F409758

General Info

Members Datasets Scaffolds Average Seq Length
329 163 658 259

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_255224|Ga0400483_255224_133_1002
Length 289
Sequence MEKRIGYAISPGKIGTDWLETFRKLQSVGWNMLTKRIIPCLDVRNKVVTKGIKFQNNIDLGDPIEMAVAYSDGGCDELVFYDITASAERRPIDIEMVADVARNIRIPFAVGGGISTLDDMYAVLHAGAEKVSVNSLAVKNPQLIAEGARAFGNQNIVLGMDPVQTDDPKFPSGYEITIRGFRERTGLDALEWAKKAEALGVGEIVVNSVDADGTRDGFELHLTSMISDNVNIPVVASGGGGTPQHLIDVFTAGKADAAIIASMIHTGEYTITEIKEPLIEAGVPIRKKW

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
86 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
87 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
88 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
91 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
92 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 1.22
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_255224 3300039062 Bacteria 1118
2 Ga0070658_10106142 3300005327 Unclassified 2324
3 Ga0070690_100002396 3300005330 Bacteria 10066
4 Ga0070690_100079384 3300005330 Bacteria 2146
5 Ga0070690_100143727 3300005330 Bacteria 1621
6 Ga0070690_100158664 3300005330 Bacteria 1548
7 Ga0070677_10121724 3300005333 Bacteria 1179
8 Ga0070680_100237906 3300005336 Bacteria 1539
9 Ga0070689_100022159 3300005340 Bacteria 4740
10 Ga0070689_100042818 3300005340 Bacteria 3478
11 Ga0070689_100507211 3300005340 Bacteria 1034
12 Ga0070691_10041870 3300005341 Bacteria 2167
13 Ga0070688_100112709 3300005365 Bacteria 1811
14 Ga0070688_100198224 3300005365 Bacteria 1403
15 Ga0070714_100004229 3300005435 Bacteria 10814
16 Ga0070701_10029277 3300005438 Bacteria 2714
17 Ga0070711_100580416 3300005439 Unclassified 933
18 Ga0070700_100560250 3300005441 Bacteria 889
19 Ga0070694_100159186 3300005444 Bacteria 1655
20 Ga0070681_10181438 3300005458 Bacteria 2026
21 Ga0070681_10486052 3300005458 Bacteria 1147
22 Ga0070706_100104134 3300005467 Bacteria 2639
23 Ga0070706_100160887 3300005467 Bacteria 2096
24 Ga0070707_100195881 3300005468 Bacteria 1970
25 Ga0070698_100126719 3300005471 Bacteria 2510
26 Ga0070699_100249075 3300005518 Bacteria 1587
27 Ga0070686_100004003 3300005544 Bacteria 8103
28 Ga0068855_100005965 3300005563 Bacteria 14859
29 Ga0068855_100043930 3300005563 Bacteria 5291
30 Ga0068855_100058633 3300005563 Bacteria 4507
31 Ga0068855_100113842 3300005563 Bacteria 3102
32 Ga0068855_100387857 3300005563 Unclassified 1533
33 Ga0068855_100418538 3300005563 Unclassified 1466
34 Ga0068857_100631537 3300005577 Bacteria 1014
35 Ga0068854_100323561 3300005578 Bacteria 1254
36 Ga0068856_100002814 3300005614 Bacteria 17814
37 Ga0068856_100045454 3300005614 Bacteria 4324
38 Ga0068856_100240783 3300005614 Bacteria 1824
39 Ga0068859_100007802 3300005617 Bacteria 10864
40 Ga0068859_100289757 3300005617 Unclassified 1730
41 Ga0068859_100649461 3300005617 Bacteria 1147
42 Ga0068859_100841032 3300005617 Bacteria 1004
43 Ga0068863_100178215 3300005841 Bacteria 2040
44 Ga0068863_100597303 3300005841 Bacteria 1092
45 Ga0081455_10109893 3300005937 Bacteria 2193
46 Ga0070717_10166490 3300006028 Bacteria 1915
47 Ga0070717_10267023 3300006028 Bacteria 1515
48 Ga0075428_100002580 3300006844 Bacteria 19675
49 Ga0075428_100060558 3300006844 Bacteria 4145
50 Ga0075428_100621909 3300006844 Bacteria 1153
51 Ga0075430_100368032 3300006846 Bacteria 1187
52 Ga0075431_100098818 3300006847 Bacteria 3013
53 Ga0075431_100240425 3300006847 Bacteria 1842
54 Ga0075431_100245889 3300006847 Bacteria 1818
55 Ga0075433_10434019 3300006852 Bacteria 1158
56 Ga0097620_100289751 3300006931 Unclassified 1730
57 Ga0097620_100649473 3300006931 Bacteria 1147
58 Ga0097620_100841119 3300006931 Bacteria 1004
59 Ga0105240_10031649 3300009093 Bacteria 6855
60 Ga0105240_10039616 3300009093 Bacteria 6032
61 Ga0105240_10062483 3300009093 Bacteria 4636
62 Ga0105240_10288880 3300009093 Bacteria 1881
63 Ga0105240_10334935 3300009093 Bacteria 1721
64 Ga0111539_10098730 3300009094 Bacteria 3429
65 Ga0111539_10151702 3300009094 Bacteria 2712
66 Ga0105245_10153311 3300009098 Bacteria 2181
67 Ga0114129_10464141 3300009147 Bacteria 1659
68 Ga0105238_10006106 3300009551 Bacteria 11949
69 Ga0105238_10090992 3300009551 Bacteria 3039
70 Ga0099796_10090448 3300010159 Bacteria 1137
71 Ga0157371_10026246 3300013102 Bacteria 4236
72 Ga0157370_10060410 3300013104 Bacteria 3599
73 Ga0157369_10120304 3300013105 Bacteria 2787
74 Ga0157369_10482971 3300013105 Unclassified 1282
75 Ga0157374_10249385 3300013296 Bacteria 1747
76 Ga0157378_10070656 3300013297 Bacteria 3135
77 Ga0157372_10160017 3300013307 Bacteria 2602
78 Ga0157372_10209094 3300013307 Bacteria 2261
79 Ga0157372_10214847 3300013307 Bacteria 2229
80 Ga0157375_10000040 3300013308 Bacteria 164344
81 Ga0157375_10423580 3300013308 Bacteria 1497
82 Ga0157375_10845064 3300013308 Bacteria 1062
83 Ga0163163_10000014 3300014325 Bacteria 231615
84 Ga0163163_10368172 3300014325 Bacteria 1494
85 Ga0157379_10460501 3300014968 Bacteria 1175
86 Ga0213876_10067031 3300021384 Bacteria 1895
87 Ga0213876_10124445 3300021384 Bacteria 1369
88 Ga0213875_10049088 3300021388 Bacteria 1978
89 Ga0207705_10075329 3300025909 Unclassified 2451
90 Ga0207707_10115964 3300025912 Bacteria 2340
91 Ga0207695_10000061 3300025913 Bacteria 359827
92 Ga0207695_10073373 3300025913 Bacteria 3487
93 Ga0207695_10102986 3300025913 Bacteria 2847
94 Ga0207693_10142927 3300025915 Bacteria 1881
95 Ga0207663_10178177 3300025916 Bacteria 1516
96 Ga0207652_10349283 3300025921 Unclassified 1335
97 Ga0207652_10684124 3300025921 Bacteria 916
98 Ga0207694_10009215 3300025924 Bacteria 7448
99 Ga0207694_10239792 3300025924 Bacteria 1482
100 Ga0207687_10187131 3300025927 Bacteria 1608
101 Ga0207664_10006609 3300025929 Bacteria 7985
102 Ga0207670_10004129 3300025936 Bacteria 7777
103 Ga0207670_10005439 3300025936 Bacteria 6988
104 Ga0207667_10007341 3300025949 Bacteria 13267
105 Ga0207667_10200846 3300025949 Bacteria 2045
106 Ga0207667_10210700 3300025949 Bacteria 1992
107 Ga0207667_10318653 3300025949 Bacteria 1588
108 Ga0207667_10402285 3300025949 Unclassified 1394
109 Ga0207667_10485398 3300025949 Unclassified 1254
110 Ga0207702_10032301 3300026078 Bacteria 4368
111 Ga0207702_10056673 3300026078 Bacteria 3328
112 Ga0207641_10065601 3300026088 Bacteria 3106
113 Ga0207676_10243523 3300026095 Bacteria 1615
114 Ga0207674_10029154 3300026116 Bacteria 5815
115 Ga0207674_10712674 3300026116 Bacteria 969
116 Ga0265337_1001799 3300028556 Bacteria 10318
117 Ga0265337_1002486 3300028556 Bacteria 8405
118 Ga0265337_1003480 3300028556 Bacteria 6803
119 Ga0265337_1016626 3300028556 Bacteria 2373
120 Ga0265337_1018616 3300028556 Bacteria 2202
121 Ga0265326_10067567 3300028558 Bacteria 1010
122 Ga0265319_1000001 3300028563 Bacteria 549513
123 Ga0265319_1028159 3300028563 Bacteria 1983
124 Ga0265334_10012943 3300028573 Bacteria 3499
125 Ga0265334_10015663 3300028573 Bacteria 3147
126 Ga0265334_10020104 3300028573 Bacteria 2738
127 Ga0265318_10039409 3300028577 Bacteria 1803
128 Ga0265318_10040723 3300028577 Bacteria 1768
129 Ga0265323_10000230 3300028653 Bacteria 32958
130 Ga0265323_10019842 3300028653 Bacteria 2591
131 Ga0265323_10093988 3300028653 Bacteria 998
132 Ga0265336_10001748 3300028666 Bacteria 9524
133 Ga0265336_10035040 3300028666 Bacteria 1549
134 Ga0265338_10000736 3300028800 Bacteria 55849
135 Ga0265338_10000991 3300028800 Bacteria 47857
136 Ga0265338_10001071 3300028800 Bacteria 45427
137 Ga0265338_10001117 3300028800 Bacteria 44576
138 Ga0265338_10001288 3300028800 Bacteria 41141
139 Ga0265338_10001595 3300028800 Bacteria 36398
140 Ga0265338_10001998 3300028800 Bacteria 31691
141 Ga0265338_10002692 3300028800 Bacteria 26111
142 Ga0265338_10005359 3300028800 Bacteria 16771
143 Ga0265338_10005525 3300028800 Bacteria 16480
144 Ga0265338_10010079 3300028800 Bacteria 11165
145 Ga0265338_10015783 3300028800 Bacteria 8271
146 Ga0265338_10023833 3300028800 Bacteria 6275
147 Ga0265338_10033474 3300028800 Bacteria 4985
148 Ga0265338_10038108 3300028800 Bacteria 4560
149 Ga0265338_10039660 3300028800 Bacteria 4438
150 Ga0265338_10051355 3300028800 Bacteria 3713
151 Ga0265338_10061914 3300028800 Bacteria 3276
152 Ga0265338_10091231 3300028800 Bacteria 2518
153 Ga0265338_10112522 3300028800 Bacteria 2189
154 Ga0265338_10199363 3300028800 Bacteria 1510
155 Ga0265338_10255423 3300028800 Bacteria 1291
156 Ga0265324_10000330 3300029957 Bacteria 34837
157 Ga0265324_10000613 3300029957 Bacteria 24352
158 Ga0265324_10006687 3300029957 Bacteria 4765
159 Ga0265324_10030403 3300029957 Bacteria 1895
160 Ga0265324_10046009 3300029957 Bacteria 1502
161 Ga0265324_10057408 3300029957 Bacteria 1332
162 Ga0265332_10112177 3300031238 Bacteria 1148
163 Ga0265332_10136935 3300031238 Bacteria 1026
164 Ga0265328_10022655 3300031239 Bacteria 2388
165 Ga0265320_10000414 3300031240 Bacteria 33864
166 Ga0265320_10001493 3300031240 Bacteria 17059
167 Ga0265320_10007918 3300031240 Bacteria 6557
168 Ga0265320_10010543 3300031240 Bacteria 5493
169 Ga0265320_10035196 3300031240 Bacteria 2540
170 Ga0265320_10053866 3300031240 Bacteria 1942
171 Ga0265320_10107910 3300031240 Bacteria 1277
172 Ga0265320_10158290 3300031240 Bacteria 1021
173 Ga0265325_10063050 3300031241 Bacteria 1876
174 Ga0265340_10003804 3300031247 Bacteria 8505
175 Ga0265340_10100210 3300031247 Bacteria 1347
176 Ga0265340_10108148 3300031247 Bacteria 1287
177 Ga0265339_10005306 3300031249 Bacteria 8594
178 Ga0265339_10143386 3300031249 Bacteria 1213
179 Ga0265327_10003039 3300031251 Bacteria 16619
180 Ga0265327_10026812 3300031251 Bacteria 3329
181 Ga0265327_10036047 3300031251 Bacteria 2724
182 Ga0265316_10019843 3300031344 Bacteria 5738
183 Ga0265316_10033432 3300031344 Bacteria 4189
184 Ga0265316_10083428 3300031344 Bacteria 2448
185 Ga0265316_10230681 3300031344 Bacteria 1363
186 Ga0265316_10233786 3300031344 Bacteria 1353
187 Ga0265316_10340855 3300031344 Bacteria 1086
188 Ga0265313_10003801 3300031595 Bacteria 11959
189 Ga0265313_10013413 3300031595 Bacteria 4920
190 Ga0265314_10006431 3300031711 Bacteria 10406
191 Ga0265314_10013850 3300031711 Bacteria 6493
192 Ga0265314_10023516 3300031711 Bacteria 4696
193 Ga0265314_10082912 3300031711 Bacteria 2109
194 Ga0265314_10100811 3300031711 Bacteria 1856
195 Ga0265314_10211315 3300031711 Bacteria 1139
196 Ga0265342_10015316 3300031712 Bacteria 5049
197 Ga0373930_0001632 3300034816 Bacteria 3381
198 Ga0373950_0001778 3300034818 Bacteria 2869
199 Ga0373928_0000318 3300035084 Bacteria 9602
200 Ga0373929_0001450 3300035085 Bacteria 4519
201 Ga0373944_0000152 3300035089 Bacteria 13680
202 Ga0373949_0000789 3300035090 Bacteria 10203
203 Ga0373951_0002424 3300035091 Bacteria 4705
204 Ga0373932_0000001 3300035112 Bacteria 1459067
205 Ga0373945_0049852 3300035116 Bacteria 1537
206 Ga0373954_0103486 3300035118 Bacteria 1374
207 Ga0373956_0014072 3300035119 Bacteria 3337
208 Ga0373956_0042958 3300035119 Bacteria 2011
209 Ga0373943_0026310 3300035170 Bacteria 2725
210 Ga0373943_0284118 3300035170 Bacteria 936
211 Ga0373946_0046627 3300035171 Bacteria 1797
212 Ga0373931_0000004 3300035691 Bacteria 535140
213 Ga0373931_0184626 3300035691 Bacteria 1237
214 Ga0373935_0078144 3300035692 Bacteria 2146
215 Ga0373935_0160294 3300035692 Bacteria 1533
216 Ga0373927_0003699 3300035695 Bacteria 10879
217 Ga0373927_0020810 3300035695 Bacteria 4300
218 Ga0373927_0044655 3300035695 Bacteria 2866
219 Ga0373933_0037335 3300035724 Bacteria 2849
220 Ga0373933_0108951 3300035724 Bacteria 1726
221 Ga0373947_0004199 3300035725 Bacteria 8451
222 Ga0373947_0061751 3300035725 Unclassified 2278
223 Ga0373947_0118216 3300035725 Bacteria 1682
224 Ga0373937_0005368 3300036401 Bacteria 10962
225 Ga0373937_0042510 3300036401 Bacteria 4147
226 Ga0373925_0000397 3300037068 Bacteria 44579
227 Ga0373925_0003523 3300037068 Bacteria 12080
228 Ga0373925_0066843 3300037068 Bacteria 2710
229 Ga0373925_0129865 3300037068 Bacteria 1964
230 Ga0436364_0269808 3300037853 Bacteria 4488
231 Ga0436364_1088487 3300037853 Bacteria 26750
232 Ga0400489_54263 3300039093 Bacteria 5094
233 Ga0436365_1281712 3300039437 Bacteria 80367
234 Ga0436365_1608188 3300039437 Bacteria 2573
235 Ga0436365_1824550 3300039437 Bacteria 7124
236 Ga0436362_0176398 3300039453 Bacteria 1638
237 Ga0451577_0000986 3300042876 Bacteria 41404
238 Ga0451577_0005580 3300042876 Bacteria 12812
239 Ga0451577_0012261 3300042876 Bacteria 8055
240 Ga0451577_0041368 3300042876 Bacteria 4136
241 Ga0451577_0138600 3300042876 Bacteria 2185
242 Ga0451577_0258670 3300042876 Bacteria 1576
243 Ga0451577_0644705 3300042876 Bacteria 961
244 Ga0466972_0051842 3300044658 Bacteria 1979
245 Ga0453684_0000192 3300044712 Bacteria 266757
246 Ga0453684_0003390 3300044712 Bacteria 36045
247 Ga0453684_0007891 3300044712 Bacteria 19328
248 Ga0453684_0098871 3300044712 Bacteria 3576
249 Ga0451576_0015415 3300045051 Bacteria 8467
250 Ga0451576_0037398 3300045051 Bacteria 5142
251 Ga0451576_0099468 3300045051 Bacteria 3026
252 Ga0451576_0294390 3300045051 Bacteria 1697
253 Ga0451576_0322787 3300045051 Bacteria 1616
254 Ga0451576_0357075 3300045051 Bacteria 1530
255 Ga0451576_0363479 3300045051 Bacteria 1516
256 Ga0451576_0544456 3300045051 Bacteria 1219
257 Ga0451576_0779355 3300045051 Bacteria 1004
258 Ga0495592_0000071 3300046454 Bacteria 92699
259 Ga0495592_0316992 3300046454 Unclassified 1009
260 Ga0495641_0010527 3300046461 Bacteria 5354
261 Ga0495651_0121545 3300046462 Bacteria 1918
262 Ga0495662_0018873 3300046476 Unclassified 3337
263 Ga0495618_0001609 3300046514 Bacteria 15065
264 Ga0495618_0029704 3300046514 Bacteria 3410
265 Ga0495628_0000197 3300046516 Bacteria 52941
266 Ga0495630_0000558 3300046517 Bacteria 27128
267 Ga0495630_0022471 3300046517 Bacteria 4659
268 Ga0495666_0025441 3300046526 Bacteria 2922
269 Ga0495666_0061646 3300046526 Bacteria 1792
270 Ga0495640_0077423 3300046533 Unclassified 2217
271 Ga0495640_0283646 3300046533 Bacteria 1031
272 Ga0495586_0000212 3300046535 Bacteria 38899
273 Ga0495586_0001433 3300046535 Bacteria 13198
274 Ga0495586_0004563 3300046535 Bacteria 7403
275 Ga0495586_0069312 3300046535 Unclassified 1925
276 Ga0495645_0010263 3300046543 Bacteria 6565
277 Ga0495645_0064808 3300046543 Unclassified 2643
278 Ga0495645_0201494 3300046543 Bacteria 1350
279 Ga0495667_0052451 3300046559 Bacteria 2687
280 Ga0495634_0007762 3300046642 Bacteria 8027
281 Ga0495634_0076185 3300046642 Unclassified 2202
282 Ga0495625_0193543 3300046660 Bacteria 1346
283 Ga0495657_0260295 3300046675 Bacteria 1042
284 Ga0495599_0011846 3300046678 Bacteria 5362
285 Ga0495599_0027257 3300046678 Bacteria 3581
286 Ga0495647_0041373 3300046681 Bacteria 1755
287 Ga0495658_0038877 3300046683 Unclassified 2637
288 Ga0495658_0218956 3300046683 Bacteria 1191
289 Ga0495669_0084461 3300046684 Unclassified 1460
290 Ga0495613_0004437 3300046689 Bacteria 10512
291 Ga0495613_0052747 3300046689 Unclassified 2994
292 Ga0495613_0193395 3300046689 Bacteria 1437
293 Ga0495613_0436392 3300046689 Bacteria 889
294 Ga0495624_0027849 3300046690 Bacteria 3696
295 Ga0495624_0247645 3300046690 Bacteria 1078
296 Ga0495600_0150551 3300046809 Bacteria 1507
297 Ga0495581_0020513 3300047315 Unclassified 3835
298 Ga0495674_0008917 3300047319 Bacteria 9540
299 Ga0495674_0031820 3300047319 Bacteria 4788
300 Ga0495674_0198274 3300047319 Bacteria 1666
301 Ga0495676_0036952 3300047321 Unclassified 4072
302 Ga0495680_0061883 3300047322 Bacteria 2878
303 Ga0495684_0343684 3300047471 Bacteria 1061
304 Ga0496106_0061969 3300048909 Bacteria 2839
305 Ga0496107_0030738 3300048910 Bacteria 3829
306 Ga0496115_0030785 3300048918 Bacteria 4224
307 Ga0496115_0548576 3300048918 Bacteria 924
308 Ga0501291_012037 3300049514 Bacteria 1258
309 Ga0501031_0002034 3300049568 Bacteria 12737
310 Ga0501032_0385141 3300049569 Bacteria 901
311 Ga0501033_0027228 3300049570 Bacteria 4299
312 Ga0501033_0031840 3300049570 Bacteria 3960
313 Ga0501034_0592878 3300049571 Bacteria 1014
314 Ga0501037_0183229 3300049573 Bacteria 1485
315 Ga0501038_0375866 3300049574 Bacteria 1103
316 Ga0501039_0180737 3300049575 Bacteria 1659
317 Ga0501047_0063380 3300049581 Bacteria 3566
318 Ga0501071_0392481 3300049587 Bacteria 1059
319 Ga0501075_0120940 3300049591 Bacteria 1993
320 Ga0501076_0537079 3300049592 Bacteria 964
321 Ga0501080_0139567 3300049742 Bacteria 2241
322 Ga0501035_0003965 3300049822 Bacteria 14106
323 Ga0501044_0000014 3300049823 Bacteria 244619
324 nmdc:mga05p37_534327_c1 3300050507 Bacteria 1338
325 nmdc:mga06r32_111320_c1 3300050510 Bacteria 2694
326 Ga0495601_0045362 3300053077 Bacteria 2764
327 Ga0500650_0096530 3300053098 Bacteria 1384
328 Ga0501084_0686013 3300054114 Unclassified 864
329 Ga0530510_0200613 3300061734 Bacteria 1481
330 Ga0400483_255224
331 Ga0070658_10106142
332 Ga0070690_100002396
333 Ga0070690_100079384
334 Ga0070690_100143727
335 Ga0070690_100158664
336 Ga0070677_10121724
337 Ga0070680_100237906
338 Ga0070689_100022159
339 Ga0070689_100042818
340 Ga0070689_100507211
341 Ga0070691_10041870
342 Ga0070688_100112709
343 Ga0070688_100198224
344 Ga0070714_100004229
345 Ga0070701_10029277
346 Ga0070711_100580416
347 Ga0070700_100560250
348 Ga0070694_100159186
349 Ga0070681_10181438
350 Ga0070681_10486052
351 Ga0070706_100104134
352 Ga0070706_100160887
353 Ga0070707_100195881
354 Ga0070698_100126719
355 Ga0070699_100249075
356 Ga0070686_100004003
357 Ga0068855_100005965
358 Ga0068855_100043930
359 Ga0068855_100058633
360 Ga0068855_100113842
361 Ga0068855_100387857
362 Ga0068855_100418538
363 Ga0068857_100631537
364 Ga0068854_100323561
365 Ga0068856_100002814
366 Ga0068856_100045454
367 Ga0068856_100240783
368 Ga0068859_100007802
369 Ga0068859_100289757
370 Ga0068859_100649461
371 Ga0068859_100841032
372 Ga0068863_100178215
373 Ga0068863_100597303
374 Ga0081455_10109893
375 Ga0070717_10166490
376 Ga0070717_10267023
377 Ga0075428_100002580
378 Ga0075428_100060558
379 Ga0075428_100621909
380 Ga0075430_100368032
381 Ga0075431_100098818
382 Ga0075431_100240425
383 Ga0075431_100245889
384 Ga0075433_10434019
385 Ga0097620_100289751
386 Ga0097620_100649473
387 Ga0097620_100841119
388 Ga0105240_10031649
389 Ga0105240_10039616
390 Ga0105240_10062483
391 Ga0105240_10288880
392 Ga0105240_10334935
393 Ga0111539_10098730
394 Ga0111539_10151702
395 Ga0105245_10153311
396 Ga0114129_10464141
397 Ga0105238_10006106
398 Ga0105238_10090992
399 Ga0099796_10090448
400 Ga0157371_10026246
401 Ga0157370_10060410
402 Ga0157369_10120304
403 Ga0157369_10482971
404 Ga0157374_10249385
405 Ga0157378_10070656
406 Ga0157372_10160017
407 Ga0157372_10209094
408 Ga0157372_10214847
409 Ga0157375_10000040
410 Ga0157375_10423580
411 Ga0157375_10845064
412 Ga0163163_10000014
413 Ga0163163_10368172
414 Ga0157379_10460501
415 Ga0213876_10067031
416 Ga0213876_10124445
417 Ga0213875_10049088
418 Ga0207705_10075329
419 Ga0207707_10115964
420 Ga0207695_10000061
421 Ga0207695_10073373
422 Ga0207695_10102986
423 Ga0207693_10142927
424 Ga0207663_10178177
425 Ga0207652_10349283
426 Ga0207652_10684124
427 Ga0207694_10009215
428 Ga0207694_10239792
429 Ga0207687_10187131
430 Ga0207664_10006609
431 Ga0207670_10004129
432 Ga0207670_10005439
433 Ga0207667_10007341
434 Ga0207667_10200846
435 Ga0207667_10210700
436 Ga0207667_10318653
437 Ga0207667_10402285
438 Ga0207667_10485398
439 Ga0207702_10032301
440 Ga0207702_10056673
441 Ga0207641_10065601
442 Ga0207676_10243523
443 Ga0207674_10029154
444 Ga0207674_10712674
445 Ga0265337_1001799
446 Ga0265337_1002486
447 Ga0265337_1003480
448 Ga0265337_1016626
449 Ga0265337_1018616
450 Ga0265326_10067567
451 Ga0265319_1000001
452 Ga0265319_1028159
453 Ga0265334_10012943
454 Ga0265334_10015663
455 Ga0265334_10020104
456 Ga0265318_10039409
457 Ga0265318_10040723
458 Ga0265323_10000230
459 Ga0265323_10019842
460 Ga0265323_10093988
461 Ga0265336_10001748
462 Ga0265336_10035040
463 Ga0265338_10000736
464 Ga0265338_10000991
465 Ga0265338_10001071
466 Ga0265338_10001117
467 Ga0265338_10001288
468 Ga0265338_10001595
469 Ga0265338_10001998
470 Ga0265338_10002692
471 Ga0265338_10005359
472 Ga0265338_10005525
473 Ga0265338_10010079
474 Ga0265338_10015783
475 Ga0265338_10023833
476 Ga0265338_10033474
477 Ga0265338_10038108
478 Ga0265338_10039660
479 Ga0265338_10051355
480 Ga0265338_10061914
481 Ga0265338_10091231
482 Ga0265338_10112522
483 Ga0265338_10199363
484 Ga0265338_10255423
485 Ga0265324_10000330
486 Ga0265324_10000613
487 Ga0265324_10006687
488 Ga0265324_10030403
489 Ga0265324_10046009
490 Ga0265324_10057408
491 Ga0265332_10112177
492 Ga0265332_10136935
493 Ga0265328_10022655
494 Ga0265320_10000414
495 Ga0265320_10001493
496 Ga0265320_10007918
497 Ga0265320_10010543
498 Ga0265320_10035196
499 Ga0265320_10053866
500 Ga0265320_10107910
501 Ga0265320_10158290
502 Ga0265325_10063050
503 Ga0265340_10003804
504 Ga0265340_10100210
505 Ga0265340_10108148
506 Ga0265339_10005306
507 Ga0265339_10143386
508 Ga0265327_10003039
509 Ga0265327_10026812
510 Ga0265327_10036047
511 Ga0265316_10019843
512 Ga0265316_10033432
513 Ga0265316_10083428
514 Ga0265316_10230681
515 Ga0265316_10233786
516 Ga0265316_10340855
517 Ga0265313_10003801
518 Ga0265313_10013413
519 Ga0265314_10006431
520 Ga0265314_10013850
521 Ga0265314_10023516
522 Ga0265314_10082912
523 Ga0265314_10100811
524 Ga0265314_10211315
525 Ga0265342_10015316
526 Ga0373930_0001632
527 Ga0373950_0001778
528 Ga0373928_0000318
529 Ga0373929_0001450
530 Ga0373944_0000152
531 Ga0373949_0000789
532 Ga0373951_0002424
533 Ga0373932_0000001
534 Ga0373945_0049852
535 Ga0373954_0103486
536 Ga0373956_0014072
537 Ga0373956_0042958
538 Ga0373943_0026310
539 Ga0373943_0284118
540 Ga0373946_0046627
541 Ga0373931_0000004
542 Ga0373931_0184626
543 Ga0373935_0078144
544 Ga0373935_0160294
545 Ga0373927_0003699
546 Ga0373927_0020810
547 Ga0373927_0044655
548 Ga0373933_0037335
549 Ga0373933_0108951
550 Ga0373947_0004199
551 Ga0373947_0061751
552 Ga0373947_0118216
553 Ga0373937_0005368
554 Ga0373937_0042510
555 Ga0373925_0000397
556 Ga0373925_0003523
557 Ga0373925_0066843
558 Ga0373925_0129865
559 Ga0436364_0269808
560 Ga0436364_1088487
561 Ga0400489_54263
562 Ga0436365_1281712
563 Ga0436365_1608188
564 Ga0436365_1824550
565 Ga0436362_0176398
566 Ga0451577_0000986
567 Ga0451577_0005580
568 Ga0451577_0012261
569 Ga0451577_0041368
570 Ga0451577_0138600
571 Ga0451577_0258670
572 Ga0451577_0644705
573 Ga0466972_0051842
574 Ga0453684_0000192
575 Ga0453684_0003390
576 Ga0453684_0007891
577 Ga0453684_0098871
578 Ga0451576_0015415
579 Ga0451576_0037398
580 Ga0451576_0099468
581 Ga0451576_0294390
582 Ga0451576_0322787
583 Ga0451576_0357075
584 Ga0451576_0363479
585 Ga0451576_0544456
586 Ga0451576_0779355
587 Ga0495592_0000071
588 Ga0495592_0316992
589 Ga0495641_0010527
590 Ga0495651_0121545
591 Ga0495662_0018873
592 Ga0495618_0001609
593 Ga0495618_0029704
594 Ga0495628_0000197
595 Ga0495630_0000558
596 Ga0495630_0022471
597 Ga0495666_0025441
598 Ga0495666_0061646
599 Ga0495640_0077423
600 Ga0495640_0283646
601 Ga0495586_0000212
602 Ga0495586_0001433
603 Ga0495586_0004563
604 Ga0495586_0069312
605 Ga0495645_0010263
606 Ga0495645_0064808
607 Ga0495645_0201494
608 Ga0495667_0052451
609 Ga0495634_0007762
610 Ga0495634_0076185
611 Ga0495625_0193543
612 Ga0495657_0260295
613 Ga0495599_0011846
614 Ga0495599_0027257
615 Ga0495647_0041373
616 Ga0495658_0038877
617 Ga0495658_0218956
618 Ga0495669_0084461
619 Ga0495613_0004437
620 Ga0495613_0052747
621 Ga0495613_0193395
622 Ga0495613_0436392
623 Ga0495624_0027849
624 Ga0495624_0247645
625 Ga0495600_0150551
626 Ga0495581_0020513
627 Ga0495674_0008917
628 Ga0495674_0031820
629 Ga0495674_0198274
630 Ga0495676_0036952
631 Ga0495680_0061883
632 Ga0495684_0343684
633 Ga0496106_0061969
634 Ga0496107_0030738
635 Ga0496115_0030785
636 Ga0496115_0548576
637 Ga0501291_012037
638 Ga0501031_0002034
639 Ga0501032_0385141
640 Ga0501033_0027228
641 Ga0501033_0031840
642 Ga0501034_0592878
643 Ga0501037_0183229
644 Ga0501038_0375866
645 Ga0501039_0180737
646 Ga0501047_0063380
647 Ga0501071_0392481
648 Ga0501075_0120940
649 Ga0501076_0537079
650 Ga0501080_0139567
651 Ga0501035_0003965
652 Ga0501044_0000014
653 nmdc:mga05p37_534327_c1
654 nmdc:mga06r32_111320_c1
655 Ga0495601_0045362
656 Ga0500650_0096530
657 Ga0501084_0686013
658 Ga0530510_0200613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

36

270

0.97

PF01207

Dus

Dihydrouridine synthase (Dus)

40

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9706 1 257
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9683 3 257
6ymu-assembly1.cif.gz_A imidazole glycerol phosphate synthase 0.9675 1 257
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9672 1 257
7qc9-assembly1.cif.gz_A hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima 0.9656 2 257
ID Description Score Start End Superfamily
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9654 1 250 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9582 1 257 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9545 1 257 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9502 1 250 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9357 1 257 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A661ELV4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF 0.9964 125 257 GO:0000105
GO:0000107
AF-A0A537NB29-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.996 126 257 GO:0000105
GO:0000107
AF-A0A4P5R906-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) 0.9954 1 257 GO:0000105
GO:0000107
GO:0005737
GO:0016829
AF-A0A831WBM2-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9949 71 257 GO:0000105
GO:0000107
GO:0016829
AF-A0A353NMJ2-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9947 48 257 GO:0000105
GO:0000107
GO:0016829

Map