F410093

General Info

Members Datasets Scaffolds Average Seq Length
330 189 328 289

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10006889|Ga0157379_100068892
Length 330
Sequence MLEIVADFKTARVRFRTERAVRLRLKPTRRIHGRPHDIIRALVSQITTVGGAAWDAPDASPGLMPALEGGDVLFLPALAFDVAPSELRLFSPDLVGAAKNVSFDPRSGRLGGTSLDGADRACLRDLLARFSVSASALVGRVLPAYRDRFELGRTSFRPVEIAGRASSWRKDDTRLHVDSFPATPVRGKRILRVFSNVNPDARPRTWRLGEDFESVARRFGGLIRVPLPGSALFLRLLRVTKSRRSPFDALMLQLHDRMKADADYQTQTPQLRVDFPAGSTWIAFTDQVSHAAMAGQYQLEQTFLVPLSAMLDEQRSPLRVLERLIGRPLV

Samples

Sample ID Description Type Environment
1 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
2 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
112 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
113 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.55
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10120017 3300005290 Bacteria 1684
2 Ga0070676_10206629 3300005328 Bacteria 1290
3 Ga0070683_100077116 3300005329 Bacteria 3116
4 Ga0070690_100032101 3300005330 Bacteria 3277
5 Ga0070670_100405385 3300005331 Bacteria 1204
6 Ga0070666_10013407 3300005335 Bacteria 5200
7 Ga0070666_10208466 3300005335 Bacteria 1376
8 Ga0068868_100029223 3300005338 Bacteria 4221
9 Ga0068868_100098080 3300005338 Bacteria 2369
10 Ga0070660_100084685 3300005339 Bacteria 2492
11 Ga0070661_100073418 3300005344 Bacteria 2519
12 Ga0070675_100003651 3300005354 Bacteria 11706
13 Ga0070675_100215689 3300005354 Bacteria 1670
14 Ga0070675_100547403 3300005354 Bacteria 1046
15 Ga0070674_100363759 3300005356 Bacteria 1172
16 Ga0070667_100016949 3300005367 Bacteria 6030
17 Ga0070714_100008199 3300005435 Bacteria 8143
18 Ga0070713_100019508 3300005436 Bacteria 5180
19 Ga0070713_100619813 3300005436 Bacteria 1029
20 Ga0070710_10033183 3300005437 Bacteria 2802
21 Ga0070710_10121602 3300005437 Unclassified 1581
22 Ga0070705_100014828 3300005440 Bacteria 4019
23 Ga0070705_100098606 3300005440 Unclassified 1839
24 Ga0070708_100108315 3300005445 Bacteria 2552
25 Ga0068867_100127480 3300005459 Bacteria 1974
26 Ga0070698_100119444 3300005471 Bacteria 2597
27 Ga0070698_100363025 3300005471 Unclassified 1380
28 Ga0070679_100161166 3300005530 Bacteria 2217
29 Ga0068853_100074611 3300005539 Bacteria 2959
30 Ga0070686_100196144 3300005544 Unclassified 1444
31 Ga0070695_100013253 3300005545 Bacteria 4952
32 Ga0070665_100005072 3300005548 Bacteria 13665
33 Ga0070665_100091352 3300005548 Bacteria 3050
34 Ga0070704_100002954 3300005549 Bacteria 9667
35 Ga0070664_100106339 3300005564 Bacteria 2444
36 Ga0068854_100005386 3300005578 Bacteria 8076
37 Ga0068854_100224214 3300005578 Bacteria 1489
38 Ga0068859_100022461 3300005617 Bacteria 6326
39 Ga0068864_100008953 3300005618 Bacteria 8252
40 Ga0068863_100001403 3300005841 Bacteria 23884
41 Ga0068863_100394653 3300005841 Bacteria 1352
42 Ga0068858_100003488 3300005842 Bacteria 15596
43 Ga0068858_100007706 3300005842 Bacteria 10392
44 Ga0068858_100049964 3300005842 Bacteria 3872
45 Ga0068858_100057426 3300005842 Bacteria 3597
46 Ga0068858_100361214 3300005842 Bacteria 1392
47 Ga0068860_100025023 3300005843 Bacteria 5762
48 Ga0068860_100102901 3300005843 Bacteria 2726
49 Ga0068860_100169756 3300005843 Unclassified 2107
50 Ga0068860_100227363 3300005843 Bacteria 1813
51 Ga0068862_100013820 3300005844 Bacteria 6691
52 Ga0081455_10342925 3300005937 Bacteria 1056
53 Ga0070716_100075836 3300006173 Unclassified 1991
54 Ga0070716_100209850 3300006173 Unclassified 1301
55 Ga0097621_100000385 3300006237 Bacteria 30766
56 Ga0097621_100021983 3300006237 Bacteria 4944
57 Ga0097621_100057602 3300006237 Bacteria 3178
58 Ga0097621_100098204 3300006237 Bacteria 2460
59 Ga0097621_100113425 3300006237 Bacteria 2293
60 Ga0097621_100139462 3300006237 Bacteria 2071
61 Ga0068871_100000835 3300006358 Bacteria 20626
62 Ga0068871_100033405 3300006358 Bacteria 4074
63 Ga0068871_100043347 3300006358 Bacteria 3614
64 Ga0075428_100004272 3300006844 Bacteria 15725
65 Ga0075431_100130157 3300006847 Bacteria 2596
66 Ga0075431_100207797 3300006847 Unclassified 2001
67 Ga0075433_10051746 3300006852 Bacteria 3578
68 Ga0075434_100000633 3300006871 Bacteria 27175
69 Ga0075434_100012244 3300006871 Bacteria 8128
70 Ga0075434_100019776 3300006871 Bacteria 6519
71 Ga0075434_100021400 3300006871 Bacteria 6284
72 Ga0075434_100073836 3300006871 Bacteria 3404
73 Ga0075429_100014777 3300006880 Bacteria 6766
74 Ga0075429_100198459 3300006880 Unclassified 1758
75 Ga0068865_100048233 3300006881 Bacteria 2930
76 Ga0075436_100001697 3300006914 Bacteria 15078
77 Ga0075436_100003168 3300006914 Bacteria 11285
78 Ga0097620_100022461 3300006931 Bacteria 6326
79 Ga0075435_100000285 3300007076 Bacteria 31543
80 Ga0075435_100004978 3300007076 Bacteria 9222
81 Ga0075435_100008435 3300007076 Bacteria 7392
82 Ga0075435_100110762 3300007076 Unclassified 2283
83 Ga0075435_100527106 3300007076 Unclassified 1022
84 Ga0105251_10000571 3300009011 Bacteria 34449
85 Ga0105250_10001563 3300009092 Bacteria 12305
86 Ga0105240_10029923 3300009093 Bacteria 7085
87 Ga0105240_10033900 3300009093 Bacteria 6592
88 Ga0105240_10081619 3300009093 Bacteria 3973
89 Ga0105240_10246290 3300009093 Bacteria 2069
90 Ga0105240_10517767 3300009093 Bacteria 1324
91 Ga0111539_10007387 3300009094 Bacteria 14076
92 Ga0111539_10030361 3300009094 Bacteria 6570
93 Ga0111539_10056277 3300009094 Unclassified 4674
94 Ga0111539_10068760 3300009094 Bacteria 4182
95 Ga0111539_10171939 3300009094 Bacteria 2531
96 Ga0111539_10220803 3300009094 Bacteria 2207
97 Ga0111539_10649254 3300009094 Bacteria 1229
98 Ga0105245_10014576 3300009098 Bacteria 6845
99 Ga0105245_10020995 3300009098 Bacteria 5727
100 Ga0105247_10021797 3300009101 Bacteria 3854
101 Ga0114129_10002032 3300009147 Bacteria 27742
102 Ga0114129_10005371 3300009147 Bacteria 18085
103 Ga0114129_10008522 3300009147 Bacteria 14615
104 Ga0114129_10087029 3300009147 Unclassified 4333
105 Ga0105241_10053120 3300009174 Bacteria 3097
106 Ga0105242_10022146 3300009176 Bacteria 4993
107 Ga0105242_10107164 3300009176 Bacteria 2376
108 Ga0105248_10036561 3300009177 Bacteria 5493
109 Ga0105248_10042788 3300009177 Bacteria 5079
110 Ga0105248_10110704 3300009177 Bacteria 3097
111 Ga0105248_10134805 3300009177 Bacteria 2786
112 Ga0105248_10148934 3300009177 Bacteria 2640
113 Ga0105248_10312011 3300009177 Bacteria 1771
114 Ga0105248_10424805 3300009177 Bacteria 1497
115 Ga0105237_10061179 3300009545 Bacteria 3766
116 Ga0105238_10020723 3300009551 Bacteria 6696
117 Ga0105238_10495861 3300009551 Bacteria 1221
118 Ga0105238_10560552 3300009551 Bacteria 1147
119 Ga0157374_10081555 3300013296 Bacteria 3070
120 Ga0157378_10263824 3300013297 Unclassified 1654
121 Ga0157378_10407454 3300013297 Bacteria 1341
122 Ga0157378_10431944 3300013297 Unclassified 1304
123 Ga0163162_10180334 3300013306 Bacteria 2238
124 Ga0157375_10106042 3300013308 Bacteria 2901
125 Ga0157375_10268848 3300013308 Bacteria 1867
126 Ga0163163_10001113 3300014325 Bacteria 22847
127 Ga0163163_10051217 3300014325 Bacteria 4071
128 Ga0163163_10113432 3300014325 Unclassified 2741
129 Ga0163163_10290864 3300014325 Bacteria 1686
130 Ga0157380_10077667 3300014326 Bacteria 2706
131 Ga0157380_10520041 3300014326 Bacteria 1160
132 Ga0157377_10040240 3300014745 Bacteria 2587
133 Ga0157379_10006889 3300014968 Bacteria 9827
134 Ga0157379_10010079 3300014968 Bacteria 8238
135 Ga0157379_10021615 3300014968 Bacteria 5698
136 Ga0157379_10057716 3300014968 Bacteria 3469
137 Ga0157376_10049877 3300014969 Bacteria 3469
138 Ga0157376_10105764 3300014969 Bacteria 2468
139 Ga0157376_10119441 3300014969 Bacteria 2334
140 Ga0157376_10254615 3300014969 Bacteria 1641
141 Ga0157376_10279156 3300014969 Bacteria 1573
142 Ga0209256_1016029 3300025299 Unclassified 2580
143 Ga0207696_1000460 3300025711 Bacteria 35536
144 Ga0207713_1000061 3300025735 Bacteria 209289
145 Ga0207692_10144602 3300025898 Unclassified 1356
146 Ga0207688_10152213 3300025901 Bacteria 1367
147 Ga0207680_10015719 3300025903 Bacteria 3957
148 Ga0207684_10127359 3300025910 Bacteria 2185
149 Ga0207695_10079377 3300025913 Bacteria 3326
150 Ga0207695_10084535 3300025913 Bacteria 3204
151 Ga0207695_10097103 3300025913 Bacteria 2947
152 Ga0207695_10336833 3300025913 Bacteria 1397
153 Ga0207671_10032551 3300025914 Bacteria 3880
154 Ga0207660_10364976 3300025917 Bacteria 1159
155 Ga0207652_10151631 3300025921 Bacteria 2076
156 Ga0207694_10039783 3300025924 Bacteria 3619
157 Ga0207694_10373929 3300025924 Bacteria 1182
158 Ga0207650_10009438 3300025925 Bacteria 6668
159 Ga0207659_10001563 3300025926 Bacteria 13586
160 Ga0207659_10188388 3300025926 Bacteria 1640
161 Ga0207659_10239254 3300025926 Bacteria 1468
162 Ga0207687_10036613 3300025927 Bacteria 3343
163 Ga0207687_10060788 3300025927 Bacteria 2666
164 Ga0207644_10027600 3300025931 Bacteria 3923
165 Ga0207690_10235617 3300025932 Bacteria 1407
166 Ga0207670_10084702 3300025936 Unclassified 2226
167 Ga0207704_10137185 3300025938 Bacteria 1705
168 Ga0207665_10049235 3300025939 Bacteria 2830
169 Ga0207691_10122288 3300025940 Bacteria 2305
170 Ga0207691_10137602 3300025940 Bacteria 2153
171 Ga0207691_10189895 3300025940 Bacteria 1792
172 Ga0207711_10013243 3300025941 Bacteria 6853
173 Ga0207711_10022028 3300025941 Bacteria 5325
174 Ga0207711_10197247 3300025941 Bacteria 1836
175 Ga0207711_10240509 3300025941 Bacteria 1660
176 Ga0207711_10258598 3300025941 Unclassified 1600
177 Ga0207711_10343832 3300025941 Bacteria 1381
178 Ga0207661_10187164 3300025944 Bacteria 1813
179 Ga0207661_10677331 3300025944 Bacteria 948
180 Ga0207679_10141856 3300025945 Bacteria 1943
181 Ga0207679_10495891 3300025945 Bacteria 1089
182 Ga0207651_10017850 3300025960 Unclassified 4205
183 Ga0207651_10301355 3300025960 Bacteria 1333
184 Ga0207668_10094877 3300025972 Bacteria 2201
185 Ga0207640_10101997 3300025981 Bacteria 2015
186 Ga0207640_10264347 3300025981 Bacteria 1342
187 Ga0207658_10030857 3300025986 Bacteria 3800
188 Ga0207677_10041065 3300026023 Bacteria 3055
189 Ga0207677_10066158 3300026023 Bacteria 2526
190 Ga0207703_10027233 3300026035 Bacteria 4501
191 Ga0207703_10029699 3300026035 Bacteria 4315
192 Ga0207703_10085657 3300026035 Bacteria 2638
193 Ga0207703_10200956 3300026035 Bacteria 1771
194 Ga0207639_10020788 3300026041 Bacteria 4705
195 Ga0207639_10023244 3300026041 Bacteria 4475
196 Ga0207639_10524686 3300026041 Bacteria 1085
197 Ga0207641_10000722 3300026088 Bacteria 35493
198 Ga0207641_10332961 3300026088 Bacteria 1443
199 Ga0207648_10051027 3300026089 Bacteria 3616
200 Ga0207648_10239927 3300026089 Bacteria 1614
201 Ga0207648_10435143 3300026089 Unclassified 1192
202 Ga0207676_10020126 3300026095 Bacteria 4878
203 Ga0207676_10078882 3300026095 Unclassified 2668
204 Ga0207683_10047226 3300026121 Bacteria 3770
205 Ga0207428_10011564 3300027907 Bacteria 7794
206 Ga0207428_10016228 3300027907 Bacteria 6413
207 Ga0207428_10039514 3300027907 Bacteria 3831
208 Ga0268266_10026665 3300028379 Bacteria 4916
209 Ga0268266_10117997 3300028379 Bacteria 2358
210 Ga0268265_10024854 3300028380 Unclassified 4244
211 Ga0268264_10020538 3300028381 Bacteria 5397
212 Ga0268264_10108277 3300028381 Bacteria 2429
213 Ga0265325_10124913 3300031241 Bacteria 1237
214 Ga0307416_100131123 3300032002 Bacteria 2256
215 Ga0373958_0000815 3300034819 Bacteria 3989
216 Ga0373928_0009111 3300035084 Bacteria 1937
217 Ga0373929_0002170 3300035085 Unclassified 3638
218 Ga0373934_0087802 3300035086 Bacteria 1252
219 Ga0373940_0006580 3300035088 Bacteria 2584
220 Ga0373949_0003502 3300035090 Bacteria 3720
221 Ga0373952_0002110 3300035092 Bacteria 3578
222 Ga0373932_0000672 3300035112 Bacteria 10375
223 Ga0373936_0181489 3300035113 Unclassified 924
224 Ga0373939_0003558 3300035114 Bacteria 3656
225 Ga0373954_0180648 3300035118 Bacteria 1035
226 Ga0373956_0103557 3300035119 Unclassified 1322
227 Ga0373960_0004430 3300035121 Bacteria 3217
228 Ga0373943_0008594 3300035170 Unclassified 4578
229 Ga0373946_0124981 3300035171 Unclassified 1178
230 Ga0373955_0030041 3300035172 Bacteria 2833
231 Ga0373962_0053379 3300035242 Bacteria 1169
232 Ga0373924_0021967 3300035410 Unclassified 2491
233 Ga0373931_0002139 3300035691 Bacteria 8705
234 Ga0373931_0041443 3300035691 Bacteria 2419
235 Ga0373935_0030680 3300035692 Bacteria 3333
236 Ga0373935_0304645 3300035692 Bacteria 1127
237 Ga0373947_0014521 3300035725 Bacteria 4520
238 Ga0373947_0043902 3300035725 Unclassified 2671
239 Ga0373947_0152033 3300035725 Bacteria 1491
240 Ga0373937_0094584 3300036401 Bacteria 2771
241 Ga0373937_0095523 3300036401 Bacteria 2756
242 Ga0373937_0181756 3300036401 Unclassified 1975
243 Ga0373937_0582330 3300036401 Bacteria 1063
244 Ga0373925_0035706 3300037068 Unclassified 3669
245 Ga0395899_0000013 3300037312 Bacteria 510397
246 Ga0436364_0405699 3300037853 Archaea 1500
247 Ga0436363_0614991 3300039450 Bacteria 2540
248 Ga0436363_0894936 3300039450 Bacteria 7892
249 Ga0451853_1317456 3300041512 Unclassified 877
250 Ga0466966_0112643 3300044684 Bacteria 1676
251 Ga0495629_0355212 3300046459 Unclassified 999
252 Ga0495651_0076640 3300046462 Bacteria 2533
253 Ga0495580_0008181 3300046472 Bacteria 8325
254 Ga0495580_0190943 3300046472 Bacteria 1413
255 Ga0495608_0016263 3300046511 Bacteria 5145
256 Ga0495628_0033269 3300046516 Bacteria 4156
257 Ga0495630_0005352 3300046517 Bacteria 9053
258 Ga0495652_0137443 3300046529 Bacteria 1926
259 Ga0495652_0259037 3300046529 Bacteria 1285
260 Ga0495652_0343199 3300046529 Bacteria 1072
261 Ga0495586_0171296 3300046535 Bacteria 1227
262 Ga0495667_0034587 3300046559 Bacteria 3378
263 Ga0495599_0130627 3300046678 Bacteria 1560
264 Ga0495647_0091936 3300046681 Bacteria 1245
265 Ga0495669_0003009 3300046684 Bacteria 6926
266 Ga0495613_0000620 3300046689 Bacteria 28244
267 Ga0495613_0002710 3300046689 Bacteria 13296
268 Ga0495674_0042947 3300047319 Bacteria 4028
269 Ga0495684_0006698 3300047471 Bacteria 8939
270 Ga0496100_0361040 3300048903 Bacteria 1099
271 Ga0496101_0024713 3300048904 Bacteria 4161
272 Ga0496102_0085625 3300048905 Bacteria 2910
273 Ga0496102_0334131 3300048905 Bacteria 1427
274 Ga0496104_0043685 3300048907 Bacteria 4209
275 Ga0496107_0142776 3300048910 Bacteria 1770
276 Ga0496108_0002194 3300048911 Bacteria 15633
277 Ga0496111_0091833 3300048914 Unclassified 2225
278 Ga0496112_0003322 3300048915 Bacteria 13273
279 Ga0496112_0097296 3300048915 Bacteria 2914
280 Ga0496112_0421288 3300048915 Bacteria 1274
281 Ga0496113_0085349 3300048916 Unclassified 2425
282 Ga0496114_0001268 3300048917 Bacteria 19064
283 Ga0496114_0308549 3300048917 Bacteria 1397
284 Ga0496115_0082984 3300048918 Bacteria 2612
285 Ga0496117_0079219 3300048920 Bacteria 2166
286 Ga0501033_0203116 3300049570 Bacteria 1415
287 Ga0501034_0022355 3300049571 Bacteria 6445
288 Ga0501047_0050845 3300049581 Bacteria 4002
289 Ga0501047_0072732 3300049581 Bacteria 3309
290 Ga0501069_0139535 3300049585 Bacteria 1390
291 Ga0501070_0063685 3300049586 Bacteria 3054
292 Ga0501070_0202860 3300049586 Unclassified 1628
293 Ga0501070_0293240 3300049586 Bacteria 1326
294 Ga0501071_0210117 3300049587 Bacteria 1463
295 Ga0501073_0095360 3300049589 Bacteria 2066
296 Ga0501073_0236705 3300049589 Unclassified 1261
297 Ga0501074_0097943 3300049590 Bacteria 2099
298 Ga0501075_0084377 3300049591 Bacteria 2406
299 Ga0501077_0137777 3300049593 Bacteria 1547
300 Ga0501080_0013019 3300049742 Bacteria 7638
301 Ga0501080_0106495 3300049742 Bacteria 2598
302 Ga0501080_0298925 3300049742 Bacteria 1460
303 Ga0501044_0044631 3300049823 Bacteria 4599
304 nmdc:mga05p37_113107_c1 3300050507 Bacteria 3338
305 nmdc:mga05p37_14078_c1 3300050507 Bacteria 9599
306 nmdc:mga05p37_4667_c1 3300050507 Bacteria 16014
307 nmdc:mga05p37_64023_c1 3300050507 Unclassified 4524
308 nmdc:mga05p37_95048_c1 3300050507 Bacteria 3672
309 nmdc:mga09592_105806_c1 3300050508 Bacteria 2413
310 nmdc:mga06r32_195888_c1 3300050510 Bacteria 2008
311 nmdc:mga08y16_15263_c1 3300050511 Bacteria 8081
312 nmdc:mga08y16_44068_c1 3300050511 Unclassified 4674
313 nmdc:mga0n895_112855_c1 3300050512 Bacteria 2735
314 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
315 nmdc:mga0n895_65864_c1 3300050512 Bacteria 3587
316 nmdc:mga0n895_8923_c1 3300050512 Bacteria 8737
317 nmdc:mga0rr50_1831_c1 3300050513 Bacteria 11765
318 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
319 nmdc:mga08x19_1370_c1 3300050514 Bacteria 15085
320 nmdc:mga08x19_156291_c1 3300050514 Bacteria 1547
321 nmdc:mga08x19_97488_c1 3300050514 Bacteria 1947
322 nmdc:mga0a205_1769_c1 3300050515 Bacteria 6946
323 nmdc:mga0a205_201471_c1 3300050515 Bacteria 1881
324 nmdc:mga0a205_55025_c1 3300050515 Bacteria 3843
325 Ga0495601_0006744 3300053077 Bacteria 6724
326 Ga0495595_0066983 3300053084 Bacteria 1692
327 Ga0495619_0002028 3300053085 Bacteria 13458
328 Ga0530510_0188862 3300061734 Bacteria 1529

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0079219 Ga0496117_0079219_1329_2111 259
2 3300005435 Ga0070714_100008199 Ga0070714_1000081996 265
3 3300005548 Ga0070665_100091352 Ga0070665_1000913523 265
4 3300005843 Ga0068860_100102901 Ga0068860_1001029013 265
5 3300006237 Ga0097621_100139462 Ga0097621_1001394623 265
6 3300009093 Ga0105240_10246290 Ga0105240_102462902 265
7 3300014325 Ga0163163_10290864 Ga0163163_102908643 265
8 3300025926 Ga0207659_10188388 Ga0207659_101883882 265
9 3300025944 Ga0207661_10187164 Ga0207661_101871642 265
10 3300028381 Ga0268264_10108277 Ga0268264_101082771 265
11 3300049593 Ga0501077_0137777 Ga0501077_0137777_709_1506 265
12 3300009093 Ga0105240_10033900 Ga0105240_100339002 266
13 3300025913 Ga0207695_10084535 Ga0207695_100845353 266
14 3300032002 Ga0307416_100131123 Ga0307416_1001311231 266
15 3300014326 Ga0157380_10077667 Ga0157380_100776672 271
16 3300041512 Ga0451853_1317456 Ga0451853_1317456_47_862 271
17 3300006852 Ga0075433_10051746 Ga0075433_100517462 274
18 3300006871 Ga0075434_100019776 Ga0075434_1000197765 274
19 3300050512 nmdc:mga0n895_8923_c1 nmdc:mga0n895_8923_c1_7277_8155 274
20 3300050515 nmdc:mga0a205_55025_c1 nmdc:mga0a205_55025_c1_2088_2966 274
21 3300005471 Ga0070698_100119444 Ga0070698_1001194441 279
22 3300009094 Ga0111539_10056277 Ga0111539_100562772 279
23 3300050511 nmdc:mga08y16_44068_c1 nmdc:mga08y16_44068_c1_3299_4144 279
24 3300006847 Ga0075431_100207797 Ga0075431_1002077972 280
25 3300046529 Ga0495652_0259037 Ga0495652_0259037_38_928 280
26 3300046689 Ga0495613_0002710 Ga0495613_0002710_251_1141 280
27 3300005329 Ga0070683_100077116 Ga0070683_1000771163 281
28 3300005338 Ga0068868_100029223 Ga0068868_1000292233 281
29 3300005459 Ga0068867_100127480 Ga0068867_1001274801 281
30 3300005544 Ga0070686_100196144 Ga0070686_1001961442 281
31 3300005843 Ga0068860_100227363 Ga0068860_1002273631 281
32 3300006237 Ga0097621_100000385 Ga0097621_10000038536 281
33 3300006237 Ga0097621_100021983 Ga0097621_1000219833 281
34 3300006237 Ga0097621_100057602 Ga0097621_1000576023 281
35 3300006358 Ga0068871_100000835 Ga0068871_1000008355 281
36 3300006358 Ga0068871_100033405 Ga0068871_1000334053 281
37 3300006881 Ga0068865_100048233 Ga0068865_1000482335 281
38 3300009094 Ga0111539_10030361 Ga0111539_100303614 281
39 3300009098 Ga0105245_10020995 Ga0105245_100209953 281
40 3300009177 Ga0105248_10134805 Ga0105248_101348052 281
41 3300009177 Ga0105248_10424805 Ga0105248_104248052 281
42 3300013296 Ga0157374_10081555 Ga0157374_100815553 281
43 3300014969 Ga0157376_10049877 Ga0157376_100498772 281
44 3300014969 Ga0157376_10254615 Ga0157376_102546152 281
45 3300025927 Ga0207687_10060788 Ga0207687_100607882 281
46 3300025940 Ga0207691_10122288 Ga0207691_101222883 281
47 3300025941 Ga0207711_10343832 Ga0207711_103438321 281
48 3300025944 Ga0207661_10677331 Ga0207661_106773311 281
49 3300026023 Ga0207677_10041065 Ga0207677_100410653 281
50 3300026035 Ga0207703_10085657 Ga0207703_100856572 281
51 3300026089 Ga0207648_10051027 Ga0207648_100510273 281
52 3300026121 Ga0207683_10047226 Ga0207683_100472263 281
53 3300027907 Ga0207428_10016228 Ga0207428_100162284 281
54 3300035113 Ga0373936_0181489 Ga0373936_0181489_32_880 281
55 3300035118 Ga0373954_0180648 Ga0373954_0180648_128_973 281
56 3300035170 Ga0373943_0008594 Ga0373943_0008594_1387_2235 281
57 3300035171 Ga0373946_0124981 Ga0373946_0124981_35_886 281
58 3300035172 Ga0373955_0030041 Ga0373955_0030041_693_1544 281
59 3300035410 Ga0373924_0021967 Ga0373924_0021967_645_1493 281
60 3300035692 Ga0373935_0304645 Ga0373935_0304645_244_1095 281
61 3300035725 Ga0373947_0014521 Ga0373947_0014521_3051_3899 281
62 3300036401 Ga0373937_0181756 Ga0373937_0181756_123_968 281
63 3300036401 Ga0373937_0582330 Ga0373937_0582330_126_971 281
64 3300037068 Ga0373925_0035706 Ga0373925_0035706_1101_1949 281
65 3300046462 Ga0495651_0076640 Ga0495651_0076640_1245_2096 281
66 3300046511 Ga0495608_0016263 Ga0495608_0016263_2128_2979 281
67 3300046516 Ga0495628_0033269 Ga0495628_0033269_2275_3126 281
68 3300046517 Ga0495630_0005352 Ga0495630_0005352_2926_3777 281
69 3300046529 Ga0495652_0343199 Ga0495652_0343199_160_1011 281
70 3300046559 Ga0495667_0034587 Ga0495667_0034587_2237_3088 281
71 3300046678 Ga0495599_0130627 Ga0495599_0130627_324_1175 281
72 3300046684 Ga0495669_0003009 Ga0495669_0003009_72_923 281
73 3300046689 Ga0495613_0000620 Ga0495613_0000620_25017_25868 281
74 3300047319 Ga0495674_0042947 Ga0495674_0042947_2893_3744 281
75 3300047471 Ga0495684_0006698 Ga0495684_0006698_5354_6205 281
76 3300048904 Ga0496101_0024713 Ga0496101_0024713_363_1208 281
77 3300048905 Ga0496102_0085625 Ga0496102_0085625_604_1449 281
78 3300048915 Ga0496112_0097296 Ga0496112_0097296_1147_1992 281
79 3300048917 Ga0496114_0001268 Ga0496114_0001268_16156_17001 281
80 3300048918 Ga0496115_0082984 Ga0496115_0082984_1561_2406 281
81 3300050511 nmdc:mga08y16_15263_c1 nmdc:mga08y16_15263_c1_5145_6008 281
82 3300053077 Ga0495601_0006744 Ga0495601_0006744_263_1114 281
83 3300053084 Ga0495595_0066983 Ga0495595_0066983_567_1418 281
84 3300053085 Ga0495619_0002028 Ga0495619_0002028_2131_2982 281
85 3300005539 Ga0068853_100074611 Ga0068853_1000746113 282
86 3300006237 Ga0097621_100098204 Ga0097621_1000982042 282
87 3300009093 Ga0105240_10029923 Ga0105240_100299233 282
88 3300009545 Ga0105237_10061179 Ga0105237_100611791 282
89 3300025913 Ga0207695_10097103 Ga0207695_100971031 282
90 3300025914 Ga0207671_10032551 Ga0207671_100325513 282
91 3300026041 Ga0207639_10020788 Ga0207639_100207883 282
92 3300035725 Ga0373947_0043902 Ga0373947_0043902_903_1760 285
93 3300046459 Ga0495629_0355212 Ga0495629_0355212_13_870 285
94 3300009094 Ga0111539_10007387 Ga0111539_100073872 287
95 3300049742 Ga0501080_0106495 Ga0501080_0106495_1545_2420 287
96 3300050508 nmdc:mga09592_105806_c1 nmdc:mga09592_105806_c1_561_1424 287
97 iso_pu_bacteria 2883291878 2883294290 287
98 iso_pu_bacteria 2883354860 2883357186 287
99 3300005436 Ga0070713_100019508 Ga0070713_1000195085 288
100 3300005437 Ga0070710_10033183 Ga0070710_100331832 288
101 3300006173 Ga0070716_100209850 Ga0070716_1002098501 288
102 3300037312 Ga0395899_0000013 Ga0395899_0000013_91738_92628 288
103 3300039450 Ga0436363_0614991 Ga0436363_0614991_1326_2198 288
104 3300044684 Ga0466966_0112643 Ga0466966_0112643_733_1623 288
105 3300048905 Ga0496102_0334131 Ga0496102_0334131_371_1237 288
106 3300009176 Ga0105242_10107164 Ga0105242_101071642 289
107 3300046535 Ga0495586_0171296 Ga0495586_0171296_306_1175 289
108 3300048917 Ga0496114_0308549 Ga0496114_0308549_372_1241 289
109 3300049570 Ga0501033_0203116 Ga0501033_0203116_523_1392 289
110 3300049571 Ga0501034_0022355 Ga0501034_0022355_1629_2498 289
111 3300049581 Ga0501047_0050845 Ga0501047_0050845_2967_3836 289
112 3300049823 Ga0501044_0044631 Ga0501044_0044631_2775_3644 289
113 3300005331 Ga0070670_100405385 Ga0070670_1004053852 290
114 3300005338 Ga0068868_100098080 Ga0068868_1000980802 290
115 3300005344 Ga0070661_100073418 Ga0070661_1000734183 290
116 3300005354 Ga0070675_100003651 Ga0070675_1000036516 290
117 3300005354 Ga0070675_100547403 Ga0070675_1005474031 290
118 3300005356 Ga0070674_100363759 Ga0070674_1003637592 290
119 3300005445 Ga0070708_100108315 Ga0070708_1001083151 290
120 3300005548 Ga0070665_100005072 Ga0070665_1000050722 290
121 3300005564 Ga0070664_100106339 Ga0070664_1001063393 290
122 3300005842 Ga0068858_100049964 Ga0068858_1000499645 290
123 3300006358 Ga0068871_100043347 Ga0068871_1000433473 290
124 3300006914 Ga0075436_100003168 Ga0075436_1000031686 290
125 3300009093 Ga0105240_10517767 Ga0105240_105177671 290
126 3300009098 Ga0105245_10014576 Ga0105245_100145762 290
127 3300009147 Ga0114129_10005371 Ga0114129_1000537111 290
128 3300009147 Ga0114129_10087029 Ga0114129_100870296 290
129 3300009176 Ga0105242_10022146 Ga0105242_100221465 290
130 3300009177 Ga0105248_10110704 Ga0105248_101107043 290
131 3300009551 Ga0105238_10560552 Ga0105238_105605521 290
132 3300013306 Ga0163162_10180334 Ga0163162_101803342 290
133 3300014745 Ga0157377_10040240 Ga0157377_100402402 290
134 3300014969 Ga0157376_10119441 Ga0157376_101194412 290
135 3300025299 Ga0209256_1016029 Ga0209256_10160293 290
136 3300025913 Ga0207695_10336833 Ga0207695_103368332 290
137 3300025926 Ga0207659_10001563 Ga0207659_100015636 290
138 3300025927 Ga0207687_10036613 Ga0207687_100366132 290
139 3300025940 Ga0207691_10189895 Ga0207691_101898952 290
140 3300025941 Ga0207711_10197247 Ga0207711_101972473 290
141 3300025945 Ga0207679_10141856 Ga0207679_101418562 290
142 3300026023 Ga0207677_10066158 Ga0207677_100661582 290
143 3300026035 Ga0207703_10200956 Ga0207703_102009563 290
144 3300028379 Ga0268266_10117997 Ga0268266_101179974 290
145 3300048903 Ga0496100_0361040 Ga0496100_0361040_24_896 290
146 3300049586 Ga0501070_0293240 Ga0501070_0293240_442_1314 290
147 3300049587 Ga0501071_0210117 Ga0501071_0210117_395_1267 290
148 3300049590 Ga0501074_0097943 Ga0501074_0097943_388_1260 290
149 3300049591 Ga0501075_0084377 Ga0501075_0084377_1054_1926 290
150 3300049742 Ga0501080_0298925 Ga0501080_0298925_274_1146 290
151 3300050507 nmdc:mga05p37_14078_c1 nmdc:mga05p37_14078_c1_3841_4755 290
152 3300050507 nmdc:mga05p37_64023_c1 nmdc:mga05p37_64023_c1_3002_3874 290
153 3300050515 nmdc:mga0a205_201471_c1 nmdc:mga0a205_201471_c1_771_1685 290
154 3300061734 Ga0530510_0188862 Ga0530510_0188862_325_1197 290
155 3300005328 Ga0070676_10206629 Ga0070676_102066291 291
156 3300005330 Ga0070690_100032101 Ga0070690_1000321012 291
157 3300005335 Ga0070666_10013407 Ga0070666_100134077 291
158 3300005339 Ga0070660_100084685 Ga0070660_1000846853 291
159 3300005437 Ga0070710_10121602 Ga0070710_101216021 291
160 3300005440 Ga0070705_100014828 Ga0070705_1000148283 291
161 3300005440 Ga0070705_100098606 Ga0070705_1000986061 291
162 3300005545 Ga0070695_100013253 Ga0070695_1000132532 291
163 3300005549 Ga0070704_100002954 Ga0070704_1000029543 291
164 3300005578 Ga0068854_100005386 Ga0068854_1000053864 291
165 3300005617 Ga0068859_100022461 Ga0068859_1000224616 291
166 3300005618 Ga0068864_100008953 Ga0068864_1000089538 291
167 3300005842 Ga0068858_100003488 Ga0068858_1000034884 291
168 3300005842 Ga0068858_100007706 Ga0068858_10000770611 291
169 3300005843 Ga0068860_100169756 Ga0068860_1001697562 291
170 3300006173 Ga0070716_100075836 Ga0070716_1000758362 291
171 3300006237 Ga0097621_100113425 Ga0097621_1001134252 291
172 3300006844 Ga0075428_100004272 Ga0075428_10000427214 291
173 3300006871 Ga0075434_100000633 Ga0075434_10000063326 291
174 3300006871 Ga0075434_100021400 Ga0075434_1000214007 291
175 3300006871 Ga0075434_100073836 Ga0075434_1000738362 291
176 3300006880 Ga0075429_100014777 Ga0075429_1000147774 291
177 3300006880 Ga0075429_100198459 Ga0075429_1001984592 291
178 3300006914 Ga0075436_100001697 Ga0075436_10000169714 291
179 3300006931 Ga0097620_100022461 Ga0097620_1000224614 291
180 3300007076 Ga0075435_100000285 Ga0075435_10000028528 291
181 3300007076 Ga0075435_100008435 Ga0075435_1000084353 291
182 3300007076 Ga0075435_100110762 Ga0075435_1001107622 291
183 3300007076 Ga0075435_100527106 Ga0075435_1005271061 291
184 3300009011 Ga0105251_10000571 Ga0105251_1000057122 291
185 3300009092 Ga0105250_10001563 Ga0105250_1000156310 291
186 3300009093 Ga0105240_10081619 Ga0105240_100816193 291
187 3300009094 Ga0111539_10171939 Ga0111539_101719392 291
188 3300009101 Ga0105247_10021797 Ga0105247_100217972 291
189 3300009147 Ga0114129_10002032 Ga0114129_1000203220 291
190 3300009174 Ga0105241_10053120 Ga0105241_100531202 291
191 3300009177 Ga0105248_10042788 Ga0105248_100427886 291
192 3300009177 Ga0105248_10312011 Ga0105248_103120112 291
193 3300009551 Ga0105238_10020723 Ga0105238_100207236 291
194 3300009551 Ga0105238_10495861 Ga0105238_104958612 291
195 3300013297 Ga0157378_10431944 Ga0157378_104319441 291
196 3300013308 Ga0157375_10268848 Ga0157375_102688482 291
197 3300014325 Ga0163163_10001113 Ga0163163_1000111311 291
198 3300014325 Ga0163163_10051217 Ga0163163_100512173 291
199 3300014325 Ga0163163_10113432 Ga0163163_101134322 291
200 3300014968 Ga0157379_10021615 Ga0157379_100216153 291
201 3300014968 Ga0157379_10057716 Ga0157379_100577163 291
202 3300014969 Ga0157376_10279156 Ga0157376_102791562 291
203 3300025711 Ga0207696_1000460 Ga0207696_10004608 291
204 3300025735 Ga0207713_1000061 Ga0207713_10000618 291
205 3300025898 Ga0207692_10144602 Ga0207692_101446021 291
206 3300025903 Ga0207680_10015719 Ga0207680_100157193 291
207 3300025913 Ga0207695_10079377 Ga0207695_100793772 291
208 3300025917 Ga0207660_10364976 Ga0207660_103649762 291
209 3300025921 Ga0207652_10151631 Ga0207652_101516312 291
210 3300025924 Ga0207694_10373929 Ga0207694_103739291 291
211 3300025925 Ga0207650_10009438 Ga0207650_100094383 291
212 3300025932 Ga0207690_10235617 Ga0207690_102356172 291
213 3300025936 Ga0207670_10084702 Ga0207670_100847024 291
214 3300025939 Ga0207665_10049235 Ga0207665_100492353 291
215 3300025941 Ga0207711_10013243 Ga0207711_100132435 291
216 3300025941 Ga0207711_10240509 Ga0207711_102405091 291
217 3300025945 Ga0207679_10495891 Ga0207679_104958912 291
218 3300025981 Ga0207640_10101997 Ga0207640_101019971 291
219 3300025981 Ga0207640_10264347 Ga0207640_102643472 291
220 3300026035 Ga0207703_10029699 Ga0207703_100296994 291
221 3300026041 Ga0207639_10023244 Ga0207639_100232443 291
222 3300026088 Ga0207641_10332961 Ga0207641_103329612 291
223 3300026089 Ga0207648_10239927 Ga0207648_102399273 291
224 3300026095 Ga0207676_10020126 Ga0207676_100201264 291
225 3300026095 Ga0207676_10078882 Ga0207676_100788823 291
226 3300027907 Ga0207428_10011564 Ga0207428_100115648 291
227 3300028379 Ga0268266_10026665 Ga0268266_100266653 291
228 3300031241 Ga0265325_10124913 Ga0265325_101249131 291
229 3300034819 Ga0373958_0000815 Ga0373958_0000815_2040_2915 291
230 3300035084 Ga0373928_0009111 Ga0373928_0009111_1051_1926 291
231 3300035085 Ga0373929_0002170 Ga0373929_0002170_548_1423 291
232 3300035086 Ga0373934_0087802 Ga0373934_0087802_278_1153 291
233 3300035088 Ga0373940_0006580 Ga0373940_0006580_1042_1917 291
234 3300035090 Ga0373949_0003502 Ga0373949_0003502_2179_3054 291
235 3300035092 Ga0373952_0002110 Ga0373952_0002110_1765_2640 291
236 3300035112 Ga0373932_0000672 Ga0373932_0000672_4364_5239 291
237 3300035114 Ga0373939_0003558 Ga0373939_0003558_28_903 291
238 3300035119 Ga0373956_0103557 Ga0373956_0103557_350_1225 291
239 3300035121 Ga0373960_0004430 Ga0373960_0004430_1551_2426 291
240 3300035242 Ga0373962_0053379 Ga0373962_0053379_197_1072 291
241 3300035691 Ga0373931_0002139 Ga0373931_0002139_6105_6980 291
242 3300035691 Ga0373931_0041443 Ga0373931_0041443_712_1587 291
243 3300035692 Ga0373935_0030680 Ga0373935_0030680_1928_2803 291
244 3300035725 Ga0373947_0152033 Ga0373947_0152033_549_1424 291
245 3300036401 Ga0373937_0094584 Ga0373937_0094584_1661_2536 291
246 3300036401 Ga0373937_0095523 Ga0373937_0095523_696_1571 291
247 3300037853 Ga0436364_0405699 Ga0436364_0405699_289_1164 291
248 3300039450 Ga0436363_0894936 Ga0436363_0894936_6972_7847 291
249 3300046472 Ga0495580_0190943 Ga0495580_0190943_222_1115 291
250 3300046529 Ga0495652_0137443 Ga0495652_0137443_891_1766 291
251 3300048907 Ga0496104_0043685 Ga0496104_0043685_1369_2244 291
252 3300048910 Ga0496107_0142776 Ga0496107_0142776_635_1510 291
253 3300048911 Ga0496108_0002194 Ga0496108_0002194_2974_3849 291
254 3300048914 Ga0496111_0091833 Ga0496111_0091833_467_1342 291
255 3300048915 Ga0496112_0003322 Ga0496112_0003322_732_1607 291
256 3300048915 Ga0496112_0421288 Ga0496112_0421288_165_1040 291
257 3300048916 Ga0496113_0085349 Ga0496113_0085349_1248_2123 291
258 3300049581 Ga0501047_0072732 Ga0501047_0072732_1120_2004 291
259 3300049585 Ga0501069_0139535 Ga0501069_0139535_129_1013 291
260 3300049586 Ga0501070_0063685 Ga0501070_0063685_1423_2307 291
261 3300049586 Ga0501070_0202860 Ga0501070_0202860_86_970 291
262 3300049589 Ga0501073_0095360 Ga0501073_0095360_864_1739 291
263 3300049589 Ga0501073_0236705 Ga0501073_0236705_46_930 291
264 3300049742 Ga0501080_0013019 Ga0501080_0013019_4428_5312 291
265 3300050507 nmdc:mga05p37_113107_c1 nmdc:mga05p37_113107_c1_565_1443 291
266 3300050507 nmdc:mga05p37_4667_c1 nmdc:mga05p37_4667_c1_2080_2955 291
267 3300050512 nmdc:mga0n895_112855_c1 nmdc:mga0n895_112855_c1_1389_2264 291
268 3300050512 nmdc:mga0n895_11_c1 nmdc:mga0n895_11_c1_19784_20659 291
269 3300050513 nmdc:mga0rr50_1831_c1 nmdc:mga0rr50_1831_c1_1980_2855 291
270 3300050513 nmdc:mga0rr50_19_c1 nmdc:mga0rr50_19_c1_31990_32865 291
271 3300050514 nmdc:mga08x19_1370_c1 nmdc:mga08x19_1370_c1_11578_12453 291
272 3300050514 nmdc:mga08x19_156291_c1 nmdc:mga08x19_156291_c1_440_1315 291
273 3300050514 nmdc:mga08x19_97488_c1 nmdc:mga08x19_97488_c1_742_1617 291
274 3300007076 Ga0075435_100004978 Ga0075435_1000049788 292
275 3300005335 Ga0070666_10208466 Ga0070666_102084662 293
276 3300005842 Ga0068858_100057426 Ga0068858_1000574264 293
277 3300005843 Ga0068860_100025023 Ga0068860_1000250234 293
278 3300005937 Ga0081455_10342925 Ga0081455_103429251 293
279 3300009177 Ga0105248_10036561 Ga0105248_100365613 293
280 3300013297 Ga0157378_10407454 Ga0157378_104074542 293
281 3300014326 Ga0157380_10520041 Ga0157380_105200412 293
282 3300014968 Ga0157379_10010079 Ga0157379_1001007910 293
283 3300025931 Ga0207644_10027600 Ga0207644_100276004 293
284 3300025940 Ga0207691_10137602 Ga0207691_101376022 293
285 3300025941 Ga0207711_10022028 Ga0207711_100220282 293
286 3300025986 Ga0207658_10030857 Ga0207658_100308572 293
287 3300026035 Ga0207703_10027233 Ga0207703_100272334 293
288 3300028381 Ga0268264_10020538 Ga0268264_100205384 293
289 3300046681 Ga0495647_0091936 Ga0495647_0091936_132_1013 293
290 3300005367 Ga0070667_100016949 Ga0070667_1000169493 294
291 3300005436 Ga0070713_100619813 Ga0070713_1006198131 294
292 3300005471 Ga0070698_100363025 Ga0070698_1003630252 294
293 3300005841 Ga0068863_100001403 Ga0068863_10000140326 294
294 3300005841 Ga0068863_100394653 Ga0068863_1003946532 294
295 3300005842 Ga0068858_100361214 Ga0068858_1003612142 294
296 3300005844 Ga0068862_100013820 Ga0068862_1000138201 294
297 3300006847 Ga0075431_100130157 Ga0075431_1001301572 294
298 3300006871 Ga0075434_100012244 Ga0075434_10001224410 294
299 3300009094 Ga0111539_10068760 Ga0111539_100687604 294
300 3300009094 Ga0111539_10220803 Ga0111539_102208032 294
301 3300009094 Ga0111539_10649254 Ga0111539_106492542 294
302 3300009147 Ga0114129_10008522 Ga0114129_100085223 294
303 3300013297 Ga0157378_10263824 Ga0157378_102638241 294
304 3300025901 Ga0207688_10152213 Ga0207688_101522131 294
305 3300025910 Ga0207684_10127359 Ga0207684_101273593 294
306 3300025924 Ga0207694_10039783 Ga0207694_100397833 294
307 3300025960 Ga0207651_10017850 Ga0207651_100178501 294
308 3300025972 Ga0207668_10094877 Ga0207668_100948773 294
309 3300026088 Ga0207641_10000722 Ga0207641_1000072227 294
310 3300026089 Ga0207648_10435143 Ga0207648_104351431 294
311 3300028380 Ga0268265_10024854 Ga0268265_100248547 294
312 3300046472 Ga0495580_0008181 Ga0495580_0008181_3155_4039 294
313 3300050507 nmdc:mga05p37_95048_c1 nmdc:mga05p37_95048_c1_540_1427 294
314 3300050510 nmdc:mga06r32_195888_c1 nmdc:mga06r32_195888_c1_448_1335 294
315 3300050512 nmdc:mga0n895_65864_c1 nmdc:mga0n895_65864_c1_861_1745 294
316 3300050515 nmdc:mga0a205_1769_c1 nmdc:mga0a205_1769_c1_3807_4691 294
317 3300014968 Ga0157379_10006889 Ga0157379_100068892 295
318 3300025941 Ga0207711_10258598 Ga0207711_102585982 295
319 3300027907 Ga0207428_10039514 Ga0207428_100395143 295
320 3300009177 Ga0105248_10148934 Ga0105248_101489341 296
321 3300026041 Ga0207639_10524686 Ga0207639_105246861 296
322 3300005290 Ga0065712_10120017 Ga0065712_101200171 299
323 3300005354 Ga0070675_100215689 Ga0070675_1002156892 299
324 3300005530 Ga0070679_100161166 Ga0070679_1001611662 299
325 3300005578 Ga0068854_100224214 Ga0068854_1002242142 299
326 3300013308 Ga0157375_10106042 Ga0157375_101060423 299
327 3300014969 Ga0157376_10105764 Ga0157376_101057643 299
328 3300025926 Ga0207659_10239254 Ga0207659_102392542 299
329 3300025938 Ga0207704_10137185 Ga0207704_101371852 299
330 3300025960 Ga0207651_10301355 Ga0207651_103013552 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11004

Kdo_hydroxy

3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase

56

329

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yw0-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with succinate and fe(iii) 0.9866 12 298
5yvz-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate and fe(iii) 0.9846 11 299
5yka-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with cobalt(ii) 0.9828 12 298
6a2e-assembly1.cif.gz_A apo structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase 0.9825 11 298
5yvz-assembly1.cif.gz_A crystal structure of the kdo hydroxylase kdoo, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate and fe(iii) 0.9549 11 299
ID Description Score Start End Superfamily
4hvqA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7149 123 270 2.60.120.10
1yfuA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6374 118 270 2.60.120.10
af_P64488_1_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6011 118 275 2.60.120.10
3gbfA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.5913 116 275 2.60.120.10
3ouiA00 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.5864 94 275 2.60.120.620
ID Description Score Start End GO Terms
AF-A0A4Y8PEJ3-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9884 12 298
AF-G2JAV8-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.988 161 299
AF-A0A1G0FYV3-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9878 9 299
AF-A0A2V8CGM8-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9876 10 299
AF-A0A843SS47-F1-model_v4 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) hydroxylase 0.9871 9 299

Feature Viewer

pLDDT pTM Quality
89.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map