F409926

General Info

Members Datasets Scaffolds Average Seq Length
330 150 660 184

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10140305|rootL2_101403053
Length 186
Sequence MRIISGTYRGRVLKSPSGHKTRPTSDRLRETLFNVLQTKIDPETRFLDLCAGTGAIGIEALSRGAHFATFVDKSRRACALIEENLDLLEIPENQTEVFQNSADDFLRRLGEKNVGWDIIFFDPPYQEDYSKVIYLLADGDVNLLKTDGIFIAEHHAKNILPDAVGELRRWRILKQGETHLSFYEKN

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
138 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
139 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
147 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
148 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.61
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 29.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10140305 3300003322 Bacteria 1885
2 LJQas_1002263 3300000549 Bacteria 2711
3 Ga0065704_10169554 3300005289 Unclassified 1300
4 Ga0065704_10185201 3300005289 Unclassified 1216
5 Ga0065704_10197576 3300005289 Bacteria 1161
6 Ga0065715_10314626 3300005293 Unclassified 1014
7 Ga0070658_10000547 3300005327 Bacteria 32575
8 Ga0070676_10156946 3300005328 Unclassified 1461
9 Ga0070683_100358315 3300005329 Bacteria 1389
10 Ga0070690_100097837 3300005330 Unclassified 1941
11 Ga0070670_100037148 3300005331 Bacteria 4191
12 Ga0070670_100042961 3300005331 Bacteria 3887
13 Ga0070670_100193728 3300005331 Bacteria 1766
14 Ga0070677_10175583 3300005333 Bacteria 1016
15 Ga0068868_100039633 3300005338 Bacteria 3661
16 Ga0070689_100009504 3300005340 Bacteria 6894
17 Ga0070689_100281069 3300005340 Unclassified 1381
18 Ga0070689_100670395 3300005340 Bacteria 904
19 Ga0070692_10122396 3300005345 Unclassified 1452
20 Ga0070668_100657277 3300005347 Bacteria 921
21 Ga0070675_100078062 3300005354 Bacteria 2757
22 Ga0070675_100085237 3300005354 Bacteria 2639
23 Ga0070675_100315235 3300005354 Bacteria 1381
24 Ga0070675_100537272 3300005354 Bacteria 1056
25 Ga0070675_100834969 3300005354 Bacteria 843
26 Ga0070671_100058785 3300005355 Bacteria 3199
27 Ga0070671_100063635 3300005355 Bacteria 3072
28 Ga0070671_100345641 3300005355 Bacteria 1269
29 Ga0070674_100067499 3300005356 Bacteria 2516
30 Ga0070673_100057417 3300005364 Bacteria 3075
31 Ga0070673_100586439 3300005364 Unclassified 1016
32 Ga0070673_100606435 3300005364 Unclassified 999
33 Ga0070673_100674003 3300005364 Unclassified 948
34 Ga0070659_100894957 3300005366 Bacteria 775
35 Ga0070667_100214465 3300005367 Bacteria 1712
36 Ga0070708_100369924 3300005445 Bacteria 1351
37 Ga0070678_100026904 3300005456 Bacteria 3896
38 Ga0070678_100426384 3300005456 Unclassified 1157
39 Ga0070662_100018456 3300005457 Bacteria 4719
40 Ga0070662_100869253 3300005457 Unclassified 768
41 Ga0070681_10030660 3300005458 Bacteria 5396
42 Ga0070681_10036747 3300005458 Bacteria 4918
43 Ga0068867_100576812 3300005459 Unclassified 978
44 Ga0070685_10460524 3300005466 Unclassified 893
45 Ga0070685_10482900 3300005466 Bacteria 874
46 Ga0070698_100922326 3300005471 Bacteria 819
47 Ga0070684_100716572 3300005535 Bacteria 933
48 Ga0068853_100007799 3300005539 Bacteria 8584
49 Ga0068853_100125915 3300005539 Bacteria 2289
50 Ga0068853_100266963 3300005539 Bacteria 1575
51 Ga0070672_100155040 3300005543 Bacteria 1897
52 Ga0070672_100219823 3300005543 Unclassified 1593
53 Ga0070672_100756490 3300005543 Unclassified 853
54 Ga0070686_101041351 3300005544 Bacteria 673
55 Ga0070693_100081618 3300005547 Unclassified 1929
56 Ga0070665_100388978 3300005548 Bacteria 1402
57 Ga0070665_101458727 3300005548 Unclassified 693
58 Ga0070704_100174858 3300005549 Unclassified 1711
59 Ga0070704_100334976 3300005549 Unclassified 1272
60 Ga0068855_100030194 3300005563 Bacteria 6483
61 Ga0068855_100424528 3300005563 Unclassified 1454
62 Ga0068855_100450254 3300005563 Unclassified 1405
63 Ga0070664_100002024 3300005564 Bacteria 16250
64 Ga0070664_100302046 3300005564 Unclassified 1447
65 Ga0070664_101176347 3300005564 Unclassified 723
66 Ga0068857_100038742 3300005577 Bacteria 4220
67 Ga0068857_100814997 3300005577 Unclassified 892
68 Ga0068854_100079410 3300005578 Unclassified 2419
69 Ga0068854_100095893 3300005578 Bacteria 2215
70 Ga0068854_100217515 3300005578 Bacteria 1510
71 Ga0068856_100846597 3300005614 Bacteria 934
72 Ga0070702_100051687 3300005615 Bacteria 2354
73 Ga0068852_100079483 3300005616 Bacteria 2905
74 Ga0068852_100219019 3300005616 Unclassified 1809
75 Ga0068852_100419144 3300005616 Unclassified 1320
76 Ga0068852_100478408 3300005616 Bacteria 1237
77 Ga0068852_100704928 3300005616 Bacteria 1020
78 Ga0068859_100061421 3300005617 Bacteria 3786
79 Ga0068859_100061780 3300005617 Bacteria 3775
80 Ga0068864_100017852 3300005618 Bacteria 5918
81 Ga0068864_100050694 3300005618 Bacteria 3574
82 Ga0068864_100160632 3300005618 Bacteria 2042
83 Ga0068863_100399251 3300005841 Bacteria 1344
84 Ga0068863_101093914 3300005841 Unclassified 801
85 Ga0068858_100067333 3300005842 Bacteria 3317
86 Ga0068858_100534444 3300005842 Bacteria 1134
87 Ga0068860_100075163 3300005843 Bacteria 3213
88 Ga0068860_100129944 3300005843 Bacteria 2416
89 Ga0068860_101075227 3300005843 Unclassified 823
90 Ga0068860_101826230 3300005843 Unclassified 629
91 Ga0068862_100076857 3300005844 Bacteria 2890
92 Ga0068862_100123571 3300005844 Bacteria 2283
93 Ga0068862_100156970 3300005844 Unclassified 2029
94 Ga0068862_100290587 3300005844 Bacteria 1501
95 Ga0068862_100479000 3300005844 Bacteria 1178
96 Ga0097621_100118175 3300006237 Bacteria 2247
97 Ga0097621_100153696 3300006237 Bacteria 1974
98 Ga0097621_100657085 3300006237 Bacteria 962
99 Ga0068865_100888272 3300006881 Bacteria 774
100 Ga0097620_100061423 3300006931 Bacteria 3786
101 Ga0097620_100061780 3300006931 Bacteria 3775
102 Ga0105240_10052248 3300009093 Bacteria 5138
103 Ga0105240_10606899 3300009093 Bacteria 1204
104 Ga0111539_10145679 3300009094 Bacteria 2773
105 Ga0111539_10173335 3300009094 Bacteria 2520
106 Ga0111539_11207053 3300009094 Bacteria 879
107 Ga0105245_10148380 3300009098 Bacteria 2215
108 Ga0105247_10020233 3300009101 Bacteria 4002
109 Ga0105247_10034340 3300009101 Bacteria 3089
110 Ga0114129_10665103 3300009147 Unclassified 1343
111 Ga0105241_10039729 3300009174 Bacteria 3550
112 Ga0105241_10055830 3300009174 Bacteria 3026
113 Ga0105242_11817560 3300009176 Unclassified 648
114 Ga0105248_10214552 3300009177 Bacteria 2168
115 Ga0105248_10256210 3300009177 Bacteria 1970
116 Ga0105248_10441165 3300009177 Bacteria 1466
117 Ga0105237_10023727 3300009545 Bacteria 6280
118 Ga0105238_10342377 3300009551 Unclassified 1483
119 Ga0105249_10006592 3300009553 Bacteria 10103
120 Ga0105249_10048238 3300009553 Bacteria 3883
121 Ga0105249_10119839 3300009553 Bacteria 2499
122 Ga0105249_10218382 3300009553 Bacteria 1875
123 Ga0105249_10960908 3300009553 Bacteria 922
124 Ga0105249_10962043 3300009553 Bacteria 922
125 Ga0105249_11005254 3300009553 Bacteria 903
126 Ga0105239_10010922 3300010375 Bacteria 10144
127 Ga0105239_10533386 3300010375 Unclassified 1336
128 Ga0157373_10111103 3300013100 Bacteria 1927
129 Ga0157373_10332135 3300013100 Unclassified 1083
130 Ga0157371_10839495 3300013102 Bacteria 694
131 Ga0157370_10195652 3300013104 Unclassified 1876
132 Ga0157370_10247044 3300013104 Bacteria 1651
133 Ga0157369_10097158 3300013105 Bacteria 3142
134 Ga0157374_10080558 3300013296 Bacteria 3089
135 Ga0157378_11175274 3300013297 Unclassified 806
136 Ga0157378_11230243 3300013297 Bacteria 789
137 Ga0163162_10096072 3300013306 Unclassified 3051
138 Ga0163162_10150662 3300013306 Bacteria 2443
139 Ga0163162_11014283 3300013306 Unclassified 939
140 Ga0163162_11018386 3300013306 Bacteria 937
141 Ga0163162_11443397 3300013306 Bacteria 783
142 Ga0157372_10069898 3300013307 Bacteria 3949
143 Ga0157372_10164302 3300013307 Bacteria 2567
144 Ga0157372_10450329 3300013307 Unclassified 1500
145 Ga0157375_10017778 3300013308 Bacteria 6429
146 Ga0157375_10310776 3300013308 Bacteria 1740
147 Ga0157375_10328234 3300013308 Bacteria 1695
148 Ga0157375_10474573 3300013308 Unclassified 1416
149 Ga0163163_10052325 3300014325 Bacteria 4029
150 Ga0163163_10123055 3300014325 Unclassified 2629
151 Ga0163163_10174015 3300014325 Bacteria 2199
152 Ga0163163_10191952 3300014325 Bacteria 2091
153 Ga0163163_10374284 3300014325 Bacteria 1481
154 Ga0163163_11269663 3300014325 Bacteria 799
155 Ga0157380_10004972 3300014326 Bacteria 9258
156 Ga0157380_10026863 3300014326 Bacteria 4373
157 Ga0157380_10205596 3300014326 Bacteria 1750
158 Ga0157376_10525039 3300014969 Unclassified 1167
159 Ga0157376_10667013 3300014969 Unclassified 1042
160 Ga0163161_10002148 3300017792 Bacteria 14220
161 Ga0163161_10034408 3300017792 Bacteria 3625
162 Ga0163161_10506657 3300017792 Unclassified 984
163 Ga0163161_10605947 3300017792 Bacteria 903
164 Ga0163161_10708329 3300017792 Unclassified 839
165 Ga0207656_10299986 3300025321 Unclassified 795
166 Ga0207710_10040247 3300025900 Bacteria 2071
167 Ga0207680_10019757 3300025903 Unclassified 3610
168 Ga0207643_10036774 3300025908 Bacteria 2746
169 Ga0207654_10041763 3300025911 Bacteria 2592
170 Ga0207707_10014044 3300025912 Bacteria 6981
171 Ga0207671_10149999 3300025914 Unclassified 1801
172 Ga0207660_10044910 3300025917 Bacteria 3110
173 Ga0207660_10787737 3300025917 Unclassified 776
174 Ga0207662_10214589 3300025918 Bacteria 1251
175 Ga0207649_10286085 3300025920 Bacteria 1200
176 Ga0207649_10601575 3300025920 Unclassified 846
177 Ga0207650_10010410 3300025925 Bacteria 6375
178 Ga0207650_10018156 3300025925 Bacteria 4933
179 Ga0207650_10191936 3300025925 Unclassified 1632
180 Ga0207659_10064225 3300025926 Bacteria 2656
181 Ga0207659_10072049 3300025926 Bacteria 2525
182 Ga0207659_10072753 3300025926 Bacteria 2514
183 Ga0207644_10263114 3300025931 Unclassified 1380
184 Ga0207644_10533890 3300025931 Unclassified 970
185 Ga0207706_10032456 3300025933 Bacteria 4650
186 Ga0207670_10029505 3300025936 Unclassified 3495
187 Ga0207670_10764714 3300025936 Unclassified 803
188 Ga0207669_10157669 3300025937 Bacteria 1599
189 Ga0207669_10397722 3300025937 Unclassified 1078
190 Ga0207704_10669543 3300025938 Bacteria 856
191 Ga0207691_10027232 3300025940 Bacteria 5362
192 Ga0207711_10061188 3300025941 Bacteria 3246
193 Ga0207711_10623732 3300025941 Bacteria 1006
194 Ga0207689_10052633 3300025942 Bacteria 3354
195 Ga0207661_10199683 3300025944 Bacteria 1758
196 Ga0207679_10344955 3300025945 Unclassified 1296
197 Ga0207679_10410332 3300025945 Unclassified 1193
198 Ga0207679_10868912 3300025945 Unclassified 824
199 Ga0207667_10070647 3300025949 Bacteria 3633
200 Ga0207667_10332612 3300025949 Bacteria 1551
201 Ga0207651_10315160 3300025960 Bacteria 1306
202 Ga0207712_10041086 3300025961 Bacteria 3177
203 Ga0207712_10045665 3300025961 Bacteria 3035
204 Ga0207712_10269381 3300025961 Bacteria 1385
205 Ga0207640_10173837 3300025981 Bacteria 1608
206 Ga0207640_10235615 3300025981 Unclassified 1411
207 Ga0207640_10390653 3300025981 Bacteria 1130
208 Ga0207640_10538626 3300025981 Bacteria 979
209 Ga0207658_10063443 3300025986 Bacteria 2769
210 Ga0207658_10500655 3300025986 Unclassified 1082
211 Ga0207703_10713216 3300026035 Bacteria 954
212 Ga0207703_10794253 3300026035 Bacteria 903
213 Ga0207703_11057670 3300026035 Bacteria 779
214 Ga0207639_10022623 3300026041 Bacteria 4529
215 Ga0207639_10080927 3300026041 Bacteria 2571
216 Ga0207678_10388654 3300026067 Bacteria 1207
217 Ga0207702_10931067 3300026078 Bacteria 861
218 Ga0207641_10174554 3300026088 Bacteria 1964
219 Ga0207641_10346253 3300026088 Bacteria 1415
220 Ga0207641_11465798 3300026088 Unclassified 684
221 Ga0207648_10096195 3300026089 Unclassified 2591
222 Ga0207648_10921870 3300026089 Unclassified 817
223 Ga0207676_10009884 3300026095 Bacteria 6788
224 Ga0207676_10053283 3300026095 Bacteria 3166
225 Ga0207676_10185441 3300026095 Bacteria 1826
226 Ga0207676_10186082 3300026095 Bacteria 1823
227 Ga0207676_10277015 3300026095 Bacteria 1521
228 Ga0207676_10403847 3300026095 Bacteria 1277
229 Ga0207674_10017178 3300026116 Bacteria 7897
230 Ga0207683_10011568 3300026121 Bacteria 7534
231 Ga0207683_11273920 3300026121 Bacteria 681
232 Ga0207698_10188572 3300026142 Unclassified 1834
233 Ga0268265_10157609 3300028380 Bacteria 1923
234 Ga0268265_10495355 3300028380 Bacteria 1150
235 Ga0268265_10506114 3300028380 Bacteria 1139
236 Ga0268264_10017498 3300028381 Bacteria 5869
237 Ga0307408_100003418 3300031548 Bacteria 10887
238 Ga0307408_100194768 3300031548 Unclassified 1636
239 Ga0307408_100205785 3300031548 Unclassified 1596
240 Ga0307408_100297851 3300031548 Unclassified 1350
241 Ga0307408_100325119 3300031548 Bacteria 1297
242 Ga0307405_10013099 3300031731 Bacteria 4414
243 Ga0307405_10092289 3300031731 Unclassified 2008
244 Ga0307405_10136477 3300031731 Unclassified 1704
245 Ga0307405_10206858 3300031731 Unclassified 1430
246 Ga0307405_10388850 3300031731 Unclassified 1088
247 Ga0307413_10000243 3300031824 Bacteria 16331
248 Ga0307413_10024581 3300031824 Bacteria 3287
249 Ga0307413_10055393 3300031824 Bacteria 2412
250 Ga0307413_10072763 3300031824 Bacteria 2170
251 Ga0307413_10174048 3300031824 Unclassified 1527
252 Ga0307413_10214140 3300031824 Bacteria 1402
253 Ga0307413_10273167 3300031824 Unclassified 1267
254 Ga0307410_10000871 3300031852 Bacteria 12869
255 Ga0307410_10005349 3300031852 Bacteria 6785
256 Ga0307410_10058892 3300031852 Bacteria 2620
257 Ga0307410_10436313 3300031852 Bacteria 1065
258 Ga0307406_10002191 3300031901 Bacteria 10635
259 Ga0307406_10022604 3300031901 Bacteria 3733
260 Ga0307406_10046058 3300031901 Bacteria 2742
261 Ga0307406_10048149 3300031901 Unclassified 2691
262 Ga0307406_10069553 3300031901 Unclassified 2302
263 Ga0307406_10220798 3300031901 Bacteria 1408
264 Ga0307406_10281828 3300031901 Bacteria 1268
265 Ga0307406_10290323 3300031901 Bacteria 1252
266 Ga0307406_10344166 3300031901 Bacteria 1162
267 Ga0307406_10549706 3300031901 Unclassified 944
268 Ga0307406_10560461 3300031901 Unclassified 936
269 Ga0307407_10006634 3300031903 Bacteria 5169
270 Ga0307407_10098854 3300031903 Bacteria 1806
271 Ga0307407_10120323 3300031903 Bacteria 1663
272 Ga0307407_10276567 3300031903 Unclassified 1161
273 Ga0307412_10001914 3300031911 Bacteria 11501
274 Ga0307412_10364428 3300031911 Bacteria 1165
275 Ga0307412_10460037 3300031911 Bacteria 1050
276 Ga0307412_11159080 3300031911 Unclassified 690
277 Ga0307409_100000356 3300031995 Bacteria 19078
278 Ga0307409_100043997 3300031995 Bacteria 3359
279 Ga0307409_100105459 3300031995 Bacteria 2350
280 Ga0307409_100125725 3300031995 Bacteria 2180
281 Ga0307409_100243024 3300031995 Bacteria 1640
282 Ga0307409_100785419 3300031995 Bacteria 959
283 Ga0307409_100834928 3300031995 Bacteria 931
284 Ga0307409_101180107 3300031995 Bacteria 788
285 Ga0307416_100004134 3300032002 Bacteria 8694
286 Ga0307416_100180443 3300032002 Bacteria 1978
287 Ga0307416_101113966 3300032002 Bacteria 894
288 Ga0307416_101387868 3300032002 Unclassified 808
289 Ga0307414_10015868 3300032004 Bacteria 4561
290 Ga0307414_10198092 3300032004 Bacteria 1631
291 Ga0307414_10469967 3300032004 Bacteria 1107
292 Ga0307414_11213868 3300032004 Unclassified 698
293 Ga0307411_10003527 3300032005 Bacteria 7279
294 Ga0307411_10047870 3300032005 Bacteria 2767
295 Ga0307411_10104776 3300032005 Bacteria 2009
296 Ga0307411_10339499 3300032005 Unclassified 1220
297 Ga0307411_10431812 3300032005 Bacteria 1097
298 Ga0307415_100032156 3300032126 Bacteria 3390
299 Ga0307415_100100509 3300032126 Bacteria 2119
300 Ga0307415_100199533 3300032126 Bacteria 1586
301 Ga0307415_100361819 3300032126 Unclassified 1225
302 Ga0307415_100449059 3300032126 Unclassified 1114
303 Ga0395900_0239688 3300037418 Bacteria 1820
304 Ga0395905_0734945 3300037471 Bacteria 889
305 Ga0395901_0218501 3300038443 Bacteria 1993
306 Ga0451802_0001756 3300041460 Unclassified 824
307 Ga0451807_1982982 3300041486 Bacteria 882
308 Ga0495629_0295455 3300046459 Bacteria 1110
309 Ga0495621_0204625 3300046539 Unclassified 795
310 Ga0495621_0230914 3300046539 Unclassified 751
311 Ga0495633_0346411 3300046558 Unclassified 673
312 Ga0495668_0003521 3300046616 Bacteria 11662
313 Ga0501072_0009953 3300049588 Bacteria 7231
314 Ga0501198_026577 3300049649 Bacteria 946
315 Ga0501209_093120 3300049656 Bacteria 878
316 Ga0501209_119265 3300049656 Unclassified 782
317 Ga0501209_139301 3300049656 Unclassified 727
318 Ga0501224_015670 3300049664 Unclassified 1124
319 Ga0501227_044945 3300049665 Bacteria 1101
320 Ga0501235_092254 3300049669 Bacteria 732
321 Ga0501249_027096 3300049679 Unclassified 1268
322 Ga0501249_119413 3300049679 Unclassified 643
323 Ga0501257_019334 3300049686 Bacteria 1593
324 Ga0501221_009311 3300049704 Bacteria 1722
325 Ga0501225_0019378 3300049705 Bacteria 1883
326 Ga0501263_034135 3300049760 Unclassified 728
327 Ga0501266_009932 3300049763 Bacteria 1207
328 Ga0501268_037368 3300049765 Bacteria 903
329 nmdc:mga08y16_873980_c1 3300050511 Bacteria 887
330 Ga0500577_0280147 3300053142 Bacteria 726
331 rootL2_10140305
332 LJQas_1002263
333 Ga0065704_10169554
334 Ga0065704_10185201
335 Ga0065704_10197576
336 Ga0065715_10314626
337 Ga0070658_10000547
338 Ga0070676_10156946
339 Ga0070683_100358315
340 Ga0070690_100097837
341 Ga0070670_100037148
342 Ga0070670_100042961
343 Ga0070670_100193728
344 Ga0070677_10175583
345 Ga0068868_100039633
346 Ga0070689_100009504
347 Ga0070689_100281069
348 Ga0070689_100670395
349 Ga0070692_10122396
350 Ga0070668_100657277
351 Ga0070675_100078062
352 Ga0070675_100085237
353 Ga0070675_100315235
354 Ga0070675_100537272
355 Ga0070675_100834969
356 Ga0070671_100058785
357 Ga0070671_100063635
358 Ga0070671_100345641
359 Ga0070674_100067499
360 Ga0070673_100057417
361 Ga0070673_100586439
362 Ga0070673_100606435
363 Ga0070673_100674003
364 Ga0070659_100894957
365 Ga0070667_100214465
366 Ga0070708_100369924
367 Ga0070678_100026904
368 Ga0070678_100426384
369 Ga0070662_100018456
370 Ga0070662_100869253
371 Ga0070681_10030660
372 Ga0070681_10036747
373 Ga0068867_100576812
374 Ga0070685_10460524
375 Ga0070685_10482900
376 Ga0070698_100922326
377 Ga0070684_100716572
378 Ga0068853_100007799
379 Ga0068853_100125915
380 Ga0068853_100266963
381 Ga0070672_100155040
382 Ga0070672_100219823
383 Ga0070672_100756490
384 Ga0070686_101041351
385 Ga0070693_100081618
386 Ga0070665_100388978
387 Ga0070665_101458727
388 Ga0070704_100174858
389 Ga0070704_100334976
390 Ga0068855_100030194
391 Ga0068855_100424528
392 Ga0068855_100450254
393 Ga0070664_100002024
394 Ga0070664_100302046
395 Ga0070664_101176347
396 Ga0068857_100038742
397 Ga0068857_100814997
398 Ga0068854_100079410
399 Ga0068854_100095893
400 Ga0068854_100217515
401 Ga0068856_100846597
402 Ga0070702_100051687
403 Ga0068852_100079483
404 Ga0068852_100219019
405 Ga0068852_100419144
406 Ga0068852_100478408
407 Ga0068852_100704928
408 Ga0068859_100061421
409 Ga0068859_100061780
410 Ga0068864_100017852
411 Ga0068864_100050694
412 Ga0068864_100160632
413 Ga0068863_100399251
414 Ga0068863_101093914
415 Ga0068858_100067333
416 Ga0068858_100534444
417 Ga0068860_100075163
418 Ga0068860_100129944
419 Ga0068860_101075227
420 Ga0068860_101826230
421 Ga0068862_100076857
422 Ga0068862_100123571
423 Ga0068862_100156970
424 Ga0068862_100290587
425 Ga0068862_100479000
426 Ga0097621_100118175
427 Ga0097621_100153696
428 Ga0097621_100657085
429 Ga0068865_100888272
430 Ga0097620_100061423
431 Ga0097620_100061780
432 Ga0105240_10052248
433 Ga0105240_10606899
434 Ga0111539_10145679
435 Ga0111539_10173335
436 Ga0111539_11207053
437 Ga0105245_10148380
438 Ga0105247_10020233
439 Ga0105247_10034340
440 Ga0114129_10665103
441 Ga0105241_10039729
442 Ga0105241_10055830
443 Ga0105242_11817560
444 Ga0105248_10214552
445 Ga0105248_10256210
446 Ga0105248_10441165
447 Ga0105237_10023727
448 Ga0105238_10342377
449 Ga0105249_10006592
450 Ga0105249_10048238
451 Ga0105249_10119839
452 Ga0105249_10218382
453 Ga0105249_10960908
454 Ga0105249_10962043
455 Ga0105249_11005254
456 Ga0105239_10010922
457 Ga0105239_10533386
458 Ga0157373_10111103
459 Ga0157373_10332135
460 Ga0157371_10839495
461 Ga0157370_10195652
462 Ga0157370_10247044
463 Ga0157369_10097158
464 Ga0157374_10080558
465 Ga0157378_11175274
466 Ga0157378_11230243
467 Ga0163162_10096072
468 Ga0163162_10150662
469 Ga0163162_11014283
470 Ga0163162_11018386
471 Ga0163162_11443397
472 Ga0157372_10069898
473 Ga0157372_10164302
474 Ga0157372_10450329
475 Ga0157375_10017778
476 Ga0157375_10310776
477 Ga0157375_10328234
478 Ga0157375_10474573
479 Ga0163163_10052325
480 Ga0163163_10123055
481 Ga0163163_10174015
482 Ga0163163_10191952
483 Ga0163163_10374284
484 Ga0163163_11269663
485 Ga0157380_10004972
486 Ga0157380_10026863
487 Ga0157380_10205596
488 Ga0157376_10525039
489 Ga0157376_10667013
490 Ga0163161_10002148
491 Ga0163161_10034408
492 Ga0163161_10506657
493 Ga0163161_10605947
494 Ga0163161_10708329
495 Ga0207656_10299986
496 Ga0207710_10040247
497 Ga0207680_10019757
498 Ga0207643_10036774
499 Ga0207654_10041763
500 Ga0207707_10014044
501 Ga0207671_10149999
502 Ga0207660_10044910
503 Ga0207660_10787737
504 Ga0207662_10214589
505 Ga0207649_10286085
506 Ga0207649_10601575
507 Ga0207650_10010410
508 Ga0207650_10018156
509 Ga0207650_10191936
510 Ga0207659_10064225
511 Ga0207659_10072049
512 Ga0207659_10072753
513 Ga0207644_10263114
514 Ga0207644_10533890
515 Ga0207706_10032456
516 Ga0207670_10029505
517 Ga0207670_10764714
518 Ga0207669_10157669
519 Ga0207669_10397722
520 Ga0207704_10669543
521 Ga0207691_10027232
522 Ga0207711_10061188
523 Ga0207711_10623732
524 Ga0207689_10052633
525 Ga0207661_10199683
526 Ga0207679_10344955
527 Ga0207679_10410332
528 Ga0207679_10868912
529 Ga0207667_10070647
530 Ga0207667_10332612
531 Ga0207651_10315160
532 Ga0207712_10041086
533 Ga0207712_10045665
534 Ga0207712_10269381
535 Ga0207640_10173837
536 Ga0207640_10235615
537 Ga0207640_10390653
538 Ga0207640_10538626
539 Ga0207658_10063443
540 Ga0207658_10500655
541 Ga0207703_10713216
542 Ga0207703_10794253
543 Ga0207703_11057670
544 Ga0207639_10022623
545 Ga0207639_10080927
546 Ga0207678_10388654
547 Ga0207702_10931067
548 Ga0207641_10174554
549 Ga0207641_10346253
550 Ga0207641_11465798
551 Ga0207648_10096195
552 Ga0207648_10921870
553 Ga0207676_10009884
554 Ga0207676_10053283
555 Ga0207676_10185441
556 Ga0207676_10186082
557 Ga0207676_10277015
558 Ga0207676_10403847
559 Ga0207674_10017178
560 Ga0207683_10011568
561 Ga0207683_11273920
562 Ga0207698_10188572
563 Ga0268265_10157609
564 Ga0268265_10495355
565 Ga0268265_10506114
566 Ga0268264_10017498
567 Ga0307408_100003418
568 Ga0307408_100194768
569 Ga0307408_100205785
570 Ga0307408_100297851
571 Ga0307408_100325119
572 Ga0307405_10013099
573 Ga0307405_10092289
574 Ga0307405_10136477
575 Ga0307405_10206858
576 Ga0307405_10388850
577 Ga0307413_10000243
578 Ga0307413_10024581
579 Ga0307413_10055393
580 Ga0307413_10072763
581 Ga0307413_10174048
582 Ga0307413_10214140
583 Ga0307413_10273167
584 Ga0307410_10000871
585 Ga0307410_10005349
586 Ga0307410_10058892
587 Ga0307410_10436313
588 Ga0307406_10002191
589 Ga0307406_10022604
590 Ga0307406_10046058
591 Ga0307406_10048149
592 Ga0307406_10069553
593 Ga0307406_10220798
594 Ga0307406_10281828
595 Ga0307406_10290323
596 Ga0307406_10344166
597 Ga0307406_10549706
598 Ga0307406_10560461
599 Ga0307407_10006634
600 Ga0307407_10098854
601 Ga0307407_10120323
602 Ga0307407_10276567
603 Ga0307412_10001914
604 Ga0307412_10364428
605 Ga0307412_10460037
606 Ga0307412_11159080
607 Ga0307409_100000356
608 Ga0307409_100043997
609 Ga0307409_100105459
610 Ga0307409_100125725
611 Ga0307409_100243024
612 Ga0307409_100785419
613 Ga0307409_100834928
614 Ga0307409_101180107
615 Ga0307416_100004134
616 Ga0307416_100180443
617 Ga0307416_101113966
618 Ga0307416_101387868
619 Ga0307414_10015868
620 Ga0307414_10198092
621 Ga0307414_10469967
622 Ga0307414_11213868
623 Ga0307411_10003527
624 Ga0307411_10047870
625 Ga0307411_10104776
626 Ga0307411_10339499
627 Ga0307411_10431812
628 Ga0307415_100032156
629 Ga0307415_100100509
630 Ga0307415_100199533
631 Ga0307415_100361819
632 Ga0307415_100449059
633 Ga0395900_0239688
634 Ga0395905_0734945
635 Ga0395901_0218501
636 Ga0451802_0001756
637 Ga0451807_1982982
638 Ga0495629_0295455
639 Ga0495621_0204625
640 Ga0495621_0230914
641 Ga0495633_0346411
642 Ga0495668_0003521
643 Ga0501072_0009953
644 Ga0501198_026577
645 Ga0501209_093120
646 Ga0501209_119265
647 Ga0501209_139301
648 Ga0501224_015670
649 Ga0501227_044945
650 Ga0501235_092254
651 Ga0501249_027096
652 Ga0501249_119413
653 Ga0501257_019334
654 Ga0501221_009311
655 Ga0501225_0019378
656 Ga0501263_034135
657 Ga0501266_009932
658 Ga0501268_037368
659 nmdc:mga08y16_873980_c1
660 Ga0500577_0280147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

1

184

0.95

PF05175

MTS

Methyltransferase small domain

17

170

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8939 29 184
2ift-assembly2.cif.gz_B crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102. 0.863 23 183
2ift-assembly2.cif.gz_B crystal structure of putative methylase hi0767 from haemophilus influenzae. nesg target ir102. 0.8484 23 183
2esr-assembly1.cif.gz_B conserved hypothetical protein- streptococcus pyogenes 0.8475 29 184
7rc2-assembly1.cif.gz_A aeronamide n-methyltransferase, aere 0.8414 30 153
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9578 40 105 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8946 27 184 3.40.50.150
2esrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8772 29 183 3.40.50.150
af_Q2FZF6_1_156_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8729 27 184 3.40.50.150
2iftB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8628 23 183 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A399Z7B9-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9563 28 184 GO:0008168
GO:0031167
AF-A0A1F8TAU6-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9494 48 184 GO:0008168
GO:0031167
AF-X1CX93-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9476 44 184 GO:0008168
GO:0031167
AF-A0A1V5NY19-F1-model_v4 Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.171) 0.9404 43 182 GO:0003676
GO:0052913
AF-A0A419FMJ1-F1-model_v4 16S rRNA (Guanine(966)-N(2))-methyltransferase RsmD 0.9397 59 184 GO:0003676
GO:0008168
GO:0031167

Map