F409832

General Info

Members Datasets Scaffolds Average Seq Length
329 183 658 252

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0085369|Ga0496101_0085369_153_1025
Length 290
Sequence VAAVGHIFASPGVKRVQVNLPAEGKTMKPENRTQKIAVTGATGRVGAPLVEILEQRGHDVVPIARSNGVDVISGDGLDEALAGVETIIDTATGPSPDQEAATAFFTAAARNLQRAGAAAGAKRIVLVSIIGIDKFQGGYNAAKVAQEQTLLEGPLPVRIVRAAQFHEFVDQLVGWMIQDDVAYVPEMRTQLVAARVVAEALADAAEEPEIENGRITEIAGPQEERLAAAAAMLFASRGDAIEIREVPPSGDPDTDAYAQGAALPNPGATLAGPSFEAWLATARRPSTMGA

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.26
Nodule 0
Rhizoplane 12.77
Rhizosphere 82.37
Stem 0
Stem Tuber 0
Unclassified 13.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0085369 3300048904 Bacteria 2339
2 Ga0070683_100047906 3300005329 Bacteria 3950
3 Ga0070683_100281342 3300005329 Bacteria 1582
4 Ga0068869_100031617 3300005334 Bacteria 3723
5 Ga0068868_100021808 3300005338 Bacteria 4827
6 Ga0068868_100054695 3300005338 Bacteria 3146
7 Ga0070660_100157584 3300005339 Bacteria 1828
8 Ga0070660_100442412 3300005339 Unclassified 1078
9 Ga0070689_100120787 3300005340 Bacteria 2092
10 Ga0070661_100147325 3300005344 Unclassified 1778
11 Ga0070668_100113257 3300005347 Bacteria 2161
12 Ga0070668_100353175 3300005347 Bacteria 1245
13 Ga0070669_100064491 3300005353 Bacteria 2698
14 Ga0070674_100290920 3300005356 Bacteria 1299
15 Ga0070659_100004299 3300005366 Bacteria 10170
16 Ga0070659_100088395 3300005366 Bacteria 2481
17 Ga0070659_100144242 3300005366 Bacteria 1940
18 Ga0070709_10237071 3300005434 Bacteria 1308
19 Ga0070714_100125188 3300005435 Unclassified 2291
20 Ga0070713_100035165 3300005436 Bacteria 4030
21 Ga0070713_100396378 3300005436 Bacteria 1288
22 Ga0070710_10017915 3300005437 Unclassified 3636
23 Ga0070710_10103783 3300005437 Bacteria 1697
24 Ga0070711_100246152 3300005439 Bacteria 1400
25 Ga0070705_100130801 3300005440 Unclassified 1637
26 Ga0070700_100002169 3300005441 Bacteria 9959
27 Ga0068867_100361115 3300005459 Bacteria 1215
28 Ga0068867_100844170 3300005459 Bacteria 820
29 Ga0070685_10107571 3300005466 Bacteria 1713
30 Ga0070707_100090336 3300005468 Bacteria 2965
31 Ga0070698_100015469 3300005471 Bacteria 8060
32 Ga0070698_100068120 3300005471 Bacteria 3578
33 Ga0070699_100008899 3300005518 Bacteria 8697
34 Ga0070684_100054052 3300005535 Bacteria 3498
35 Ga0070684_100348510 3300005535 Bacteria 1362
36 Ga0068853_100229834 3300005539 Unclassified 1697
37 Ga0070665_100127761 3300005548 Bacteria 2545
38 Ga0070665_100314615 3300005548 Bacteria 1570
39 Ga0070704_100345899 3300005549 Bacteria 1254
40 Ga0070664_100029029 3300005564 Bacteria 4609
41 Ga0068857_100081449 3300005577 Bacteria 2890
42 Ga0068854_100053587 3300005578 Bacteria 2898
43 Ga0068854_100290102 3300005578 Unclassified 1320
44 Ga0068856_100001452 3300005614 Bacteria 24864
45 Ga0068856_100260772 3300005614 Bacteria 1748
46 Ga0070702_100019806 3300005615 Bacteria 3516
47 Ga0070702_100031580 3300005615 Bacteria 2899
48 Ga0068859_100130547 3300005617 Bacteria 2584
49 Ga0068864_100173301 3300005618 Bacteria 1969
50 Ga0068864_100269006 3300005618 Bacteria 1587
51 Ga0068866_10046473 3300005718 Bacteria 2184
52 Ga0068861_100061334 3300005719 Bacteria 2885
53 Ga0068861_100117204 3300005719 Bacteria 2143
54 Ga0068863_100428701 3300005841 Bacteria 1296
55 Ga0068858_100063338 3300005842 Bacteria 3421
56 Ga0068858_100121806 3300005842 Bacteria 2440
57 Ga0068858_100231705 3300005842 Bacteria 1751
58 Ga0068860_100317010 3300005843 Bacteria 1530
59 Ga0081455_10014917 3300005937 Bacteria 7572
60 Ga0081455_10045668 3300005937 Bacteria 3809
61 Ga0081455_10116910 3300005937 Bacteria 2108
62 Ga0081455_10475911 3300005937 Bacteria 846
63 Ga0081538_10000110 3300005981 Bacteria 81874
64 Ga0081538_10000318 3300005981 Bacteria 55086
65 Ga0081538_10000329 3300005981 Bacteria 54226
66 Ga0081538_10000559 3300005981 Bacteria 41262
67 Ga0081538_10002098 3300005981 Bacteria 19865
68 Ga0081538_10004056 3300005981 Bacteria 13627
69 Ga0081538_10005423 3300005981 Bacteria 11458
70 Ga0081538_10008043 3300005981 Bacteria 9014
71 Ga0081538_10068396 3300005981 Bacteria 1975
72 Ga0081540_1000556 3300005983 Bacteria 36167
73 Ga0081539_10032507 3300005985 Bacteria 3195
74 Ga0070717_10200590 3300006028 Bacteria 1747
75 Ga0075365_10001325 3300006038 Bacteria 11067
76 Ga0075365_10018232 3300006038 Bacteria 4312
77 Ga0075365_10035533 3300006038 Bacteria 3224
78 Ga0075365_10047761 3300006038 Bacteria 2815
79 Ga0075365_10218017 3300006038 Bacteria 1338
80 Ga0075364_10062494 3300006051 Bacteria 2443
81 Ga0075364_10285746 3300006051 Bacteria 1122
82 Ga0070715_10050359 3300006163 Bacteria 1788
83 Ga0070716_100008994 3300006173 Bacteria 4969
84 Ga0075367_10091910 3300006178 Bacteria 1847
85 Ga0097621_100244717 3300006237 Bacteria 1569
86 Ga0075428_100069445 3300006844 Bacteria 3852
87 Ga0075428_100143681 3300006844 Bacteria 2594
88 Ga0075428_100240013 3300006844 Bacteria 1955
89 Ga0075430_100187461 3300006846 Bacteria 1720
90 Ga0075431_100028837 3300006847 Bacteria 5707
91 Ga0075431_100195086 3300006847 Bacteria 2073
92 Ga0075434_100436843 3300006871 Bacteria 1330
93 Ga0075434_100766932 3300006871 Bacteria 981
94 Ga0075429_100293160 3300006880 Bacteria 1424
95 Ga0097620_100130543 3300006931 Bacteria 2584
96 Ga0111539_10067164 3300009094 Bacteria 4234
97 Ga0111539_10241838 3300009094 Bacteria 2101
98 Ga0111539_10419067 3300009094 Bacteria 1559
99 Ga0105245_10008381 3300009098 Bacteria 9030
100 Ga0105245_10043975 3300009098 Bacteria 3986
101 Ga0105245_10148005 3300009098 Bacteria 2217
102 Ga0105247_10078678 3300009101 Bacteria 2074
103 Ga0114129_10123143 3300009147 Bacteria 3567
104 Ga0105243_10006637 3300009148 Bacteria 8936
105 Ga0105243_10086556 3300009148 Bacteria 2571
106 Ga0105241_10122839 3300009174 Bacteria 2093
107 Ga0105242_10027602 3300009176 Bacteria 4511
108 Ga0105242_10342285 3300009176 Bacteria 1378
109 Ga0105242_10751232 3300009176 Bacteria 960
110 Ga0105249_10071893 3300009553 Bacteria 3197
111 Ga0105239_10038955 3300010375 Bacteria 5207
112 Ga0105239_10162843 3300010375 Unclassified 2493
113 Ga0105246_10040689 3300011119 Bacteria 3139
114 Ga0157369_10778624 3300013105 Bacteria 983
115 Ga0157374_10064348 3300013296 Bacteria 3441
116 Ga0163162_10360288 3300013306 Unclassified 1587
117 Ga0157372_10224526 3300013307 Bacteria 2177
118 Ga0163163_10296000 3300014325 Bacteria 1671
119 Ga0163163_10310182 3300014325 Bacteria 1631
120 Ga0157380_10675672 3300014326 Unclassified 1034
121 Ga0182008_10173345 3300014497 Bacteria 1090
122 Ga0157377_10022558 3300014745 Bacteria 3325
123 Ga0157377_10025307 3300014745 Bacteria 3164
124 Ga0163161_10486631 3300017792 Unclassified 1003
125 Ga0213876_10002137 3300021384 Bacteria 11685
126 Ga0224712_10074527 3300022467 Bacteria 1386
127 Ga0207426_1006359 3300025302 Bacteria 5154
128 Ga0207653_10059321 3300025885 Unclassified 1288
129 Ga0207710_10099112 3300025900 Unclassified 1372
130 Ga0207688_10000207 3300025901 Bacteria 26293
131 Ga0207688_10189746 3300025901 Unclassified 1229
132 Ga0207685_10071591 3300025905 Bacteria 1407
133 Ga0207699_10069985 3300025906 Bacteria 2141
134 Ga0207699_10211923 3300025906 Bacteria 1318
135 Ga0207684_10213381 3300025910 Bacteria 1665
136 Ga0207693_10044038 3300025915 Bacteria 3508
137 Ga0207693_10207496 3300025915 Unclassified 1540
138 Ga0207663_10203871 3300025916 Unclassified 1429
139 Ga0207662_10100547 3300025918 Bacteria 1791
140 Ga0207649_10286029 3300025920 Unclassified 1200
141 Ga0207646_10056259 3300025922 Bacteria 3516
142 Ga0207659_10475469 3300025926 Unclassified 1055
143 Ga0207687_10066509 3300025927 Bacteria 2562
144 Ga0207687_10272003 3300025927 Unclassified 1355
145 Ga0207700_10010513 3300025928 Bacteria 5845
146 Ga0207700_10045913 3300025928 Unclassified 3227
147 Ga0207664_10088809 3300025929 Bacteria 2530
148 Ga0207664_10266391 3300025929 Bacteria 1500
149 Ga0207664_10301766 3300025929 Bacteria 1409
150 Ga0207644_10406843 3300025931 Unclassified 1113
151 Ga0207706_10198872 3300025933 Bacteria 1758
152 Ga0207706_10671297 3300025933 Bacteria 887
153 Ga0207669_10348381 3300025937 Bacteria 1143
154 Ga0207704_10048630 3300025938 Bacteria 2544
155 Ga0207704_10112122 3300025938 Bacteria 1846
156 Ga0207679_10125210 3300025945 Bacteria 2052
157 Ga0207712_10033049 3300025961 Bacteria 3495
158 Ga0207712_10049530 3300025961 Bacteria 2928
159 Ga0207640_10084875 3300025981 Bacteria 2175
160 Ga0207640_10112780 3300025981 Unclassified 1931
161 Ga0207640_10826977 3300025981 Bacteria 804
162 Ga0207677_10130234 3300026023 Bacteria 1909
163 Ga0207703_10206186 3300026035 Bacteria 1750
164 Ga0207639_10236861 3300026041 Unclassified 1585
165 Ga0207678_10013046 3300026067 Bacteria 7291
166 Ga0207678_10739652 3300026067 Bacteria 867
167 Ga0207708_10000908 3300026075 Bacteria 22266
168 Ga0207702_10006529 3300026078 Bacteria 10035
169 Ga0207702_10116001 3300026078 Bacteria 2389
170 Ga0207702_10119542 3300026078 Bacteria 2356
171 Ga0207641_10149004 3300026088 Bacteria 2118
172 Ga0207648_10047492 3300026089 Bacteria 3763
173 Ga0207648_10419273 3300026089 Bacteria 1215
174 Ga0207676_10199654 3300026095 Bacteria 1766
175 Ga0207676_10492275 3300026095 Bacteria 1163
176 Ga0207674_10170697 3300026116 Bacteria 2128
177 Ga0207675_100006465 3300026118 Bacteria 11097
178 Ga0207675_100100922 3300026118 Bacteria 2719
179 Ga0207675_100385754 3300026118 Bacteria 1378
180 Ga0207698_10885331 3300026142 Bacteria 899
181 Ga0268264_10204717 3300028381 Bacteria 1808
182 Ga0268264_10338785 3300028381 Bacteria 1428
183 Ga0307413_10358933 3300031824 Bacteria 1127
184 Ga0307412_10654972 3300031911 Bacteria 896
185 Ga0307409_100325833 3300031995 Bacteria 1439
186 Ga0307416_100047632 3300032002 Bacteria 3394
187 Ga0307416_100286961 3300032002 Bacteria 1627
188 Ga0307416_100785129 3300032002 Unclassified 1047
189 Ga0307411_10269550 3300032005 Bacteria 1349
190 Ga0307415_100109664 3300032126 Bacteria 2045
191 Ga0307415_100218123 3300032126 Bacteria 1527
192 Ga0307415_100448496 3300032126 Bacteria 1115
193 Ga0373931_0208231 3300035691 Bacteria 1172
194 Ga0395899_0013055 3300037312 Bacteria 6354
195 Ga0395899_0039119 3300037312 Bacteria 3551
196 Ga0395899_0252564 3300037312 Bacteria 1209
197 Ga0395900_0002688 3300037418 Bacteria 19446
198 Ga0395900_0006390 3300037418 Bacteria 12286
199 Ga0395900_0111403 3300037418 Bacteria 2811
200 Ga0395900_0112400 3300037418 Bacteria 2797
201 Ga0395900_0232454 3300037418 Bacteria 1853
202 Ga0395900_0533598 3300037418 Unclassified 1120
203 Ga0395898_0002917 3300037466 Bacteria 19461
204 Ga0395898_0015235 3300037466 Bacteria 7892
205 Ga0395898_0029299 3300037466 Bacteria 5516
206 Ga0395898_0207945 3300037466 Bacteria 1867
207 Ga0395898_0213101 3300037466 Bacteria 1842
208 Ga0395898_0230892 3300037466 Bacteria 1765
209 Ga0395898_0297733 3300037466 Bacteria 1539
210 Ga0395905_0001999 3300037471 Bacteria 23302
211 Ga0395905_0024488 3300037471 Bacteria 5695
212 Ga0395905_0044638 3300037471 Bacteria 4158
213 Ga0395905_0116478 3300037471 Bacteria 2511
214 Ga0395905_0136320 3300037471 Bacteria 2309
215 Ga0395905_0281461 3300037471 Unclassified 1549
216 Ga0395901_0005920 3300038443 Bacteria 12382
217 Ga0395901_0113123 3300038443 Bacteria 2850
218 Ga0395901_0140975 3300038443 Bacteria 2533
219 Ga0395901_0257338 3300038443 Bacteria 1817
220 Ga0395901_0290370 3300038443 Bacteria 1697
221 Ga0436365_0495709 3300039437 Bacteria 17887
222 Ga0466972_0015683 3300044658 Bacteria 3788
223 Ga0466966_0057578 3300044684 Bacteria 2457
224 Ga0466961_0024223 3300044693 Unclassified 3904
225 Ga0466961_0108787 3300044693 Bacteria 1745
226 Ga0466963_0006719 3300044694 Bacteria 6831
227 Ga0466964_0109524 3300044706 Unclassified 1230
228 Ga0466971_0017092 3300044719 Unclassified 3205
229 Ga0466960_0127818 3300044901 Bacteria 1338
230 Ga0466959_0061010 3300045049 Unclassified 2743
231 Ga0466958_0003936 3300045836 Bacteria 7788
232 Ga0466958_0059377 3300045836 Unclassified 2326
233 Ga0466958_0110597 3300045836 Bacteria 1715
234 Ga0466967_0173102 3300045976 Bacteria 2032
235 Ga0495629_0368144 3300046459 Bacteria 979
236 Ga0495596_0104839 3300046500 Bacteria 1098
237 Ga0495597_0148275 3300046542 Bacteria 964
238 Ga0495674_0514659 3300047319 Bacteria 956
239 Ga0495676_0113777 3300047321 Bacteria 1981
240 Ga0496100_0409281 3300048903 Unclassified 1034
241 Ga0496100_0492546 3300048903 Bacteria 944
242 Ga0496101_0238556 3300048904 Bacteria 1415
243 Ga0496102_0007222 3300048905 Bacteria 9481
244 Ga0496102_0448547 3300048905 Bacteria 1210
245 Ga0496103_0162994 3300048906 Unclassified 1430
246 Ga0496104_0028902 3300048907 Bacteria 5141
247 Ga0496104_0124471 3300048907 Bacteria 2475
248 Ga0496104_0203309 3300048907 Bacteria 1892
249 Ga0496105_0009179 3300048908 Bacteria 7720
250 Ga0496105_0048035 3300048908 Unclassified 3523
251 Ga0496106_0015583 3300048909 Bacteria 5622
252 Ga0496106_0550792 3300048909 Bacteria 925
253 Ga0496107_0030291 3300048910 Bacteria 3857
254 Ga0496107_0065893 3300048910 Bacteria 2626
255 Ga0496107_0102906 3300048910 Bacteria 2095
256 Ga0496108_0008562 3300048911 Bacteria 8295
257 Ga0496108_0066147 3300048911 Bacteria 3048
258 Ga0496108_0093274 3300048911 Bacteria 2561
259 Ga0496109_0063608 3300048912 Bacteria 3375
260 Ga0496109_0105655 3300048912 Bacteria 2615
261 Ga0496109_0131631 3300048912 Unclassified 2335
262 Ga0496109_0369971 3300048912 Bacteria 1354
263 Ga0496110_0006277 3300048913 Bacteria 9382
264 Ga0496110_0145957 3300048913 Unclassified 2140
265 Ga0496110_0474436 3300048913 Bacteria 1140
266 Ga0496111_0001287 3300048914 Bacteria 14053
267 Ga0496111_0264073 3300048914 Bacteria 1277
268 Ga0496112_0003603 3300048915 Bacteria 12887
269 Ga0496112_0010536 3300048915 Bacteria 8393
270 Ga0496112_0017699 3300048915 Bacteria 6704
271 Ga0496112_0025318 3300048915 Bacteria 5698
272 Ga0496112_0053296 3300048915 Unclassified 3972
273 Ga0496112_0241098 3300048915 Bacteria 1761
274 Ga0496113_0014749 3300048916 Bacteria 5345
275 Ga0496113_0035182 3300048916 Bacteria 3662
276 Ga0496113_0067230 3300048916 Bacteria 2717
277 Ga0496113_0154326 3300048916 Unclassified 1812
278 Ga0496113_0271853 3300048916 Bacteria 1354
279 Ga0496115_0053736 3300048918 Bacteria 3233
280 Ga0496115_0145748 3300048918 Unclassified 1954
281 Ga0501032_0265021 3300049569 Bacteria 1114
282 Ga0501036_0065753 3300049572 Bacteria 3068
283 Ga0501038_0082158 3300049574 Bacteria 2713
284 Ga0501038_0254428 3300049574 Bacteria 1390
285 Ga0501039_0150501 3300049575 Bacteria 1828
286 Ga0501040_0024897 3300049576 Bacteria 4021
287 Ga0501041_0071604 3300049577 Bacteria 2128
288 Ga0501041_0079597 3300049577 Bacteria 2017
289 Ga0501041_0234976 3300049577 Bacteria 1151
290 Ga0501042_0080592 3300049578 Bacteria 2332
291 Ga0501042_0139230 3300049578 Bacteria 1749
292 Ga0501042_0212366 3300049578 Bacteria 1396
293 Ga0501071_0151799 3300049587 Bacteria 1728
294 Ga0501071_0268503 3300049587 Bacteria 1289
295 Ga0501072_0016121 3300049588 Bacteria 5731
296 Ga0501072_0113847 3300049588 Bacteria 2154
297 Ga0501072_0191509 3300049588 Bacteria 1631
298 Ga0501074_0128916 3300049590 Bacteria 1810
299 Ga0501075_0031521 3300049591 Bacteria 3935
300 Ga0501075_0175859 3300049591 Bacteria 1633
301 Ga0501076_0195279 3300049592 Bacteria 1652
302 Ga0501079_0036820 3300049741 Bacteria 3769
303 Ga0501081_0076503 3300049743 Bacteria 2337
304 Ga0501035_0178291 3300049822 Bacteria 1832
305 Ga0501045_0040013 3300049824 Bacteria 3411
306 Ga0501045_0471553 3300049824 Bacteria 933
307 nmdc:mga00v17_287359_c1 3300050491 Bacteria 1068
308 nmdc:mga00v17_5164_c1 3300050491 Bacteria 6867
309 nmdc:mga0yw44_16123_c1 3300050492 Bacteria 4029
310 nmdc:mga0yw44_50544_c1 3300050492 Bacteria 2514
311 nmdc:mga0yw44_5075_c1 3300050492 Bacteria 6152
312 nmdc:mga05p37_47905_c1 3300050507 Bacteria 5256
313 nmdc:mga05p37_535474_c1 3300050507 Bacteria 1337
314 nmdc:mga06r32_169561_c1 3300050510 Unclassified 2166
315 nmdc:mga06r32_211488_c1 3300050510 Bacteria 1927
316 nmdc:mga08y16_236859_c1 3300050511 Bacteria 1887
317 nmdc:mga08y16_61185_c1 3300050511 Bacteria 3932
318 nmdc:mga0n895_148724_c1 3300050512 Bacteria 2371
319 nmdc:mga0n895_341561_c1 3300050512 Unclassified 1516
320 nmdc:mga0n895_488294_c1 3300050512 Bacteria 1241
321 nmdc:mga0rr50_664234_c1 3300050513 Bacteria 889
322 nmdc:mga0a205_230661_c1 3300050515 Bacteria 1734
323 Ga0501084_0202496 3300054114 Bacteria 1675
324 Ga0501082_0405708 3300060353 Bacteria 1189
325 Ga0466962_0012195 3300061719 Bacteria 4131
326 Ga0466962_0035105 3300061719 Unclassified 2400
327 Ga0530510_0006485 3300061734 Bacteria 8148
328 Ga0530510_0024147 3300061734 Bacteria 4337
329 Ga0530510_0425480 3300061734 Unclassified 1003
330 Ga0496101_0085369
331 Ga0070683_100047906
332 Ga0070683_100281342
333 Ga0068869_100031617
334 Ga0068868_100021808
335 Ga0068868_100054695
336 Ga0070660_100157584
337 Ga0070660_100442412
338 Ga0070689_100120787
339 Ga0070661_100147325
340 Ga0070668_100113257
341 Ga0070668_100353175
342 Ga0070669_100064491
343 Ga0070674_100290920
344 Ga0070659_100004299
345 Ga0070659_100088395
346 Ga0070659_100144242
347 Ga0070709_10237071
348 Ga0070714_100125188
349 Ga0070713_100035165
350 Ga0070713_100396378
351 Ga0070710_10017915
352 Ga0070710_10103783
353 Ga0070711_100246152
354 Ga0070705_100130801
355 Ga0070700_100002169
356 Ga0068867_100361115
357 Ga0068867_100844170
358 Ga0070685_10107571
359 Ga0070707_100090336
360 Ga0070698_100015469
361 Ga0070698_100068120
362 Ga0070699_100008899
363 Ga0070684_100054052
364 Ga0070684_100348510
365 Ga0068853_100229834
366 Ga0070665_100127761
367 Ga0070665_100314615
368 Ga0070704_100345899
369 Ga0070664_100029029
370 Ga0068857_100081449
371 Ga0068854_100053587
372 Ga0068854_100290102
373 Ga0068856_100001452
374 Ga0068856_100260772
375 Ga0070702_100019806
376 Ga0070702_100031580
377 Ga0068859_100130547
378 Ga0068864_100173301
379 Ga0068864_100269006
380 Ga0068866_10046473
381 Ga0068861_100061334
382 Ga0068861_100117204
383 Ga0068863_100428701
384 Ga0068858_100063338
385 Ga0068858_100121806
386 Ga0068858_100231705
387 Ga0068860_100317010
388 Ga0081455_10014917
389 Ga0081455_10045668
390 Ga0081455_10116910
391 Ga0081455_10475911
392 Ga0081538_10000110
393 Ga0081538_10000318
394 Ga0081538_10000329
395 Ga0081538_10000559
396 Ga0081538_10002098
397 Ga0081538_10004056
398 Ga0081538_10005423
399 Ga0081538_10008043
400 Ga0081538_10068396
401 Ga0081540_1000556
402 Ga0081539_10032507
403 Ga0070717_10200590
404 Ga0075365_10001325
405 Ga0075365_10018232
406 Ga0075365_10035533
407 Ga0075365_10047761
408 Ga0075365_10218017
409 Ga0075364_10062494
410 Ga0075364_10285746
411 Ga0070715_10050359
412 Ga0070716_100008994
413 Ga0075367_10091910
414 Ga0097621_100244717
415 Ga0075428_100069445
416 Ga0075428_100143681
417 Ga0075428_100240013
418 Ga0075430_100187461
419 Ga0075431_100028837
420 Ga0075431_100195086
421 Ga0075434_100436843
422 Ga0075434_100766932
423 Ga0075429_100293160
424 Ga0097620_100130543
425 Ga0111539_10067164
426 Ga0111539_10241838
427 Ga0111539_10419067
428 Ga0105245_10008381
429 Ga0105245_10043975
430 Ga0105245_10148005
431 Ga0105247_10078678
432 Ga0114129_10123143
433 Ga0105243_10006637
434 Ga0105243_10086556
435 Ga0105241_10122839
436 Ga0105242_10027602
437 Ga0105242_10342285
438 Ga0105242_10751232
439 Ga0105249_10071893
440 Ga0105239_10038955
441 Ga0105239_10162843
442 Ga0105246_10040689
443 Ga0157369_10778624
444 Ga0157374_10064348
445 Ga0163162_10360288
446 Ga0157372_10224526
447 Ga0163163_10296000
448 Ga0163163_10310182
449 Ga0157380_10675672
450 Ga0182008_10173345
451 Ga0157377_10022558
452 Ga0157377_10025307
453 Ga0163161_10486631
454 Ga0213876_10002137
455 Ga0224712_10074527
456 Ga0207426_1006359
457 Ga0207653_10059321
458 Ga0207710_10099112
459 Ga0207688_10000207
460 Ga0207688_10189746
461 Ga0207685_10071591
462 Ga0207699_10069985
463 Ga0207699_10211923
464 Ga0207684_10213381
465 Ga0207693_10044038
466 Ga0207693_10207496
467 Ga0207663_10203871
468 Ga0207662_10100547
469 Ga0207649_10286029
470 Ga0207646_10056259
471 Ga0207659_10475469
472 Ga0207687_10066509
473 Ga0207687_10272003
474 Ga0207700_10010513
475 Ga0207700_10045913
476 Ga0207664_10088809
477 Ga0207664_10266391
478 Ga0207664_10301766
479 Ga0207644_10406843
480 Ga0207706_10198872
481 Ga0207706_10671297
482 Ga0207669_10348381
483 Ga0207704_10048630
484 Ga0207704_10112122
485 Ga0207679_10125210
486 Ga0207712_10033049
487 Ga0207712_10049530
488 Ga0207640_10084875
489 Ga0207640_10112780
490 Ga0207640_10826977
491 Ga0207677_10130234
492 Ga0207703_10206186
493 Ga0207639_10236861
494 Ga0207678_10013046
495 Ga0207678_10739652
496 Ga0207708_10000908
497 Ga0207702_10006529
498 Ga0207702_10116001
499 Ga0207702_10119542
500 Ga0207641_10149004
501 Ga0207648_10047492
502 Ga0207648_10419273
503 Ga0207676_10199654
504 Ga0207676_10492275
505 Ga0207674_10170697
506 Ga0207675_100006465
507 Ga0207675_100100922
508 Ga0207675_100385754
509 Ga0207698_10885331
510 Ga0268264_10204717
511 Ga0268264_10338785
512 Ga0307413_10358933
513 Ga0307412_10654972
514 Ga0307409_100325833
515 Ga0307416_100047632
516 Ga0307416_100286961
517 Ga0307416_100785129
518 Ga0307411_10269550
519 Ga0307415_100109664
520 Ga0307415_100218123
521 Ga0307415_100448496
522 Ga0373931_0208231
523 Ga0395899_0013055
524 Ga0395899_0039119
525 Ga0395899_0252564
526 Ga0395900_0002688
527 Ga0395900_0006390
528 Ga0395900_0111403
529 Ga0395900_0112400
530 Ga0395900_0232454
531 Ga0395900_0533598
532 Ga0395898_0002917
533 Ga0395898_0015235
534 Ga0395898_0029299
535 Ga0395898_0207945
536 Ga0395898_0213101
537 Ga0395898_0230892
538 Ga0395898_0297733
539 Ga0395905_0001999
540 Ga0395905_0024488
541 Ga0395905_0044638
542 Ga0395905_0116478
543 Ga0395905_0136320
544 Ga0395905_0281461
545 Ga0395901_0005920
546 Ga0395901_0113123
547 Ga0395901_0140975
548 Ga0395901_0257338
549 Ga0395901_0290370
550 Ga0436365_0495709
551 Ga0466972_0015683
552 Ga0466966_0057578
553 Ga0466961_0024223
554 Ga0466961_0108787
555 Ga0466963_0006719
556 Ga0466964_0109524
557 Ga0466971_0017092
558 Ga0466960_0127818
559 Ga0466959_0061010
560 Ga0466958_0003936
561 Ga0466958_0059377
562 Ga0466958_0110597
563 Ga0466967_0173102
564 Ga0495629_0368144
565 Ga0495596_0104839
566 Ga0495597_0148275
567 Ga0495674_0514659
568 Ga0495676_0113777
569 Ga0496100_0409281
570 Ga0496100_0492546
571 Ga0496101_0238556
572 Ga0496102_0007222
573 Ga0496102_0448547
574 Ga0496103_0162994
575 Ga0496104_0028902
576 Ga0496104_0124471
577 Ga0496104_0203309
578 Ga0496105_0009179
579 Ga0496105_0048035
580 Ga0496106_0015583
581 Ga0496106_0550792
582 Ga0496107_0030291
583 Ga0496107_0065893
584 Ga0496107_0102906
585 Ga0496108_0008562
586 Ga0496108_0066147
587 Ga0496108_0093274
588 Ga0496109_0063608
589 Ga0496109_0105655
590 Ga0496109_0131631
591 Ga0496109_0369971
592 Ga0496110_0006277
593 Ga0496110_0145957
594 Ga0496110_0474436
595 Ga0496111_0001287
596 Ga0496111_0264073
597 Ga0496112_0003603
598 Ga0496112_0010536
599 Ga0496112_0017699
600 Ga0496112_0025318
601 Ga0496112_0053296
602 Ga0496112_0241098
603 Ga0496113_0014749
604 Ga0496113_0035182
605 Ga0496113_0067230
606 Ga0496113_0154326
607 Ga0496113_0271853
608 Ga0496115_0053736
609 Ga0496115_0145748
610 Ga0501032_0265021
611 Ga0501036_0065753
612 Ga0501038_0082158
613 Ga0501038_0254428
614 Ga0501039_0150501
615 Ga0501040_0024897
616 Ga0501041_0071604
617 Ga0501041_0079597
618 Ga0501041_0234976
619 Ga0501042_0080592
620 Ga0501042_0139230
621 Ga0501042_0212366
622 Ga0501071_0151799
623 Ga0501071_0268503
624 Ga0501072_0016121
625 Ga0501072_0113847
626 Ga0501072_0191509
627 Ga0501074_0128916
628 Ga0501075_0031521
629 Ga0501075_0175859
630 Ga0501076_0195279
631 Ga0501079_0036820
632 Ga0501081_0076503
633 Ga0501035_0178291
634 Ga0501045_0040013
635 Ga0501045_0471553
636 nmdc:mga00v17_287359_c1
637 nmdc:mga00v17_5164_c1
638 nmdc:mga0yw44_16123_c1
639 nmdc:mga0yw44_50544_c1
640 nmdc:mga0yw44_5075_c1
641 nmdc:mga05p37_47905_c1
642 nmdc:mga05p37_535474_c1
643 nmdc:mga06r32_169561_c1
644 nmdc:mga06r32_211488_c1
645 nmdc:mga08y16_236859_c1
646 nmdc:mga08y16_61185_c1
647 nmdc:mga0n895_148724_c1
648 nmdc:mga0n895_341561_c1
649 nmdc:mga0n895_488294_c1
650 nmdc:mga0rr50_664234_c1
651 nmdc:mga0a205_230661_c1
652 Ga0501084_0202496
653 Ga0501082_0405708
654 Ga0466962_0012195
655 Ga0466962_0035105
656 Ga0530510_0006485
657 Ga0530510_0024147
658 Ga0530510_0425480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

152

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

40

208

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jkh-assembly1.cif.gz_B the nad+-bound form of human nsdhl 0.8812 8 135
6jkh-assembly1.cif.gz_A the nad+-bound form of human nsdhl 0.8727 8 136
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8528 7 136
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.836 8 220
6rfs-assembly1.cif.gz_E cryo-em structure of a respiratory complex i mutant lacking ndufs4 0.8323 8 220
ID Description Score Start End Superfamily
af_P76113_12_234_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.945 7 38 3.40.50.2300
af_Q5QMG5_99_194_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8711 7 63 3.40.50.720
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8682 8 93 3.40.50.20
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8549 6 63 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.851 8 135 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537L1H2-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.992 8 90
AF-A0A2V5WFZ3-F1-model_v4 NmrA family transcriptional regulator 0.985 9 100
AF-A0A3B4CG98-F1-model_v4 deleted 0.982 9 122
AF-A0A4V1T6H8-F1-model_v4 deleted 0.9816 9 98
AF-A0A6A7L888-F1-model_v4 Epimerase 0.9792 9 260

Map