F409950

General Info

Members Datasets Scaffolds Average Seq Length
330 212 660 324

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100317253|Ga0070683_1003172532
Length 348
Sequence LVLATQKRGTITGRGTIRPVNWEEYADTALKSFAEATTAGELAEAHTAWLGRKSELKVGLRNVRDRETGMALNAVRERLEAAFASREAELERGALAQLDEQLDVTLPGTPLSRGRLHPLTQIRREVEDIFLGLGYEIIDSREVETVWHNFDALTQPLTHPSRSHRDTFYVDDDTLLRTHTSTGQIRVMEERQPPIYIATLGRVYRRDTPSPRSTPNFHQVEALAVDRGISLADLKGTLMHFFRAMFGEDRDVRMRTSFFPFTEPSVEFDVTCFLCGGKGCAFCKYTGWFEMGGAGAVDPAVFEKMGYDPEEWSGFAWGLGLDRIAAQRHGIPDIRMFWENDLRVLRQF

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 15.76
Rhizosphere 82.73
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100317253 3300005329 Unclassified 1483
2 Ga0070683_100264100 3300005329 Unclassified 1637
3 Ga0070690_100040096 3300005330 Bacteria 2961
4 Ga0070666_10062711 3300005335 Bacteria 2519
5 Ga0070680_100014237 3300005336 Bacteria 6210
6 Ga0070682_100289388 3300005337 Bacteria 1197
7 Ga0070660_100005127 3300005339 Bacteria 9051
8 Ga0070660_100017554 3300005339 Bacteria 5217
9 Ga0070689_100015072 3300005340 Bacteria 5629
10 Ga0070691_10023317 3300005341 Bacteria 2873
11 Ga0070661_100014396 3300005344 Bacteria 5573
12 Ga0070661_100158989 3300005344 Bacteria 1711
13 Ga0070674_100012276 3300005356 Bacteria 5258
14 Ga0070688_100001303 3300005365 Bacteria 12433
15 Ga0070688_100255213 3300005365 Bacteria 1250
16 Ga0070659_100179116 3300005366 Bacteria 1739
17 Ga0070713_100397241 3300005436 Bacteria 1287
18 Ga0070710_10001929 3300005437 Bacteria 9823
19 Ga0070701_10006925 3300005438 Bacteria 4804
20 Ga0070711_100001795 3300005439 Bacteria 11953
21 Ga0070705_100006211 3300005440 Bacteria 5850
22 Ga0070705_100016406 3300005440 Bacteria 3848
23 Ga0070700_100002064 3300005441 Bacteria 10203
24 Ga0070694_100034048 3300005444 Bacteria 3357
25 Ga0070708_100072150 3300005445 Bacteria 3110
26 Ga0070708_100122996 3300005445 Bacteria 2395
27 Ga0070708_100126347 3300005445 Bacteria 2364
28 Ga0070708_100354027 3300005445 Bacteria 1384
29 Ga0070663_100050916 3300005455 Bacteria 2947
30 Ga0070678_100005718 3300005456 Bacteria 7224
31 Ga0070681_10005995 3300005458 Bacteria 11779
32 Ga0070685_10003638 3300005466 Bacteria 7818
33 Ga0070706_100008465 3300005467 Bacteria 9581
34 Ga0070706_100051040 3300005467 Bacteria 3816
35 Ga0070706_100064481 3300005467 Bacteria 3386
36 Ga0070707_100003936 3300005468 Bacteria 13980
37 Ga0070707_100167561 3300005468 Bacteria 2141
38 Ga0070698_100076892 3300005471 Bacteria 3339
39 Ga0070698_100083553 3300005471 Bacteria 3182
40 Ga0070698_100163697 3300005471 Bacteria 2168
41 Ga0070698_100244137 3300005471 Bacteria 1729
42 Ga0070699_100023586 3300005518 Bacteria 5300
43 Ga0070699_100078987 3300005518 Bacteria 2866
44 Ga0070699_100081245 3300005518 Bacteria 2825
45 Ga0070699_100124567 3300005518 Bacteria 2268
46 Ga0070679_100022451 3300005530 Bacteria 6166
47 Ga0070697_100049140 3300005536 Bacteria 3423
48 Ga0068853_100003961 3300005539 Bacteria 11377
49 Ga0070672_100006346 3300005543 Bacteria 7938
50 Ga0070686_100007827 3300005544 Bacteria 5974
51 Ga0070695_100037607 3300005545 Bacteria 3051
52 Ga0070696_100024911 3300005546 Bacteria 4066
53 Ga0070696_100046368 3300005546 Bacteria 3014
54 Ga0070693_100052936 3300005547 Bacteria 2329
55 Ga0070665_100387642 3300005548 Bacteria 1405
56 Ga0070704_100025827 3300005549 Bacteria 3872
57 Ga0070704_100295884 3300005549 Bacteria 1347
58 Ga0068855_100108927 3300005563 Bacteria 3181
59 Ga0068856_100026813 3300005614 Bacteria 5619
60 Ga0068856_100102560 3300005614 Bacteria 2855
61 Ga0070702_100004065 3300005615 Bacteria 6632
62 Ga0070702_100079848 3300005615 Bacteria 1956
63 Ga0068852_100010619 3300005616 Bacteria 6890
64 Ga0068864_100290771 3300005618 Bacteria 1528
65 Ga0068866_10001820 3300005718 Bacteria 8972
66 Ga0068861_100066654 3300005719 Bacteria 2776
67 Ga0068862_100305387 3300005844 Bacteria 1465
68 Ga0070717_10248413 3300006028 Bacteria 1571
69 Ga0070715_10028627 3300006163 Bacteria 2237
70 Ga0070716_100102219 3300006173 Bacteria 1760
71 Ga0070712_100024682 3300006175 Bacteria 3987
72 Ga0097621_100126463 3300006237 Bacteria 2172
73 Ga0068871_100063051 3300006358 Bacteria 3031
74 Ga0075433_10121620 3300006852 Bacteria 2318
75 Ga0075434_100015033 3300006871 Bacteria 7412
76 Ga0068865_100031933 3300006881 Bacteria 3514
77 Ga0111539_10143880 3300009094 Bacteria 2791
78 Ga0105245_10020139 3300009098 Bacteria 5847
79 Ga0105247_10045041 3300009101 Bacteria 2707
80 Ga0114129_10113934 3300009147 Bacteria 3728
81 Ga0105243_10013807 3300009148 Bacteria 6112
82 Ga0105241_10021339 3300009174 Bacteria 4787
83 Ga0105242_10010733 3300009176 Bacteria 7033
84 Ga0105248_10022195 3300009177 Bacteria 7037
85 Ga0105237_10319268 3300009545 Bacteria 1557
86 Ga0105238_10038137 3300009551 Bacteria 4881
87 Ga0105249_10001940 3300009553 Bacteria 17962
88 Ga0105249_10133326 3300009553 Bacteria 2374
89 Ga0105239_10041862 3300010375 Bacteria 5019
90 Ga0105246_10030690 3300011119 Bacteria 3552
91 Ga0157373_10080735 3300013100 Bacteria 2293
92 Ga0157371_10195277 3300013102 Bacteria 1450
93 Ga0157370_10060098 3300013104 Bacteria 3610
94 Ga0157374_10029097 3300013296 Bacteria 4997
95 Ga0157378_10011798 3300013297 Bacteria 7651
96 Ga0157378_10300898 3300013297 Bacteria 1552
97 Ga0163162_10025281 3300013306 Bacteria 5867
98 Ga0157375_10021124 3300013308 Bacteria 5963
99 Ga0157375_10080561 3300013308 Bacteria 3294
100 Ga0157377_10007181 3300014745 Bacteria 5362
101 Ga0157379_10100402 3300014968 Bacteria 2598
102 Ga0157376_10002472 3300014969 Bacteria 12497
103 Ga0207692_10043308 3300025898 Bacteria 2239
104 Ga0207642_10018620 3300025899 Bacteria 2669
105 Ga0207680_10149427 3300025903 Bacteria 1556
106 Ga0207685_10030103 3300025905 Bacteria 1929
107 Ga0207684_10031037 3300025910 Bacteria 4548
108 Ga0207684_10080990 3300025910 Bacteria 2762
109 Ga0207684_10087056 3300025910 Bacteria 2661
110 Ga0207654_10021547 3300025911 Bacteria 3428
111 Ga0207707_10026256 3300025912 Bacteria 5091
112 Ga0207663_10005575 3300025916 Bacteria 6354
113 Ga0207663_10074155 3300025916 Bacteria 2204
114 Ga0207660_10256540 3300025917 Bacteria 1381
115 Ga0207649_10030425 3300025920 Bacteria 3197
116 Ga0207652_10276386 3300025921 Bacteria 1515
117 Ga0207646_10075807 3300025922 Bacteria 3005
118 Ga0207687_10088049 3300025927 Bacteria 2258
119 Ga0207664_10054691 3300025929 Bacteria 3164
120 Ga0207706_10013475 3300025933 Bacteria 7431
121 Ga0207686_10075369 3300025934 Bacteria 2184
122 Ga0207709_10067669 3300025935 Bacteria 2255
123 Ga0207669_10056075 3300025937 Bacteria 2390
124 Ga0207704_10077392 3300025938 Bacteria 2135
125 Ga0207665_10051396 3300025939 Bacteria 2774
126 Ga0207691_10003940 3300025940 Bacteria 14419
127 Ga0207711_10128348 3300025941 Bacteria 2270
128 Ga0207667_10302819 3300025949 Bacteria 1633
129 Ga0207651_10110653 3300025960 Bacteria 2061
130 Ga0207712_10033109 3300025961 Bacteria 3492
131 Ga0207712_10199727 3300025961 Bacteria 1585
132 Ga0207668_10184013 3300025972 Bacteria 1650
133 Ga0207658_10164539 3300025986 Bacteria 1821
134 Ga0207677_10061541 3300026023 Bacteria 2600
135 Ga0207639_10200484 3300026041 Bacteria 1711
136 Ga0207708_10000618 3300026075 Bacteria 27289
137 Ga0207648_10003274 3300026089 Bacteria 17031
138 Ga0207676_10108458 3300026095 Bacteria 2318
139 Ga0207675_100026431 3300026118 Bacteria 5403
140 Ga0207683_10006342 3300026121 Bacteria 10133
141 Ga0207698_10049176 3300026142 Bacteria 3207
142 Ga0207698_10400159 3300026142 Bacteria 1312
143 Ga0268266_10060125 3300028379 Bacteria 3275
144 Ga0268265_10100909 3300028380 Bacteria 2331
145 Ga0307406_10237038 3300031901 Bacteria 1366
146 Ga0307416_100245890 3300032002 Bacteria 1737
147 Ga0307415_100017437 3300032126 Bacteria 4306
148 Ga0373936_0011213 3300035113 Bacteria 3389
149 Ga0373943_0009716 3300035170 Bacteria 4308
150 Ga0373946_0065795 3300035171 Bacteria 1553
151 Ga0373927_0092215 3300035695 Bacteria 1968
152 Ga0373925_0010897 3300037068 Bacteria 6595
153 Ga0395899_0020483 3300037312 Bacteria 5013
154 Ga0395899_0028416 3300037312 Bacteria 4211
155 Ga0395899_0038085 3300037312 Bacteria 3603
156 Ga0395899_0066213 3300037312 Bacteria 2653
157 Ga0395899_0083679 3300037312 Bacteria 2320
158 Ga0395899_0154886 3300037312 Bacteria 1622
159 Ga0395899_0190724 3300037312 Bacteria 1434
160 Ga0395900_0009708 3300037418 Bacteria 9860
161 Ga0395900_0009837 3300037418 Bacteria 9794
162 Ga0395900_0016205 3300037418 Bacteria 7592
163 Ga0395900_0016328 3300037418 Bacteria 7568
164 Ga0395900_0041307 3300037418 Bacteria 4755
165 Ga0395900_0050236 3300037418 Bacteria 4296
166 Ga0395900_0051398 3300037418 Bacteria 4246
167 Ga0395900_0268558 3300037418 Bacteria 1701
168 Ga0395900_0273241 3300037418 Bacteria 1684
169 Ga0395898_0000635 3300037466 Bacteria 64060
170 Ga0395898_0007862 3300037466 Bacteria 11313
171 Ga0395898_0009165 3300037466 Bacteria 10425
172 Ga0395898_0021357 3300037466 Bacteria 6565
173 Ga0395898_0041309 3300037466 Bacteria 4556
174 Ga0395898_0068841 3300037466 Bacteria 3425
175 Ga0395898_0070009 3300037466 Bacteria 3393
176 Ga0395905_0004382 3300037471 Bacteria 14690
177 Ga0395905_0007787 3300037471 Bacteria 10623
178 Ga0395905_0026208 3300037471 Bacteria 5497
179 Ga0395905_0061059 3300037471 Bacteria 3525
180 Ga0395905_0118777 3300037471 Bacteria 2485
181 Ga0395905_0236243 3300037471 Bacteria 1708
182 Ga0395901_0006552 3300038443 Bacteria 11777
183 Ga0395901_0010770 3300038443 Bacteria 9271
184 Ga0395901_0023306 3300038443 Bacteria 6344
185 Ga0395901_0029071 3300038443 Bacteria 5686
186 Ga0395901_0030508 3300038443 Bacteria 5554
187 Ga0395901_0074188 3300038443 Bacteria 3549
188 Ga0395901_0078184 3300038443 Bacteria 3454
189 Ga0395901_0086875 3300038443 Bacteria 3270
190 Ga0395901_0119353 3300038443 Bacteria 2771
191 Ga0395901_0175847 3300038443 Bacteria 2245
192 Ga0395901_0289511 3300038443 Bacteria 1700
193 Ga0451789_0485758 3300041443 Bacteria 3118
194 Ga0451802_0272488 3300041460 Bacteria 3019
195 Ga0451807_1518392 3300041486 Bacteria 1495
196 Ga0451839_0731987 3300041496 Bacteria 2315
197 Ga0451849_0215714 3300041505 Bacteria 1788
198 Ga0451851_0646240 3300041507 Bacteria 1579
199 Ga0450907_002712 3300042146 Bacteria 3294
200 Ga0450918_025294 3300042531 Bacteria 1040
201 Ga0466965_0093714 3300044683 Bacteria 1530
202 Ga0466966_0061757 3300044684 Bacteria 2363
203 Ga0466961_0009673 3300044693 Bacteria 6138
204 Ga0466961_0010565 3300044693 Bacteria 5888
205 Ga0466961_0072646 3300044693 Bacteria 2182
206 Ga0466963_0010949 3300044694 Bacteria 5511
207 Ga0466963_0015999 3300044694 Bacteria 4657
208 Ga0466963_0020122 3300044694 Bacteria 4195
209 Ga0466963_0066788 3300044694 Bacteria 2413
210 Ga0466963_0103013 3300044694 Bacteria 1955
211 Ga0466963_0128359 3300044694 Bacteria 1749
212 Ga0466971_0000164 3300044719 Bacteria 24721
213 Ga0466968_0005218 3300044735 Bacteria 4864
214 Ga0466968_0044933 3300044735 Bacteria 1873
215 Ga0466970_0029095 3300044765 Bacteria 2907
216 Ga0466957_0001579 3300044842 Bacteria 11996
217 Ga0466957_0089087 3300044842 Bacteria 1931
218 Ga0466959_0010957 3300045049 Bacteria 6505
219 Ga0466959_0020338 3300045049 Bacteria 4890
220 Ga0466958_0002223 3300045836 Bacteria 9665
221 Ga0466967_0012223 3300045976 Bacteria 6555
222 Ga0466967_0021142 3300045976 Bacteria 5276
223 Ga0466967_0115753 3300045976 Bacteria 2469
224 Ga0466967_0115938 3300045976 Bacteria 2467
225 Ga0466967_0258831 3300045976 Bacteria 1664
226 Ga0466967_0339380 3300045976 Bacteria 1452
227 Ga0466967_0482054 3300045976 Bacteria 1215
228 Ga0495582_0007394 3300046473 Bacteria 6082
229 Ga0495605_0015769 3300046474 Bacteria 4106
230 Ga0495594_0011199 3300046499 Bacteria 4656
231 Ga0495665_0065085 3300046531 Bacteria 1924
232 Ga0495609_0037386 3300046538 Bacteria 2190
233 Ga0495645_0195788 3300046543 Bacteria 1374
234 Ga0495588_0112919 3300046674 Bacteria 1431
235 Ga0495624_0150810 3300046690 Bacteria 1422
236 Ga0495581_0015894 3300047315 Bacteria 4372
237 Ga0495636_0064627 3300047318 Bacteria 1553
238 Ga0495674_0355093 3300047319 Bacteria 1189
239 Ga0495676_0148258 3300047321 Bacteria 1673
240 Ga0495677_0010456 3300047445 Bacteria 3408
241 Ga0496100_0009564 3300048903 Bacteria 5447
242 Ga0496100_0094871 3300048903 Bacteria 2044
243 Ga0496101_0001521 3300048904 Bacteria 13886
244 Ga0496101_0032062 3300048904 Bacteria 3696
245 Ga0496101_0046508 3300048904 Bacteria 3112
246 Ga0496102_0001739 3300048905 Bacteria 19070
247 Ga0496102_0281751 3300048905 Unclassified 1567
248 Ga0496103_0061626 3300048906 Bacteria 2333
249 Ga0496104_0002003 3300048907 Bacteria 17677
250 Ga0496104_0014177 3300048907 Bacteria 7192
251 Ga0496104_0054324 3300048907 Bacteria 3785
252 Ga0496104_0229348 3300048907 Bacteria 1769
253 Ga0496105_0017476 3300048908 Bacteria 5753
254 Ga0496105_0029997 3300048908 Bacteria 4454
255 Ga0496105_0060475 3300048908 Bacteria 3126
256 Ga0496105_0069413 3300048908 Bacteria 2912
257 Ga0496105_0076646 3300048908 Bacteria 2761
258 Ga0496106_0016849 3300048909 Bacteria 5407
259 Ga0496106_0247996 3300048909 Bacteria 1423
260 Ga0496107_0011699 3300048910 Bacteria 6117
261 Ga0496107_0016881 3300048910 Bacteria 5131
262 Ga0496107_0215988 3300048910 Bacteria 1426
263 Ga0496108_0003059 3300048911 Bacteria 13441
264 Ga0496108_0003974 3300048911 Bacteria 11884
265 Ga0496108_0044422 3300048911 Bacteria 3709
266 Ga0496108_0052664 3300048911 Bacteria 3412
267 Ga0496109_0000521 3300048912 Bacteria 32573
268 Ga0496109_0005757 3300048912 Bacteria 10367
269 Ga0496109_0015942 3300048912 Bacteria 6564
270 Ga0496109_0228519 3300048912 Bacteria 1750
271 Ga0496110_0010929 3300048913 Bacteria 7404
272 Ga0496110_0064106 3300048913 Bacteria 3247
273 Ga0496110_0094235 3300048913 Bacteria 2681
274 Ga0496110_0183652 3300048913 Bacteria 1899
275 Ga0496110_0200880 3300048913 Bacteria 1811
276 Ga0496111_0015340 3300048914 Bacteria 5256
277 Ga0496111_0197686 3300048914 Bacteria 1495
278 Ga0496112_0018357 3300048915 Bacteria 6585
279 Ga0496112_0055821 3300048915 Bacteria 3885
280 Ga0496112_0210655 3300048915 Unclassified 1901
281 Ga0496113_0044582 3300048916 Bacteria 3286
282 Ga0496113_0173897 3300048916 Unclassified 1706
283 Ga0496114_0001315 3300048917 Bacteria 18828
284 Ga0496114_0002127 3300048917 Bacteria 15061
285 Ga0496114_0087588 3300048917 Bacteria 2640
286 Ga0496114_0130530 3300048917 Bacteria 2169
287 Ga0496115_0001991 3300048918 Bacteria 14595
288 Ga0496115_0016391 3300048918 Bacteria 5643
289 Ga0496115_0184852 3300048918 Bacteria 1722
290 Ga0501036_0016282 3300049572 Bacteria 6211
291 Ga0501037_0010930 3300049573 Bacteria 6672
292 Ga0501038_0006451 3300049574 Bacteria 10859
293 Ga0501039_0001803 3300049575 Bacteria 15832
294 Ga0501040_0001040 3300049576 Bacteria 17560
295 Ga0501040_0076017 3300049576 Bacteria 2322
296 Ga0501041_0002023 3300049577 Bacteria 11403
297 Ga0501042_0007183 3300049578 Bacteria 7289
298 Ga0501042_0244133 3300049578 Bacteria 1296
299 Ga0501043_0160237 3300049579 Bacteria 1758
300 Ga0501046_0007613 3300049580 Bacteria 9503
301 Ga0501048_0027027 3300049582 Bacteria 4173
302 Ga0501067_0097733 3300049583 Unclassified 1631
303 Ga0501068_0266143 3300049584 Bacteria 1094
304 Ga0501071_0019556 3300049587 Bacteria 4699
305 Ga0501072_0033959 3300049588 Bacteria 3996
306 Ga0501072_0039041 3300049588 Bacteria 3728
307 Ga0501074_0009173 3300049590 Bacteria 7184
308 Ga0501075_0001777 3300049591 Bacteria 14185
309 Ga0501076_0001047 3300049592 Bacteria 18162
310 Ga0501077_0134598 3300049593 Bacteria 1567
311 Ga0501079_0025874 3300049741 Bacteria 4501
312 Ga0501080_0176926 3300049742 Bacteria 1965
313 Ga0501081_0056164 3300049743 Bacteria 2720
314 Ga0501081_0181637 3300049743 Bacteria 1522
315 Ga0501045_0000378 3300049824 Bacteria 26772
316 nmdc:mga00v17_130187_c1 3300050491 Bacteria 1607
317 nmdc:mga0yw44_119979_c1 3300050492 Bacteria 1693
318 nmdc:mga05p37_7612_c1 3300050507 Bacteria 12781
319 nmdc:mga08y16_366578_c1 3300050511 Bacteria 1478
320 nmdc:mga0n895_36697_c1 3300050512 Bacteria 4735
321 nmdc:mga0a205_191601_c1 3300050515 Bacteria 1936
322 Ga0495601_0118171 3300053077 Bacteria 1720
323 Ga0495612_0054764 3300053078 Bacteria 1644
324 Ga0495655_0005230 3300053083 Bacteria 2281
325 Ga0495595_0077918 3300053084 Bacteria 1575
326 Ga0501084_0001555 3300054114 Bacteria 18225
327 Ga0501082_0013063 3300060353 Bacteria 7137
328 Ga0466962_0001952 3300061719 Bacteria 9717
329 Ga0466962_0042083 3300061719 Bacteria 2186
330 Ga0530510_0006053 3300061734 Bacteria 8399
331 Ga0070683_100317253
332 Ga0070683_100264100
333 Ga0070690_100040096
334 Ga0070666_10062711
335 Ga0070680_100014237
336 Ga0070682_100289388
337 Ga0070660_100005127
338 Ga0070660_100017554
339 Ga0070689_100015072
340 Ga0070691_10023317
341 Ga0070661_100014396
342 Ga0070661_100158989
343 Ga0070674_100012276
344 Ga0070688_100001303
345 Ga0070688_100255213
346 Ga0070659_100179116
347 Ga0070713_100397241
348 Ga0070710_10001929
349 Ga0070701_10006925
350 Ga0070711_100001795
351 Ga0070705_100006211
352 Ga0070705_100016406
353 Ga0070700_100002064
354 Ga0070694_100034048
355 Ga0070708_100072150
356 Ga0070708_100122996
357 Ga0070708_100126347
358 Ga0070708_100354027
359 Ga0070663_100050916
360 Ga0070678_100005718
361 Ga0070681_10005995
362 Ga0070685_10003638
363 Ga0070706_100008465
364 Ga0070706_100051040
365 Ga0070706_100064481
366 Ga0070707_100003936
367 Ga0070707_100167561
368 Ga0070698_100076892
369 Ga0070698_100083553
370 Ga0070698_100163697
371 Ga0070698_100244137
372 Ga0070699_100023586
373 Ga0070699_100078987
374 Ga0070699_100081245
375 Ga0070699_100124567
376 Ga0070679_100022451
377 Ga0070697_100049140
378 Ga0068853_100003961
379 Ga0070672_100006346
380 Ga0070686_100007827
381 Ga0070695_100037607
382 Ga0070696_100024911
383 Ga0070696_100046368
384 Ga0070693_100052936
385 Ga0070665_100387642
386 Ga0070704_100025827
387 Ga0070704_100295884
388 Ga0068855_100108927
389 Ga0068856_100026813
390 Ga0068856_100102560
391 Ga0070702_100004065
392 Ga0070702_100079848
393 Ga0068852_100010619
394 Ga0068864_100290771
395 Ga0068866_10001820
396 Ga0068861_100066654
397 Ga0068862_100305387
398 Ga0070717_10248413
399 Ga0070715_10028627
400 Ga0070716_100102219
401 Ga0070712_100024682
402 Ga0097621_100126463
403 Ga0068871_100063051
404 Ga0075433_10121620
405 Ga0075434_100015033
406 Ga0068865_100031933
407 Ga0111539_10143880
408 Ga0105245_10020139
409 Ga0105247_10045041
410 Ga0114129_10113934
411 Ga0105243_10013807
412 Ga0105241_10021339
413 Ga0105242_10010733
414 Ga0105248_10022195
415 Ga0105237_10319268
416 Ga0105238_10038137
417 Ga0105249_10001940
418 Ga0105249_10133326
419 Ga0105239_10041862
420 Ga0105246_10030690
421 Ga0157373_10080735
422 Ga0157371_10195277
423 Ga0157370_10060098
424 Ga0157374_10029097
425 Ga0157378_10011798
426 Ga0157378_10300898
427 Ga0163162_10025281
428 Ga0157375_10021124
429 Ga0157375_10080561
430 Ga0157377_10007181
431 Ga0157379_10100402
432 Ga0157376_10002472
433 Ga0207692_10043308
434 Ga0207642_10018620
435 Ga0207680_10149427
436 Ga0207685_10030103
437 Ga0207684_10031037
438 Ga0207684_10080990
439 Ga0207684_10087056
440 Ga0207654_10021547
441 Ga0207707_10026256
442 Ga0207663_10005575
443 Ga0207663_10074155
444 Ga0207660_10256540
445 Ga0207649_10030425
446 Ga0207652_10276386
447 Ga0207646_10075807
448 Ga0207687_10088049
449 Ga0207664_10054691
450 Ga0207706_10013475
451 Ga0207686_10075369
452 Ga0207709_10067669
453 Ga0207669_10056075
454 Ga0207704_10077392
455 Ga0207665_10051396
456 Ga0207691_10003940
457 Ga0207711_10128348
458 Ga0207667_10302819
459 Ga0207651_10110653
460 Ga0207712_10033109
461 Ga0207712_10199727
462 Ga0207668_10184013
463 Ga0207658_10164539
464 Ga0207677_10061541
465 Ga0207639_10200484
466 Ga0207708_10000618
467 Ga0207648_10003274
468 Ga0207676_10108458
469 Ga0207675_100026431
470 Ga0207683_10006342
471 Ga0207698_10049176
472 Ga0207698_10400159
473 Ga0268266_10060125
474 Ga0268265_10100909
475 Ga0307406_10237038
476 Ga0307416_100245890
477 Ga0307415_100017437
478 Ga0373936_0011213
479 Ga0373943_0009716
480 Ga0373946_0065795
481 Ga0373927_0092215
482 Ga0373925_0010897
483 Ga0395899_0020483
484 Ga0395899_0028416
485 Ga0395899_0038085
486 Ga0395899_0066213
487 Ga0395899_0083679
488 Ga0395899_0154886
489 Ga0395899_0190724
490 Ga0395900_0009708
491 Ga0395900_0009837
492 Ga0395900_0016205
493 Ga0395900_0016328
494 Ga0395900_0041307
495 Ga0395900_0050236
496 Ga0395900_0051398
497 Ga0395900_0268558
498 Ga0395900_0273241
499 Ga0395898_0000635
500 Ga0395898_0007862
501 Ga0395898_0009165
502 Ga0395898_0021357
503 Ga0395898_0041309
504 Ga0395898_0068841
505 Ga0395898_0070009
506 Ga0395905_0004382
507 Ga0395905_0007787
508 Ga0395905_0026208
509 Ga0395905_0061059
510 Ga0395905_0118777
511 Ga0395905_0236243
512 Ga0395901_0006552
513 Ga0395901_0010770
514 Ga0395901_0023306
515 Ga0395901_0029071
516 Ga0395901_0030508
517 Ga0395901_0074188
518 Ga0395901_0078184
519 Ga0395901_0086875
520 Ga0395901_0119353
521 Ga0395901_0175847
522 Ga0395901_0289511
523 Ga0451789_0485758
524 Ga0451802_0272488
525 Ga0451807_1518392
526 Ga0451839_0731987
527 Ga0451849_0215714
528 Ga0451851_0646240
529 Ga0450907_002712
530 Ga0450918_025294
531 Ga0466965_0093714
532 Ga0466966_0061757
533 Ga0466961_0009673
534 Ga0466961_0010565
535 Ga0466961_0072646
536 Ga0466963_0010949
537 Ga0466963_0015999
538 Ga0466963_0020122
539 Ga0466963_0066788
540 Ga0466963_0103013
541 Ga0466963_0128359
542 Ga0466971_0000164
543 Ga0466968_0005218
544 Ga0466968_0044933
545 Ga0466970_0029095
546 Ga0466957_0001579
547 Ga0466957_0089087
548 Ga0466959_0010957
549 Ga0466959_0020338
550 Ga0466958_0002223
551 Ga0466967_0012223
552 Ga0466967_0021142
553 Ga0466967_0115753
554 Ga0466967_0115938
555 Ga0466967_0258831
556 Ga0466967_0339380
557 Ga0466967_0482054
558 Ga0495582_0007394
559 Ga0495605_0015769
560 Ga0495594_0011199
561 Ga0495665_0065085
562 Ga0495609_0037386
563 Ga0495645_0195788
564 Ga0495588_0112919
565 Ga0495624_0150810
566 Ga0495581_0015894
567 Ga0495636_0064627
568 Ga0495674_0355093
569 Ga0495676_0148258
570 Ga0495677_0010456
571 Ga0496100_0009564
572 Ga0496100_0094871
573 Ga0496101_0001521
574 Ga0496101_0032062
575 Ga0496101_0046508
576 Ga0496102_0001739
577 Ga0496102_0281751
578 Ga0496103_0061626
579 Ga0496104_0002003
580 Ga0496104_0014177
581 Ga0496104_0054324
582 Ga0496104_0229348
583 Ga0496105_0017476
584 Ga0496105_0029997
585 Ga0496105_0060475
586 Ga0496105_0069413
587 Ga0496105_0076646
588 Ga0496106_0016849
589 Ga0496106_0247996
590 Ga0496107_0011699
591 Ga0496107_0016881
592 Ga0496107_0215988
593 Ga0496108_0003059
594 Ga0496108_0003974
595 Ga0496108_0044422
596 Ga0496108_0052664
597 Ga0496109_0000521
598 Ga0496109_0005757
599 Ga0496109_0015942
600 Ga0496109_0228519
601 Ga0496110_0010929
602 Ga0496110_0064106
603 Ga0496110_0094235
604 Ga0496110_0183652
605 Ga0496110_0200880
606 Ga0496111_0015340
607 Ga0496111_0197686
608 Ga0496112_0018357
609 Ga0496112_0055821
610 Ga0496112_0210655
611 Ga0496113_0044582
612 Ga0496113_0173897
613 Ga0496114_0001315
614 Ga0496114_0002127
615 Ga0496114_0087588
616 Ga0496114_0130530
617 Ga0496115_0001991
618 Ga0496115_0016391
619 Ga0496115_0184852
620 Ga0501036_0016282
621 Ga0501037_0010930
622 Ga0501038_0006451
623 Ga0501039_0001803
624 Ga0501040_0001040
625 Ga0501040_0076017
626 Ga0501041_0002023
627 Ga0501042_0007183
628 Ga0501042_0244133
629 Ga0501043_0160237
630 Ga0501046_0007613
631 Ga0501048_0027027
632 Ga0501067_0097733
633 Ga0501068_0266143
634 Ga0501071_0019556
635 Ga0501072_0033959
636 Ga0501072_0039041
637 Ga0501074_0009173
638 Ga0501075_0001777
639 Ga0501076_0001047
640 Ga0501077_0134598
641 Ga0501079_0025874
642 Ga0501080_0176926
643 Ga0501081_0056164
644 Ga0501081_0181637
645 Ga0501045_0000378
646 nmdc:mga00v17_130187_c1
647 nmdc:mga0yw44_119979_c1
648 nmdc:mga05p37_7612_c1
649 nmdc:mga08y16_366578_c1
650 nmdc:mga0n895_36697_c1
651 nmdc:mga0a205_191601_c1
652 Ga0495601_0118171
653 Ga0495612_0054764
654 Ga0495655_0005230
655 Ga0495595_0077918
656 Ga0501084_0001555
657 Ga0501082_0013063
658 Ga0466962_0001952
659 Ga0466962_0042083
660 Ga0530510_0006053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

101

348

0.99

PF02912

Phe_tRNA-synt_N

Aminoacyl tRNA synthetase class II, N-terminal domain

37

98

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8255 90 336
4p73-assembly1.cif.gz_C phers in complex with compound 1a 0.8222 90 336
7n8y-assembly1.cif.gz_C oxidized phers g318w from salmonella enterica serovar typhimurium 0.815 90 336
6p24-assembly1.cif.gz_A escherichia coli trna synthetase 0.8127 90 336
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8126 90 336
ID Description Score Start End Superfamily
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8619 104 336 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8546 104 336 3.30.930.10
3vqxB02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8178 104 323 3.30.930.10
3l4gO01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.806 105 323 3.30.930.10
2rhsC00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.7835 77 336 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A0G0SSS7-F1-model_v4 Phenylalanyl-tRNA synthetase subunit alpha 0.9308 212 327 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A2G9YGH2-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9241 191 327 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A645B5P2-F1-model_v4 Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) 0.9156 180 326 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A3D1QB45-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9132 199 317 GO:0000049
GO:0004826
GO:0005524
GO:0005737
GO:0006432
GO:0016740
AF-A0A0G1R7C7-F1-model_v4 Phenylalanine-tRNA ligase alpha subunit 0.9027 165 327 GO:0000049
GO:0004826
GO:0005524
GO:0043039

Map