_100098080 | Ga0068868_1000980802 | 290 |
| 115 | 3300005344 | Ga0070661_100073418 | Ga0070661_1000734183 | 290 |
| 116 | 3300005354 | Ga0070675_100003651 | Ga0070675_1000036516 | 290 |
| 117 | 3300005354 | Ga0070675_100547403 | Ga0070675_1005474031 | 290 |
| 118 | 3300005356 | Ga0070674_100363759 | Ga0070674_1003637592 | 290 |
| 119 | 3300005445 | Ga0070708_100108315 | Ga0070708_1001083151 | 290 |
| 120 | 3300005548 | Ga0070665_100005072 | Ga0070665_1000050722 | 290 |
| 121 | 3300005564 | Ga0070664_100106339 | Ga0070664_1001063393 | 290 |
| 122 | 3300005842 | Ga0068858_100049964 | Ga0068858_1000499645 | 290 |
| 123 | 3300006358 | Ga0068871_100043347 | Ga0068871_1000433473 | 290 |
| 124 | 3300006914 | Ga0075436_100003168 | Ga0075436_1000031686 | 290 |
| 125 | 3300009093 | Ga0105240_10517767 | Ga0105240_105177671 | 290 |
| 126 | 3300009098 | Ga0105245_10014576 | Ga0105245_100145762 | 290 |
| 127 | 3300009147 | Ga0114129_10005371 | Ga0114129_1000537111 | 290 |
| 128 | 3300009147 | Ga0114129_10087029 | Ga0114129_100870296 | 290 |
| 129 | 3300009176 | Ga0105242_10022146 | Ga0105242_100221465 | 290 |
| 130 | 3300009177 | Ga0105248_10110704 | Ga0105248_101107043 | 290 |
| 131 | 3300009551 | Ga0105238_10560552 | Ga0105238_105605521 | 290 |
| 132 | 3300013306 | Ga0163162_10180334 | Ga0163162_101803342 | 290 |
| 133 | 3300014745 | Ga0157377_10040240 | Ga0157377_100402402 | 290 |
| 134 | 3300014969 | Ga0157376_10119441 | Ga0157376_101194412 | 290 |
| 135 | 3300025299 | Ga0209256_1016029 | Ga0209256_10160293 | 290 |
| 136 | 3300025913 | Ga0207695_10336833 | Ga0207695_103368332 | 290 |
| 137 | 3300025926 | Ga0207659_10001563 | Ga0207659_100015636 | 290 |
| 138 | 3300025927 | Ga0207687_10036613 | Ga0207687_100366132 | 290 |
| 139 | 3300025940 | Ga0207691_10189895 | Ga0207691_101898952 | 290 |
| 140 | 3300025941 | Ga0207711_10197247 | Ga0207711_101972473 | 290 |
| 141 | 3300025945 | Ga0207679_10141856 | Ga0207679_101418562 | 290 |
| 142 | 3300026023 | Ga0207677_10066158 | Ga0207677_100661582 | 290 |
| 143 | 3300026035 | Ga0207703_10200956 | Ga0207703_102009563 | 290 |
| 144 | 3300028379 | Ga0268266_10117997 | Ga0268266_101179974 | 290 |
| 145 | 3300048903 | Ga0496100_0361040 | Ga0496100_0361040_24_896 | 290 |
| 146 | 3300049586 | Ga0501070_0293240 | Ga0501070_0293240_442_1314 | 290 |
| 147 | 3300049587 | Ga0501071_0210117 | Ga0501071_0210117_395_1267 | 290 |
| 148 | 3300049590 | Ga0501074_0097943 | Ga0501074_0097943_388_1260 | 290 |
| 149 | 3300049591 | Ga0501075_0084377 | Ga0501075_0084377_1054_1926 | 290 |
| 150 | 3300049742 | Ga0501080_0298925 | Ga0501080_0298925_274_1146 | 290 |
| 151 | 3300050507 | nmdc:mga05p37_14078_c1 | nmdc:mga05p37_14078_c1_3841_4755 | 290 |
| 152 | 3300050507 | nmdc:mga05p37_64023_c1 | nmdc:mga05p37_64023_c1_3002_3874 | 290 |
| 153 | 3300050515 | nmdc:mga0a205_201471_c1 | nmdc:mga0a205_201471_c1_771_1685 | 290 |
| 154 | 3300061734 | Ga0530510_0188862 | Ga0530510_0188862_325_1197 | 290 |
| 155 | 3300005328 | Ga0070676_10206629 | Ga0070676_102066291 | 291 |
| 156 | 3300005330 | Ga0070690_100032101 | Ga0070690_1000321012 | 291 |
| 157 | 3300005335 | Ga0070666_10013407 | Ga0070666_100134077 | 291 |
| 158 | 3300005339 | Ga0070660_100084685 | Ga0070660_1000846853 | 291 |
| 159 | 3300005437 | Ga0070710_10121602 | Ga0070710_101216021 | 291 |
| 160 | 3300005440 | Ga0070705_100014828 | Ga0070705_1000148283 | 291 |
| 161 | 3300005440 | Ga0070705_100098606 | Ga0070705_1000986061 | 291 |
| 162 | 3300005545 | Ga0070695_100013253 | Ga0070695_1000132532 | 291 |
| 163 | 3300005549 | Ga0070704_100002954 | Ga0070704_1000029543 | 291 |
| 164 | 3300005578 | Ga0068854_100005386 | Ga0068854_1000053864 | 291 |
| 165 | 3300005617 | Ga0068859_100022461 | Ga0068859_1000224616 | 291 |
| 166 | 3300005618 | Ga0068864_100008953 | Ga0068864_1000089538 | 291 |
| 167 | 3300005842 | Ga0068858_100003488 | Ga0068858_1000034884 | 291 |
| 168 | 3300005842 | Ga0068858_100007706 | Ga0068858_10000770611 | 291 |
| 169 | 3300005843 | Ga0068860_100169756 | Ga0068860_1001697562 | 291 |
| 170 | 3300006173 | Ga0070716_100075836 | Ga0070716_1000758362 | 291 |
| 171 | 3300006237 | Ga0097621_100113425 | Ga0097621_1001134252 | 291 |
| 172 | 3300006844 | Ga0075428_100004272 | Ga0075428_10000427214 | 291 |
| 173 | 3300006871 | Ga0075434_100000633 | Ga0075434_10000063326 | 291 |
| 174 | 3300006871 | Ga0075434_100021400 | Ga0075434_1000214007 | 291 |
| 175 | 3300006871 | Ga0075434_100073836 | Ga0075434_1000738362 | 291 |
| 176 | 3300006880 | Ga0075429_100014777 | Ga0075429_1000147774 | 291 |
| 177 | 3300006880 | Ga0075429_100198459 | Ga0075429_1001984592 | 291 |
| 178 | 3300006914 | Ga0075436_100001697 | Ga0075436_10000169714 | 291 |
| 179 | 3300006931 | Ga0097620_100022461 | Ga0097620_1000224614 | 291 |
| 180 | 3300007076 | Ga0075435_100000285 | Ga0075435_10000028528 | 291 |
| 181 | 3300007076 | Ga0075435_100008435 | Ga0075435_1000084353 | 291 |
| 182 | 3300007076 | Ga0075435_100110762 | Ga0075435_1001107622 | 291 |
| 183 | 3300007076 | Ga0075435_100527106 | Ga0075435_1005271061 | 291 |
| 184 | 3300009011 | Ga0105251_10000571 | Ga0105251_1000057122 | 291 |
| 185 | 3300009092 | Ga0105250_10001563 | Ga0105250_1000156310 | 291 |
| 186 | 3300009093 | Ga0105240_10081619 | Ga0105240_100816193 | 291 |
| 187 | 3300009094 | Ga0111539_10171939 | Ga0111539_101719392 | 291 |
| 188 | 3300009101 | Ga0105247_10021797 | Ga0105247_100217972 | 291 |
| 189 | 3300009147 | Ga0114129_10002032 | Ga0114129_1000203220 | 291 |
| 190 | 3300009174 | Ga0105241_10053120 | Ga0105241_100531202 | 291 |
| 191 | 3300009177 | Ga0105248_10042788 | Ga0105248_100427886 | 291 |
| 192 | 3300009177 | Ga0105248_10312011 | Ga0105248_103120112 | 291 |
| 193 | 3300009551 | Ga0105238_10020723 | Ga0105238_100207236 | 291 |
| 194 | 3300009551 | Ga0105238_10495861 | Ga0105238_104958612 | 291 |
| 195 | 3300013297 | Ga0157378_10431944 | Ga0157378_104319441 | 291 |
| 196 | 3300013308 | Ga0157375_10268848 | Ga0157375_102688482 | 291 |
| 197 | 3300014325 | Ga0163163_10001113 | Ga0163163_1000111311 | 291 |
| 198 | 3300014325 | Ga0163163_10051217 | Ga0163163_100512173 | 291 |
| 199 | 3300014325 | Ga0163163_10113432 | Ga0163163_101134322 | 291 |
| 200 | 3300014968 | Ga0157379_10021615 | Ga0157379_100216153 | 291 |
| 201 | 3300014968 | Ga0157379_10057716 | Ga0157379_100577163 | 291 |
| 202 | 3300014969 | Ga0157376_10279156 | Ga0157376_102791562 | 291 |
| 203 | 3300025711 | Ga0207696_1000460 | Ga0207696_10004608 | 291 |
| 204 | 3300025735 | Ga0207713_1000061 | Ga0207713_10000618 | 291 |
| 205 | 3300025898 | Ga0207692_10144602 | Ga0207692_101446021 | 291 |
| 206 | 3300025903 | Ga0207680_10015719 | Ga0207680_100157193 | 291 |
| 207 | 3300025913 | Ga0207695_10079377 | Ga0207695_100793772 | 291 |
| 208 | 3300025917 | Ga0207660_10364976 | Ga0207660_103649762 | 291 |
| 209 | 3300025921 | Ga0207652_10151631 | Ga0207652_101516312 | 291 |
| 210 | 3300025924 | Ga0207694_10373929 | Ga0207694_103739291 | 291 |
| 211 | 3300025925 | Ga0207650_10009438 | Ga0207650_100094383 | 291 |
| 212 | 3300025932 | Ga0207690_10235617 | Ga0207690_102356172 | 291 |
| 213 | 3300025936 | Ga0207670_10084702 | Ga0207670_100847024 | 291 |
| 214 | 3300025939 | Ga0207665_10049235 | Ga0207665_100492353 | 291 |
| 215 | 3300025941 | Ga0207711_10013243 | Ga0207711_100132435 | 291 |
| 216 | 3300025941 | Ga0207711_10240509 | Ga0207711_102405091 | 291 |
| 217 | 3300025945 | Ga0207679_10495891 | Ga0207679_104958912 | 291 |
| 218 | 3300025981 | Ga0207640_10101997 | Ga0207640_101019971 | 291 |
| 219 | 3300025981 | Ga0207640_10264347 | Ga0207640_102643472 | 291 |
| 220 | 3300026035 | Ga0207703_10029699 | Ga0207703_100296994 | 291 |
| 221 | 3300026041 | Ga0207639_10023244 | Ga0207639_100232443 | 291 |
| 222 | 3300026088 | Ga0207641_10332961 | Ga0207641_103329612 | 291 |
| 223 | 3300026089 | Ga0207648_10239927 | Ga0207648_102399273 | 291 |
| 224 | 3300026095 | Ga0207676_10020126 | Ga0207676_100201264 | 291 |
| 225 | 3300026095 | Ga0207676_10078882 | Ga0207676_100788823 | 291 |
| 226 | 3300027907 | Ga0207428_10011564 | Ga0207428_100115648 | 291 |
| 227 | 3300028379 | Ga0268266_10026665 | Ga0268266_100266653 | 291 |
| 228 | 3300031241 | Ga0265325_10124913 | Ga0265325_101249131 | 291 |
| 229 | 3300034819 | Ga0373958_0000815 | Ga0373958_0000815_2040_2915 | 291 |
| 230 | 3300035084 | Ga0373928_0009111 | Ga0373928_0009111_1051_1926 | 291 |
| 231 | 3300035085 | Ga0373929_0002170 | Ga0373929_0002170_548_1423 | 291 |
| 232 | 3300035086 | Ga0373934_0087802 | Ga0373934_0087802_278_1153 | 291 |
| 233 | 3300035088 | Ga0373940_0006580 | Ga0373940_0006580_1042_1917 | 291 |
| 234 | 3300035090 | Ga0373949_0003502 | Ga0373949_0003502_2179_3054 | 291 |
| 235 | 3300035092 | Ga0373952_0002110 | Ga0373952_0002110_1765_2640 | 291 |
| 236 | 3300035112 | Ga0373932_0000672 | Ga0373932_0000672_4364_5239 | 291 |
| 237 | 3300035114 | Ga0373939_0003558 | Ga0373939_0003558_28_903 | 291 |
| 238 | 3300035119 | Ga0373956_0103557 | Ga0373956_0103557_350_1225 | 291 |
| 239 | 3300035121 | Ga0373960_0004430 | Ga0373960_0004430_1551_2426 | 291 |
| 240 | 3300035242 | Ga0373962_0053379 | Ga0373962_0053379_197_1072 | 291 |
| 241 | 3300035691 | Ga0373931_0002139 | Ga0373931_0002139_6105_6980 | 291 |
| 242 | 3300035691 | Ga0373931_0041443 | Ga0373931_0041443_712_1587 | 291 |
| 243 | 3300035692 | Ga0373935_0030680 | Ga0373935_0030680_1928_2803 | 291 |
| 244 | 3300035725 | Ga0373947_0152033 | Ga0373947_0152033_549_1424 | 291 |
| 245 | 3300036401 | Ga0373937_0094584 | Ga0373937_0094584_1661_2536 | 291 |
| 246 | 3300036401 | Ga0373937_0095523 | Ga0373937_0095523_696_1571 | 291 |
| 247 | 3300037853 | Ga0436364_0405699 | Ga0436364_0405699_289_1164 | 291 |
| 248 | 3300039450 | Ga0436363_0894936 | Ga0436363_0894936_6972_7847 | 291 |
| 249 | 3300046472 | Ga0495580_0190943 | Ga0495580_0190943_222_1115 | 291 |
| 250 | 3300046529 | Ga0495652_0137443 | Ga0495652_0137443_891_1766 | 291 |
| 251 | 3300048907 | Ga0496104_0043685 | Ga0496104_0043685_1369_2244 | 291 |
| 252 | 3300048910 | Ga0496107_0142776 | Ga0496107_0142776_635_1510 | 291 |
| 253 | 3300048911 | Ga0496108_0002194 | Ga0496108_0002194_2974_3849 | 291 |
| 254 | 3300048914 | Ga0496111_0091833 | Ga0496111_0091833_467_1342 | 291 |
| 255 | 3300048915 | Ga0496112_0003322 | Ga0496112_0003322_732_1607 | 291 |
| 256 | 3300048915 | Ga0496112_0421288 | Ga0496112_0421288_165_1040 | 291 |
| 257 | 3300048916 | Ga0496113_0085349 | Ga0496113_0085349_1248_2123 | 291 |
| 258 | 3300049581 | Ga0501047_0072732 | Ga0501047_0072732_1120_2004 | 291 |
| 259 | 3300049585 | Ga0501069_0139535 | Ga0501069_0139535_129_1013 | 291 |
| 260 | 3300049586 | Ga0501070_0063685 | Ga0501070_0063685_1423_2307 | 291 |
| 261 | 3300049586 | Ga0501070_0202860 | Ga0501070_0202860_86_970 | 291 |
| 262 | 3300049589 | Ga0501073_0095360 | Ga0501073_0095360_864_1739 | 291 |
| 263 | 3300049589 | Ga0501073_0236705 | Ga0501073_0236705_46_930 | 291 |
| 264 | 3300049742 | Ga0501080_0013019 | Ga0501080_0013019_4428_5312 | 291 |
| 265 | 3300050507 | nmdc:mga05p37_113107_c1 | nmdc:mga05p37_113107_c1_565_1443 | 291 |
| 266 | 3300050507 | nmdc:mga05p37_4667_c1 | nmdc:mga05p37_4667_c1_2080_2955 | 291 |
| 267 | 3300050512 | nmdc:mga0n895_112855_c1 | nmdc:mga0n895_112855_c1_1389_2264 | 291 |
| 268 | 3300050512 | nmdc:mga0n895_11_c1 | nmdc:mga0n895_11_c1_19784_20659 | 291 |
| 269 | 3300050513 | nmdc:mga0rr50_1831_c1 | nmdc:mga0rr50_1831_c1_1980_2855 | 291 |
| 270 | 3300050513 | nmdc:mga0rr50_19_c1 | nmdc:mga0rr50_19_c1_31990_32865 | 291 |
| 271 | 3300050514 | nmdc:mga08x19_1370_c1 | nmdc:mga08x19_1370_c1_11578_12453 | 291 |
| 272 | 3300050514 | nmdc:mga08x19_156291_c1 | nmdc:mga08x19_156291_c1_440_1315 | 291 |
| 273 | 3300050514 | nmdc:mga08x19_97488_c1 | nmdc:mga08x19_97488_c1_742_1617 | 291 |
| 274 | 3300007076 | Ga0075435_100004978 | Ga0075435_1000049788 | 292 |
| 275 | 3300005335 | Ga0070666_10208466 | Ga0070666_102084662 | 293 |
| 276 | 3300005842 | Ga0068858_100057426 | Ga0068858_1000574264 | 293 |
| 277 | 3300005843 | Ga0068860_100025023 | Ga0068860_1000250234 | 293 |
| 278 | 3300005937 | Ga0081455_10342925 | Ga0081455_103429251 | 293 |
| 279 | 3300009177 | Ga0105248_10036561 | Ga0105248_100365613 | 293 |
| 280 | 3300013297 | Ga0157378_10407454 | Ga0157378_104074542 | 293 |
| 281 | 3300014326 | Ga0157380_10520041 | Ga0157380_105200412 | 293 |
| 282 | 3300014968 | Ga0157379_10010079 | Ga0157379_1001007910 | 293 |
| 283 | 3300025931 | Ga0207644_10027600 | Ga0207644_100276004 | 293 |
| 284 | 3300025940 | Ga0207691_10137602 | Ga0207691_101376022 | 293 |
| 285 | 3300025941 | Ga0207711_10022028 | Ga0207711_100220282 | 293 |
| 286 | 3300025986 | Ga0207658_10030857 | Ga0207658_100308572 | 293 |
| 287 | 3300026035 | Ga0207703_10027233 | Ga0207703_100272334 | 293 |
| 288 | 3300028381 | Ga0268264_10020538 | Ga0268264_100205384 | 293 |
| 289 | 3300046681 | Ga0495647_0091936 | Ga0495647_0091936_132_1013 | 293 |
| 290 | 3300005367 | Ga0070667_100016949 | Ga0070667_1000169493 | 294 |
| 291 | 3300005436 | Ga0070713_100619813 | Ga0070713_1006198131 | 294 |
| 292 | 3300005471 | Ga0070698_100363025 | Ga0070698_1003630252 | 294 |
| 293 | 3300005841 | Ga0068863_100001403 | Ga0068863_10000140326 | 294 |
| 294 | 3300005841 | Ga0068863_100394653 | Ga0068863_1003946532 | 294 |
| 295 | 3300005842 | Ga0068858_100361214 | Ga0068858_1003612142 | 294 |
| 296 | 3300005844 | Ga0068862_100013820 | Ga0068862_1000138201 | 294 |
| 297 | 3300006847 | Ga0075431_100130157 | Ga0075431_1001301572 | 294 |
| 298 | 3300006871 | Ga0075434_100012244 | Ga0075434_10001224410 | 294 |
| 299 | 3300009094 | Ga0111539_10068760 | Ga0111539_100687604 | 294 |
| 300 | 3300009094 | Ga0111539_10220803 | Ga0111539_102208032 | 294 |
| 301 | 3300009094 | Ga0111539_10649254 | Ga0111539_106492542 | 294 |
| 302 | 3300009147 | Ga0114129_10008522 | Ga0114129_100085223 | 294 |
| 303 | 3300013297 | Ga0157378_10263824 | Ga0157378_102638241 | 294 |
| 304 | 3300025901 | Ga0207688_10152213 | Ga0207688_101522131 | 294 |
| 305 | 3300025910 | Ga0207684_10127359 | Ga0207684_101273593 | 294 |
| 306 | 3300025924 | Ga0207694_10039783 | Ga0207694_100397833 | 294 |
| 307 | 3300025960 | Ga0207651_10017850 | Ga0207651_100178501 | 294 |
| 308 | 3300025972 | Ga0207668_10094877 | Ga0207668_100948773 | 294 |
| 309 | 3300026088 | Ga0207641_10000722 | Ga0207641_1000072227 | 294 |
| 310 | 3300026089 | Ga0207648_10435143 | Ga0207648_104351431 | 294 |
| 311 | 3300028380 | Ga0268265_10024854 | Ga0268265_100248547 | 294 |
| 312 | 3300046472 | Ga0495580_0008181 | Ga0495580_0008181_3155_4039 | 294 |
| 313 | 3300050507 | nmdc:mga05p37_95048_c1 | nmdc:mga05p37_95048_c1_540_1427 | 294 |
| 314 | 3300050510 | nmdc:mga06r32_195888_c1 | nmdc:mga06r32_195888_c1_448_1335 | 294 |
| 315 | 3300050512 | nmdc:mga0n895_65864_c1 | nmdc:mga0n895_65864_c1_861_1745 | 294 |
| 316 | 3300050515 | nmdc:mga0a205_1769_c1 | nmdc:mga0a205_1769_c1_3807_4691 | 294 |
| 317 | 3300014968 | Ga0157379_10006889 | Ga0157379_100068892 | 295 |
| 318 | 3300025941 | Ga0207711_10258598 | Ga0207711_102585982 | 295 |
| 319 | 3300027907 | Ga0207428_10039514 | Ga0207428_100395143 | 295 |
| 320 | 3300009177 | Ga0105248_10148934 | Ga0105248_101489341 | 296 |
| 321 | 3300026041 | Ga0207639_10524686 | Ga0207639_105246861 | 296 |
| 322 | 3300005290 | Ga0065712_10120017 | Ga0065712_101200171 | 299 |
| 323 | 3300005354 | Ga0070675_100215689 | Ga0070675_1002156892 | 299 |
| 324 | 3300005530 | Ga0070679_100161166 | Ga0070679_1001611662 | 299 |
| 325 | 3300005578 | Ga0068854_100224214 | Ga0068854_1002242142 | 299 |
| 326 | 3300013308 | Ga0157375_10106042 | Ga0157375_101060423 | 299 |
| 327 | 3300014969 | Ga0157376_10105764 | Ga0157376_101057643 | 299 |
| 328 | 3300025926 | Ga0207659_10239254 | Ga0207659_102392542 | 299 |
| 329 | 3300025938 | Ga0207704_10137185 | Ga0207704_101371852 | 299 |
| 330 | 3300025960 | Ga0207651_10301355 | Ga0207651_103013552 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yw0-assembly1.cif.gz_A | crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with succinate and fe(iii) | 0.9866 | 12 | 298 |
| 5yvz-assembly1.cif.gz_A | crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate and fe(iii) | 0.9846 | 11 | 299 |
| 5yka-assembly1.cif.gz_A | crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with cobalt(ii) | 0.9828 | 12 | 298 |
| 6a2e-assembly1.cif.gz_A | apo structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase | 0.9825 | 11 | 298 |
| 5yvz-assembly1.cif.gz_A | crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate and fe(iii) | 0.9549 | 11 | 299 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hvqA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7149 | 123 | 270 | 2.60.120.10 |
| 1yfuA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.6374 | 118 | 270 | 2.60.120.10 |
| af_P64488_1_119_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.6011 | 118 | 275 | 2.60.120.10 |
| 3gbfA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.5913 | 116 | 275 | 2.60.120.10 |
| 3ouiA00 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.5864 | 94 | 275 | 2.60.120.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y8PEJ3-F1-model_v4 | 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase | 0.9884 | 12 | 298 |
|
| AF-G2JAV8-F1-model_v4 | 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase | 0.988 | 161 | 299 |
|
| AF-A0A1G0FYV3-F1-model_v4 | 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase | 0.9878 | 9 | 299 |
|
| AF-A0A2V8CGM8-F1-model_v4 | 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase | 0.9876 | 10 | 299 |
|
| AF-A0A843SS47-F1-model_v4 | 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase | 0.9871 | 9 | 299 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar