F409864

General Info

Members Datasets Scaffolds Average Seq Length
329 230 658 238

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0063500|Ga0501080_0063500_1591_2367
Length 258
Sequence MATSNDCAPSASSRKEANPMPEHEPLRRDVATANRILERVGLSNAFGHASARIPGTGTFLMPTRRSPGLCEAAALLTIDTDGKVLAGDGEPNSEFWIHARLYAARPDVGGVVHAHPPACVCLTQVGEPHRVVHNQGGIFADGVPEYSRIGLIRTRELGELLAKTLGRGNAVMMRGHGITTAFADVRTAAVAACYLEESAGLQLRMLAAAGGDGSRLRAYTREEAEGLRDQITGSVARRAWEYYAALAESLPLGANLRA

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 1.52
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0063500 3300049742 Bacteria 3437
2 Ga0065712_10200283 3300005290 Bacteria 1099
3 Ga0070658_10298015 3300005327 Bacteria 1375
4 Ga0070658_10663369 3300005327 Unclassified 905
5 Ga0070676_10444799 3300005328 Bacteria 910
6 Ga0070683_100750501 3300005329 Bacteria 935
7 Ga0070677_10035548 3300005333 Bacteria 1932
8 Ga0068869_100218782 3300005334 Bacteria 1509
9 Ga0070666_10148297 3300005335 Bacteria 1636
10 Ga0070680_100418770 3300005336 Bacteria 1143
11 Ga0068868_100048523 3300005338 Bacteria 3330
12 Ga0068868_100946359 3300005338 Bacteria 785
13 Ga0070689_100022230 3300005340 Bacteria 4735
14 Ga0070689_100052488 3300005340 Bacteria 3153
15 Ga0070661_100199002 3300005344 Unclassified 1530
16 Ga0070692_10185983 3300005345 Bacteria 1207
17 Ga0070668_100019508 3300005347 Bacteria 5103
18 Ga0070675_100004620 3300005354 Bacteria 10515
19 Ga0070671_100008774 3300005355 Bacteria 8111
20 Ga0070674_100465174 3300005356 Bacteria 1047
21 Ga0070673_100073928 3300005364 Unclassified 2745
22 Ga0070688_100353546 3300005365 Bacteria 1076
23 Ga0070659_100181013 3300005366 Unclassified 1730
24 Ga0070659_100348048 3300005366 Bacteria 1243
25 Ga0070659_100445964 3300005366 Unclassified 1097
26 Ga0070667_100371725 3300005367 Bacteria 1297
27 Ga0070713_100213806 3300005436 Bacteria 1747
28 Ga0070710_10460061 3300005437 Bacteria 864
29 Ga0070705_100092873 3300005440 Bacteria 1885
30 Ga0070700_100680397 3300005441 Bacteria 816
31 Ga0070694_100414065 3300005444 Unclassified 1058
32 Ga0070694_100698202 3300005444 Bacteria 825
33 Ga0070708_100106606 3300005445 Bacteria 2572
34 Ga0070678_100414611 3300005456 Bacteria 1173
35 Ga0070678_100441038 3300005456 Bacteria 1139
36 Ga0070662_100097783 3300005457 Bacteria 2216
37 Ga0070681_10096602 3300005458 Bacteria 2902
38 Ga0068867_100319875 3300005459 Bacteria 1285
39 Ga0070685_10119363 3300005466 Bacteria 1636
40 Ga0070685_10300768 3300005466 Bacteria 1081
41 Ga0070706_100062520 3300005467 Bacteria 3441
42 Ga0070698_100660015 3300005471 Bacteria 987
43 Ga0070699_100128087 3300005518 Bacteria 2236
44 Ga0070679_100013798 3300005530 Bacteria 7741
45 Ga0070679_100086025 3300005530 Bacteria 3131
46 Ga0070684_100044919 3300005535 Bacteria 3823
47 Ga0070684_100227091 3300005535 Bacteria 1704
48 Ga0070684_100397171 3300005535 Bacteria 1271
49 Ga0070697_100163015 3300005536 Bacteria 1884
50 Ga0068853_100012664 3300005539 Bacteria 6868
51 Ga0068853_100090151 3300005539 Unclassified 2694
52 Ga0070672_100007656 3300005543 Bacteria 7348
53 Ga0070672_100236040 3300005543 Bacteria 1537
54 Ga0070686_100512022 3300005544 Bacteria 933
55 Ga0070695_100260482 3300005545 Bacteria 1266
56 Ga0070696_100083072 3300005546 Bacteria 2271
57 Ga0070693_100003161 3300005547 Bacteria 7645
58 Ga0070693_100294074 3300005547 Bacteria 1092
59 Ga0070704_100008191 3300005549 Bacteria 6255
60 Ga0070704_100554258 3300005549 Bacteria 1005
61 Ga0068855_100004292 3300005563 Bacteria 17420
62 Ga0068855_100019882 3300005563 Bacteria 8064
63 Ga0068855_100242580 3300005563 Bacteria 2013
64 Ga0068855_100438981 3300005563 Bacteria 1426
65 Ga0070664_100097627 3300005564 Bacteria 2551
66 Ga0068857_100163434 3300005577 Bacteria 2021
67 Ga0068856_100099648 3300005614 Bacteria 2897
68 Ga0068856_100180204 3300005614 Unclassified 2126
69 Ga0068856_100461493 3300005614 Bacteria 1291
70 Ga0068852_100028257 3300005616 Bacteria 4587
71 Ga0068852_100095667 3300005616 Bacteria 2667
72 Ga0068852_100103694 3300005616 Bacteria 2573
73 Ga0068852_100387239 3300005616 Bacteria 1372
74 Ga0068859_100029181 3300005617 Bacteria 5536
75 Ga0068859_100220789 3300005617 Bacteria 1983
76 Ga0068859_100334033 3300005617 Bacteria 1610
77 Ga0068859_100847815 3300005617 Bacteria 1000
78 Ga0068864_100188144 3300005618 Bacteria 1891
79 Ga0068851_10162939 3300005834 Unclassified 1226
80 Ga0068870_10534038 3300005840 Unclassified 787
81 Ga0068863_100270630 3300005841 Unclassified 1644
82 Ga0068858_100092264 3300005842 Bacteria 2818
83 Ga0068858_100281352 3300005842 Bacteria 1584
84 Ga0068860_100320669 3300005843 Bacteria 1521
85 Ga0068862_100498131 3300005844 Bacteria 1156
86 Ga0081455_10486472 3300005937 Bacteria 833
87 Ga0081539_10008937 3300005985 Bacteria 8540
88 Ga0070717_10511274 3300006028 Bacteria 1086
89 Ga0070716_100021388 3300006173 Bacteria 3409
90 Ga0070712_100483219 3300006175 Unclassified 1036
91 Ga0075366_10015596 3300006195 Bacteria 4359
92 Ga0068871_100034308 3300006358 Bacteria 4026
93 Ga0068871_100046500 3300006358 Bacteria 3496
94 Ga0075428_100130962 3300006844 Bacteria 2728
95 Ga0075430_100582726 3300006846 Bacteria 923
96 Ga0075434_100097743 3300006871 Bacteria 2941
97 Ga0075429_100060015 3300006880 Bacteria 3314
98 Ga0097620_100029181 3300006931 Bacteria 5536
99 Ga0097620_100220790 3300006931 Bacteria 1983
100 Ga0097620_100334032 3300006931 Bacteria 1610
101 Ga0097620_100847844 3300006931 Bacteria 1000
102 Ga0105240_10018642 3300009093 Bacteria 9303
103 Ga0105240_10047727 3300009093 Bacteria 5417
104 Ga0111539_10004780 3300009094 Bacteria 17679
105 Ga0105245_10458364 3300009098 Bacteria 1285
106 Ga0105243_10192328 3300009148 Bacteria 1783
107 Ga0105243_10227334 3300009148 Bacteria 1653
108 Ga0105241_10008720 3300009174 Bacteria 7449
109 Ga0105242_10515635 3300009176 Bacteria 1140
110 Ga0105248_10012160 3300009177 Bacteria 9494
111 Ga0105248_10044307 3300009177 Bacteria 4990
112 Ga0105248_11162466 3300009177 Bacteria 872
113 Ga0105238_10061429 3300009551 Bacteria 3760
114 Ga0105238_10073593 3300009551 Bacteria 3411
115 Ga0105238_10640300 3300009551 Bacteria 1073
116 Ga0105249_10381542 3300009553 Bacteria 1435
117 Ga0157371_10150655 3300013102 Bacteria 1659
118 Ga0157370_10038822 3300013104 Bacteria 4605
119 Ga0157370_10198814 3300013104 Bacteria 1860
120 Ga0157369_10011285 3300013105 Bacteria 10150
121 Ga0157369_10562447 3300013105 Bacteria 1178
122 Ga0157374_10095615 3300013296 Bacteria 2841
123 Ga0157378_10239179 3300013297 Bacteria 1734
124 Ga0157378_10251111 3300013297 Bacteria 1693
125 Ga0157378_10803471 3300013297 Bacteria 966
126 Ga0163162_10052812 3300013306 Bacteria 4083
127 Ga0163162_10376828 3300013306 Bacteria 1552
128 Ga0163162_10888620 3300013306 Bacteria 1005
129 Ga0157372_10009538 3300013307 Bacteria 10316
130 Ga0157375_10120835 3300013308 Bacteria 2729
131 Ga0157375_10206089 3300013308 Unclassified 2123
132 Ga0157380_10007071 3300014326 Bacteria 7946
133 Ga0157380_10254245 3300014326 Bacteria 1592
134 Ga0157377_10004965 3300014745 Bacteria 6204
135 Ga0157379_10012558 3300014968 Bacteria 7398
136 Ga0157376_10040161 3300014969 Bacteria 3822
137 Ga0157376_10091459 3300014969 Bacteria 2636
138 Ga0157376_11138208 3300014969 Unclassified 807
139 Ga0213876_10076305 3300021384 Bacteria 1770
140 Ga0207656_10001673 3300025321 Bacteria 7369
141 Ga0207656_10116972 3300025321 Unclassified 1238
142 Ga0207692_10368619 3300025898 Bacteria 889
143 Ga0207680_10265017 3300025903 Bacteria 1190
144 Ga0207699_10208038 3300025906 Bacteria 1329
145 Ga0207684_10071665 3300025910 Bacteria 2944
146 Ga0207707_10187758 3300025912 Bacteria 1803
147 Ga0207695_10041368 3300025913 Bacteria 4933
148 Ga0207695_10056401 3300025913 Bacteria 4087
149 Ga0207695_10267422 3300025913 Bacteria 1606
150 Ga0207649_10321324 3300025920 Unclassified 1137
151 Ga0207652_10153069 3300025921 Bacteria 2065
152 Ga0207652_10541869 3300025921 Bacteria 1046
153 Ga0207681_10027877 3300025923 Bacteria 3657
154 Ga0207694_10033372 3300025924 Bacteria 3943
155 Ga0207694_10182380 3300025924 Bacteria 1703
156 Ga0207659_10007526 3300025926 Bacteria 6705
157 Ga0207700_10000052 3300025928 Bacteria 76498
158 Ga0207664_10401577 3300025929 Bacteria 1219
159 Ga0207644_10012006 3300025931 Bacteria 5744
160 Ga0207690_10125469 3300025932 Bacteria 1871
161 Ga0207690_10625626 3300025932 Bacteria 880
162 Ga0207706_10042725 3300025933 Unclassified 4018
163 Ga0207709_10103272 3300025935 Bacteria 1889
164 Ga0207670_10006454 3300025936 Bacteria 6505
165 Ga0207670_10019637 3300025936 Bacteria 4132
166 Ga0207665_10015183 3300025939 Bacteria 5057
167 Ga0207665_10227366 3300025939 Bacteria 1370
168 Ga0207665_10266075 3300025939 Bacteria 1272
169 Ga0207691_10007085 3300025940 Bacteria 10822
170 Ga0207691_10211186 3300025940 Bacteria 1686
171 Ga0207691_10453106 3300025940 Bacteria 1092
172 Ga0207711_10003847 3300025941 Bacteria 12913
173 Ga0207711_10538597 3300025941 Bacteria 1089
174 Ga0207689_10092332 3300025942 Bacteria 2487
175 Ga0207689_10198573 3300025942 Bacteria 1655
176 Ga0207661_10041857 3300025944 Bacteria 3609
177 Ga0207661_10676956 3300025944 Bacteria 948
178 Ga0207661_10755684 3300025944 Bacteria 895
179 Ga0207667_10121356 3300025949 Bacteria 2693
180 Ga0207667_10203973 3300025949 Bacteria 2028
181 Ga0207667_10240533 3300025949 Unclassified 1852
182 Ga0207651_10017169 3300025960 Bacteria 4267
183 Ga0207651_10498288 3300025960 Unclassified 1052
184 Ga0207712_10640415 3300025961 Bacteria 923
185 Ga0207668_10025743 3300025972 Bacteria 3811
186 Ga0207658_10012160 3300025986 Bacteria 5872
187 Ga0207677_10142749 3300026023 Unclassified 1836
188 Ga0207703_10275628 3300026035 Bacteria 1525
189 Ga0207703_10658624 3300026035 Bacteria 994
190 Ga0207639_10080766 3300026041 Bacteria 2573
191 Ga0207708_10092653 3300026075 Bacteria 2332
192 Ga0207708_10231729 3300026075 Unclassified 1483
193 Ga0207702_10326361 3300026078 Bacteria 1463
194 Ga0207702_10426931 3300026078 Unclassified 1282
195 Ga0207641_10039941 3300026088 Bacteria 3926
196 Ga0207648_10031379 3300026089 Bacteria 4698
197 Ga0207648_10168652 3300026089 Bacteria 1935
198 Ga0207676_10068768 3300026095 Bacteria 2834
199 Ga0207674_10085416 3300026116 Bacteria 3151
200 Ga0207675_100711112 3300026118 Bacteria 1014
201 Ga0207683_10020100 3300026121 Bacteria 5708
202 Ga0207683_10193704 3300026121 Bacteria 1846
203 Ga0207698_10017838 3300026142 Bacteria 4824
204 Ga0207698_10065848 3300026142 Bacteria 2849
205 Ga0207698_10236614 3300026142 Bacteria 1661
206 Ga0207428_10004076 3300027907 Bacteria 14001
207 Ga0307412_10240886 3300031911 Bacteria 1399
208 Ga0307411_10428570 3300032005 Bacteria 1101
209 Ga0373923_0009148 3300035111 Bacteria 3563
210 Ga0373923_0183051 3300035111 Unclassified 963
211 Ga0373936_0003251 3300035113 Bacteria 6090
212 Ga0373954_0012987 3300035118 Bacteria 3707
213 Ga0373956_0000228 3300035119 Bacteria 22321
214 Ga0373956_0037555 3300035119 Bacteria 2141
215 Ga0373957_0001931 3300035120 Bacteria 5767
216 Ga0373957_0056838 3300035120 Bacteria 1507
217 Ga0373955_0001679 3300035172 Bacteria 9462
218 Ga0373955_0047680 3300035172 Unclassified 2320
219 Ga0373924_0002936 3300035410 Bacteria 5787
220 Ga0373935_0231641 3300035692 Bacteria 1286
221 Ga0373927_0062529 3300035695 Bacteria 2407
222 Ga0373927_0062901 3300035695 Bacteria 2400
223 Ga0373927_0173399 3300035695 Bacteria 1414
224 Ga0373933_0000949 3300035724 Bacteria 17679
225 Ga0373933_0112303 3300035724 Bacteria 1701
226 Ga0373947_0276883 3300035725 Bacteria 1115
227 Ga0373937_0001064 3300036401 Bacteria 23171
228 Ga0373937_0067199 3300036401 Bacteria 3303
229 Ga0373937_0315614 3300036401 Bacteria 1478
230 Ga0373925_0027650 3300037068 Bacteria 4151
231 Ga0373925_0056274 3300037068 Bacteria 2946
232 Ga0395900_0105704 3300037418 Bacteria 2892
233 Ga0436365_0644452 3300039437 Bacteria 2035
234 Ga0436365_1612847 3300039437 Bacteria 2766
235 Ga0451853_2063482 3300041512 Bacteria 1596
236 Ga0451577_0328069 3300042876 Bacteria 1388
237 Ga0466961_0075178 3300044693 Bacteria 2142
238 Ga0466963_0371303 3300044694 Bacteria 1008
239 Ga0466957_0054546 3300044842 Bacteria 2440
240 Ga0466958_0017864 3300045836 Bacteria 4108
241 Ga0495592_0128913 3300046454 Unclassified 1771
242 Ga0495641_0040664 3300046461 Bacteria 2161
243 Ga0495651_0000326 3300046462 Bacteria 36974
244 Ga0495653_0021865 3300046463 Bacteria 5177
245 Ga0495580_0396258 3300046472 Bacteria 931
246 Ga0495582_0014102 3300046473 Bacteria 4398
247 Ga0495639_0032383 3300046475 Bacteria 2331
248 Ga0495662_0097003 3300046476 Bacteria 1441
249 Ga0495608_0059470 3300046511 Bacteria 2517
250 Ga0495618_0044400 3300046514 Bacteria 2803
251 Ga0495628_0014941 3300046516 Bacteria 6493
252 Ga0495628_0030349 3300046516 Bacteria 4377
253 Ga0495630_0002086 3300046517 Bacteria 13901
254 Ga0495652_0169930 3300046529 Unclassified 1684
255 Ga0495652_0302445 3300046529 Bacteria 1162
256 Ga0495665_0097019 3300046531 Bacteria 1548
257 Ga0495586_0011335 3300046535 Bacteria 4740
258 Ga0495587_0063361 3300046536 Bacteria 2162
259 Ga0495598_0019784 3300046537 Bacteria 1770
260 Ga0495621_0025313 3300046539 Bacteria 1993
261 Ga0495621_0031008 3300046539 Bacteria 1831
262 Ga0495645_0003451 3300046543 Bacteria 10721
263 Ga0495622_0089427 3300046557 Bacteria 1415
264 Ga0495667_0000966 3300046559 Bacteria 18594
265 Ga0495634_0006738 3300046642 Bacteria 8701
266 Ga0495657_0015862 3300046675 Bacteria 5501
267 Ga0495657_0157780 3300046675 Bacteria 1405
268 Ga0495657_0167129 3300046675 Bacteria 1357
269 Ga0495599_0022551 3300046678 Bacteria 3931
270 Ga0495623_0040456 3300046679 Bacteria 2976
271 Ga0495646_0260238 3300046680 Bacteria 927
272 Ga0495647_0000729 3300046681 Bacteria 9723
273 Ga0495658_0034996 3300046683 Bacteria 2759
274 Ga0495658_0126397 3300046683 Bacteria 1552
275 Ga0495600_0020663 3300046809 Bacteria 4210
276 Ga0495604_0088761 3300047317 Bacteria 2299
277 Ga0495636_0029428 3300047318 Bacteria 2242
278 Ga0495680_0036724 3300047322 Bacteria 3930
279 Ga0495675_0095604 3300047444 Bacteria 1863
280 Ga0495684_0082196 3300047471 Bacteria 2444
281 Ga0495602_0234023 3300048088 Bacteria 1378
282 Ga0496100_0376751 3300048903 Bacteria 1077
283 Ga0496101_0498676 3300048904 Unclassified 962
284 Ga0496102_0108908 3300048905 Bacteria 2581
285 Ga0496106_0321014 3300048909 Unclassified 1243
286 Ga0496109_0591658 3300048912 Bacteria 1045
287 Ga0501033_0360024 3300049570 Unclassified 1018
288 Ga0501037_0110940 3300049573 Bacteria 1976
289 Ga0501039_0144605 3300049575 Bacteria 1868
290 Ga0501040_0442615 3300049576 Bacteria 935
291 Ga0501041_0034088 3300049577 Bacteria 3082
292 Ga0501046_0158240 3300049580 Bacteria 1705
293 Ga0501047_0004761 3300049581 Bacteria 12763
294 Ga0501047_0044942 3300049581 Bacteria 4269
295 Ga0501068_0015924 3300049584 Bacteria 4330
296 Ga0501069_0001659 3300049585 Bacteria 11062
297 Ga0501069_0229674 3300049585 Bacteria 1080
298 Ga0501070_0001524 3300049586 Bacteria 20605
299 Ga0501072_0072660 3300049588 Bacteria 2719
300 Ga0501073_0000953 3300049589 Bacteria 20820
301 Ga0501074_0000154 3300049590 Bacteria 35857
302 Ga0501076_0208501 3300049592 Unclassified 1596
303 Ga0501079_0001763 3300049741 Bacteria 15436
304 Ga0501079_0023943 3300049741 Bacteria 4684
305 Ga0501080_0001327 3300049742 Bacteria 20617
306 Ga0501080_0100400 3300049742 Bacteria 2685
307 Ga0501081_0018181 3300049743 Bacteria 4665
308 Ga0501083_0003267 3300049744 Bacteria 11316
309 Ga0501035_0077375 3300049822 Bacteria 2940
310 nmdc:mga0k408_11853_c1 3300050493 Bacteria 4756
311 nmdc:mga09592_11665_c1 3300050508 Bacteria 7149
312 nmdc:mga0qj67_252724_c1 3300050509 Bacteria 1430
313 nmdc:mga0qj67_500309_c1 3300050509 Bacteria 977
314 nmdc:mga06r32_448887_c1 3300050510 Unclassified 1269
315 nmdc:mga08y16_5363_c1 3300050511 Bacteria 13409
316 nmdc:mga0n895_127910_c1 3300050512 Bacteria 2564
317 nmdc:mga0rr50_599291_c1 3300050513 Bacteria 939
318 nmdc:mga08x19_36963_c1 3300050514 Bacteria 3096
319 nmdc:mga0a205_125285_c1 3300050515 Unclassified 2468
320 Ga0495601_0015190 3300053077 Bacteria 4652
321 Ga0495601_0015459 3300053077 Bacteria 4612
322 Ga0495601_0041028 3300053077 Bacteria 2900
323 Ga0495595_0006780 3300053084 Bacteria 4673
324 Ga0495595_0031624 3300053084 Bacteria 2380
325 Ga0495619_0045750 3300053085 Bacteria 2875
326 Ga0495619_0067500 3300053085 Bacteria 2388
327 Ga0500566_0269297 3300053094 Bacteria 818
328 Ga0501084_0243856 3300054114 Unclassified 1516
329 Ga0501082_0026745 3300060353 Bacteria 4972
330 Ga0501080_0063500
331 Ga0065712_10200283
332 Ga0070658_10298015
333 Ga0070658_10663369
334 Ga0070676_10444799
335 Ga0070683_100750501
336 Ga0070677_10035548
337 Ga0068869_100218782
338 Ga0070666_10148297
339 Ga0070680_100418770
340 Ga0068868_100048523
341 Ga0068868_100946359
342 Ga0070689_100022230
343 Ga0070689_100052488
344 Ga0070661_100199002
345 Ga0070692_10185983
346 Ga0070668_100019508
347 Ga0070675_100004620
348 Ga0070671_100008774
349 Ga0070674_100465174
350 Ga0070673_100073928
351 Ga0070688_100353546
352 Ga0070659_100181013
353 Ga0070659_100348048
354 Ga0070659_100445964
355 Ga0070667_100371725
356 Ga0070713_100213806
357 Ga0070710_10460061
358 Ga0070705_100092873
359 Ga0070700_100680397
360 Ga0070694_100414065
361 Ga0070694_100698202
362 Ga0070708_100106606
363 Ga0070678_100414611
364 Ga0070678_100441038
365 Ga0070662_100097783
366 Ga0070681_10096602
367 Ga0068867_100319875
368 Ga0070685_10119363
369 Ga0070685_10300768
370 Ga0070706_100062520
371 Ga0070698_100660015
372 Ga0070699_100128087
373 Ga0070679_100013798
374 Ga0070679_100086025
375 Ga0070684_100044919
376 Ga0070684_100227091
377 Ga0070684_100397171
378 Ga0070697_100163015
379 Ga0068853_100012664
380 Ga0068853_100090151
381 Ga0070672_100007656
382 Ga0070672_100236040
383 Ga0070686_100512022
384 Ga0070695_100260482
385 Ga0070696_100083072
386 Ga0070693_100003161
387 Ga0070693_100294074
388 Ga0070704_100008191
389 Ga0070704_100554258
390 Ga0068855_100004292
391 Ga0068855_100019882
392 Ga0068855_100242580
393 Ga0068855_100438981
394 Ga0070664_100097627
395 Ga0068857_100163434
396 Ga0068856_100099648
397 Ga0068856_100180204
398 Ga0068856_100461493
399 Ga0068852_100028257
400 Ga0068852_100095667
401 Ga0068852_100103694
402 Ga0068852_100387239
403 Ga0068859_100029181
404 Ga0068859_100220789
405 Ga0068859_100334033
406 Ga0068859_100847815
407 Ga0068864_100188144
408 Ga0068851_10162939
409 Ga0068870_10534038
410 Ga0068863_100270630
411 Ga0068858_100092264
412 Ga0068858_100281352
413 Ga0068860_100320669
414 Ga0068862_100498131
415 Ga0081455_10486472
416 Ga0081539_10008937
417 Ga0070717_10511274
418 Ga0070716_100021388
419 Ga0070712_100483219
420 Ga0075366_10015596
421 Ga0068871_100034308
422 Ga0068871_100046500
423 Ga0075428_100130962
424 Ga0075430_100582726
425 Ga0075434_100097743
426 Ga0075429_100060015
427 Ga0097620_100029181
428 Ga0097620_100220790
429 Ga0097620_100334032
430 Ga0097620_100847844
431 Ga0105240_10018642
432 Ga0105240_10047727
433 Ga0111539_10004780
434 Ga0105245_10458364
435 Ga0105243_10192328
436 Ga0105243_10227334
437 Ga0105241_10008720
438 Ga0105242_10515635
439 Ga0105248_10012160
440 Ga0105248_10044307
441 Ga0105248_11162466
442 Ga0105238_10061429
443 Ga0105238_10073593
444 Ga0105238_10640300
445 Ga0105249_10381542
446 Ga0157371_10150655
447 Ga0157370_10038822
448 Ga0157370_10198814
449 Ga0157369_10011285
450 Ga0157369_10562447
451 Ga0157374_10095615
452 Ga0157378_10239179
453 Ga0157378_10251111
454 Ga0157378_10803471
455 Ga0163162_10052812
456 Ga0163162_10376828
457 Ga0163162_10888620
458 Ga0157372_10009538
459 Ga0157375_10120835
460 Ga0157375_10206089
461 Ga0157380_10007071
462 Ga0157380_10254245
463 Ga0157377_10004965
464 Ga0157379_10012558
465 Ga0157376_10040161
466 Ga0157376_10091459
467 Ga0157376_11138208
468 Ga0213876_10076305
469 Ga0207656_10001673
470 Ga0207656_10116972
471 Ga0207692_10368619
472 Ga0207680_10265017
473 Ga0207699_10208038
474 Ga0207684_10071665
475 Ga0207707_10187758
476 Ga0207695_10041368
477 Ga0207695_10056401
478 Ga0207695_10267422
479 Ga0207649_10321324
480 Ga0207652_10153069
481 Ga0207652_10541869
482 Ga0207681_10027877
483 Ga0207694_10033372
484 Ga0207694_10182380
485 Ga0207659_10007526
486 Ga0207700_10000052
487 Ga0207664_10401577
488 Ga0207644_10012006
489 Ga0207690_10125469
490 Ga0207690_10625626
491 Ga0207706_10042725
492 Ga0207709_10103272
493 Ga0207670_10006454
494 Ga0207670_10019637
495 Ga0207665_10015183
496 Ga0207665_10227366
497 Ga0207665_10266075
498 Ga0207691_10007085
499 Ga0207691_10211186
500 Ga0207691_10453106
501 Ga0207711_10003847
502 Ga0207711_10538597
503 Ga0207689_10092332
504 Ga0207689_10198573
505 Ga0207661_10041857
506 Ga0207661_10676956
507 Ga0207661_10755684
508 Ga0207667_10121356
509 Ga0207667_10203973
510 Ga0207667_10240533
511 Ga0207651_10017169
512 Ga0207651_10498288
513 Ga0207712_10640415
514 Ga0207668_10025743
515 Ga0207658_10012160
516 Ga0207677_10142749
517 Ga0207703_10275628
518 Ga0207703_10658624
519 Ga0207639_10080766
520 Ga0207708_10092653
521 Ga0207708_10231729
522 Ga0207702_10326361
523 Ga0207702_10426931
524 Ga0207641_10039941
525 Ga0207648_10031379
526 Ga0207648_10168652
527 Ga0207676_10068768
528 Ga0207674_10085416
529 Ga0207675_100711112
530 Ga0207683_10020100
531 Ga0207683_10193704
532 Ga0207698_10017838
533 Ga0207698_10065848
534 Ga0207698_10236614
535 Ga0207428_10004076
536 Ga0307412_10240886
537 Ga0307411_10428570
538 Ga0373923_0009148
539 Ga0373923_0183051
540 Ga0373936_0003251
541 Ga0373954_0012987
542 Ga0373956_0000228
543 Ga0373956_0037555
544 Ga0373957_0001931
545 Ga0373957_0056838
546 Ga0373955_0001679
547 Ga0373955_0047680
548 Ga0373924_0002936
549 Ga0373935_0231641
550 Ga0373927_0062529
551 Ga0373927_0062901
552 Ga0373927_0173399
553 Ga0373933_0000949
554 Ga0373933_0112303
555 Ga0373947_0276883
556 Ga0373937_0001064
557 Ga0373937_0067199
558 Ga0373937_0315614
559 Ga0373925_0027650
560 Ga0373925_0056274
561 Ga0395900_0105704
562 Ga0436365_0644452
563 Ga0436365_1612847
564 Ga0451853_2063482
565 Ga0451577_0328069
566 Ga0466961_0075178
567 Ga0466963_0371303
568 Ga0466957_0054546
569 Ga0466958_0017864
570 Ga0495592_0128913
571 Ga0495641_0040664
572 Ga0495651_0000326
573 Ga0495653_0021865
574 Ga0495580_0396258
575 Ga0495582_0014102
576 Ga0495639_0032383
577 Ga0495662_0097003
578 Ga0495608_0059470
579 Ga0495618_0044400
580 Ga0495628_0014941
581 Ga0495628_0030349
582 Ga0495630_0002086
583 Ga0495652_0169930
584 Ga0495652_0302445
585 Ga0495665_0097019
586 Ga0495586_0011335
587 Ga0495587_0063361
588 Ga0495598_0019784
589 Ga0495621_0025313
590 Ga0495621_0031008
591 Ga0495645_0003451
592 Ga0495622_0089427
593 Ga0495667_0000966
594 Ga0495634_0006738
595 Ga0495657_0015862
596 Ga0495657_0157780
597 Ga0495657_0167129
598 Ga0495599_0022551
599 Ga0495623_0040456
600 Ga0495646_0260238
601 Ga0495647_0000729
602 Ga0495658_0034996
603 Ga0495658_0126397
604 Ga0495600_0020663
605 Ga0495604_0088761
606 Ga0495636_0029428
607 Ga0495680_0036724
608 Ga0495675_0095604
609 Ga0495684_0082196
610 Ga0495602_0234023
611 Ga0496100_0376751
612 Ga0496101_0498676
613 Ga0496102_0108908
614 Ga0496106_0321014
615 Ga0496109_0591658
616 Ga0501033_0360024
617 Ga0501037_0110940
618 Ga0501039_0144605
619 Ga0501040_0442615
620 Ga0501041_0034088
621 Ga0501046_0158240
622 Ga0501047_0004761
623 Ga0501047_0044942
624 Ga0501068_0015924
625 Ga0501069_0001659
626 Ga0501069_0229674
627 Ga0501070_0001524
628 Ga0501072_0072660
629 Ga0501073_0000953
630 Ga0501074_0000154
631 Ga0501076_0208501
632 Ga0501079_0001763
633 Ga0501079_0023943
634 Ga0501080_0001327
635 Ga0501080_0100400
636 Ga0501081_0018181
637 Ga0501083_0003267
638 Ga0501035_0077375
639 nmdc:mga0k408_11853_c1
640 nmdc:mga09592_11665_c1
641 nmdc:mga0qj67_252724_c1
642 nmdc:mga0qj67_500309_c1
643 nmdc:mga06r32_448887_c1
644 nmdc:mga08y16_5363_c1
645 nmdc:mga0n895_127910_c1
646 nmdc:mga0rr50_599291_c1
647 nmdc:mga08x19_36963_c1
648 nmdc:mga0a205_125285_c1
649 Ga0495601_0015190
650 Ga0495601_0015459
651 Ga0495601_0041028
652 Ga0495595_0006780
653 Ga0495595_0031624
654 Ga0495619_0045750
655 Ga0495619_0067500
656 Ga0500566_0269297
657 Ga0501084_0243856
658 Ga0501082_0026745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

28

203

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9013 5 230
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.879 2 211
1e4a-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant del(27) 0.8716 1 211
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.8711 2 211
1e48-assembly1.cif.gz_P l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q/y113f/y209f 0.8677 2 211
ID Description Score Start End Superfamily
af_A0A1D8PNQ3_32_284_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9086 4 230 3.40.225.10
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9049 1 230 3.40.225.10
af_Q7LKY2_67_324_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8962 1 230 3.40.225.10
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8937 5 230 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8877 2 189 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A1F4FCE1-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9862 8 234 GO:0005829
GO:0016832
GO:0019323
AF-A0A536SD86-F1-model_v4 Class II aldolase/adducin family protein 0.9754 3 234 GO:0005829
GO:0016832
GO:0019323
AF-A0A1F4FCE1-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9693 8 234 GO:0005829
GO:0016832
GO:0019323
AF-A0A534S9B1-F1-model_v4 Class II aldolase/adducin family protein 0.9601 2 183 GO:0005829
GO:0016832
GO:0019323
AF-A0A6I1QU54-F1-model_v4 Class II aldolase/adducin N-terminal domain-containing protein 0.9556 1 226 GO:0005829
GO:0016832
GO:0019323

Map