F409673

General Info

Members Datasets Scaffolds Average Seq Length
329 201 323 317

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10405965|Ga0157379_104059652
Length 346
Sequence VKLKKKLQHQTFTKNSILQTQTLTVREALFIKKNKERWERVQHSPSSNPDEMARDFTQLVDDLAYAKTFYPSGKVTQYINSQASRIYLGIYKNKKEASSRILRFWKIELPLVVRRYHREILYAFIIFLLFAILAAFSAAHDETFVRGVLGDGYIEMTEDNIAKGDPFGVYKNGDQVSMFMFIAEHNIQVSFLVFVAGLFFSIGTVWLLFTNGVMLGAFQYYFFAKGLGWKSVLVIWIHGTLEISSIIIAGAAGLILGNSLLFPGTYKRIDSLKRGAKDGLKCLIGLVPIFITAAFLEGFVTRYATMPIWASISILTISLSFIIWYFVIYPIRVSKKIKLSSSSEKP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
193 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
198 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0
Rhizoplane 0
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_24268 2162886011 Bacteria 2254
2 JGI25154J39366_1000001 3300002738 Bacteria 483450
3 JGI25157J39369_1006806 3300002741 Bacteria 1704
4 rootH2_10101040 3300003320 Bacteria 2640
5 rootH2_10348254 3300003320 Bacteria 1055
6 rootL2_10044712 3300003322 Bacteria 4616
7 rootL2_10177018 3300003322 Bacteria 4636
8 rootH1_10009170 3300003323 Bacteria 4471
9 rootH1_10220434 3300003323 Unclassified 2357
10 rootH1_10352017 3300003323 Bacteria 3193
11 JGI25160J50197_1001169 3300003354 Bacteria 13382
12 JGI25160J50197_1010133 3300003354 Bacteria 3431
13 Ga0055526_1040807 3300003771 Unclassified 1165
14 Ga0055528_1002064 3300003790 Bacteria 11220
15 Ga0055530_10000393 3300003791 Bacteria 39108
16 Ga0065165_1000105 3300005262 Bacteria 140409
17 Ga0065165_1020153 3300005262 Bacteria 2357
18 Ga0065714_10087575 3300005288 Unclassified 2052
19 Ga0065704_10072793 3300005289 Bacteria 8003
20 Ga0065712_10091434 3300005290 Bacteria 2372
21 Ga0070658_10243964 3300005327 Bacteria 1523
22 Ga0070676_10007539 3300005328 Bacteria 5845
23 Ga0070676_10028012 3300005328 Bacteria 3199
24 Ga0070683_100066026 3300005329 Bacteria 3370
25 Ga0070683_100089910 3300005329 Bacteria 2882
26 Ga0070683_100104601 3300005329 Bacteria 2668
27 Ga0070690_100130618 3300005330 Unclassified 1696
28 Ga0068869_100033230 3300005334 Bacteria 3641
29 Ga0068869_100047770 3300005334 Bacteria 3092
30 Ga0070666_10001617 3300005335 Bacteria 13695
31 Ga0070682_100006447 3300005337 Bacteria 6597
32 Ga0070689_100020835 3300005340 Bacteria 4871
33 Ga0070691_10006462 3300005341 Bacteria 5359
34 Ga0070691_10010910 3300005341 Bacteria 4149
35 Ga0070691_10033343 3300005341 Bacteria 2423
36 Ga0070687_100027217 3300005343 Bacteria 2760
37 Ga0070668_100006287 3300005347 Bacteria 8791
38 Ga0070668_100037412 3300005347 Bacteria 3706
39 Ga0070669_100019758 3300005353 Unclassified 4813
40 Ga0070675_100066963 3300005354 Bacteria 2971
41 Ga0070673_100002312 3300005364 Bacteria 11581
42 Ga0070667_100000492 3300005367 Bacteria 40164
43 Ga0070713_100456541 3300005436 Bacteria 1201
44 Ga0070678_100129423 3300005456 Bacteria 2003
45 Ga0070678_100186365 3300005456 Bacteria 1703
46 Ga0070662_100007380 3300005457 Bacteria 7124
47 Ga0068867_100049229 3300005459 Bacteria 3102
48 Ga0068867_100107556 3300005459 Bacteria 2138
49 Ga0070698_100011755 3300005471 Bacteria 9287
50 Ga0070684_100010886 3300005535 Bacteria 7227
51 Ga0068853_100005363 3300005539 Bacteria 10041
52 Ga0068853_100086887 3300005539 Bacteria 2743
53 Ga0068853_100102269 3300005539 Bacteria 2535
54 Ga0068853_100242871 3300005539 Bacteria 1651
55 Ga0068853_100419769 3300005539 Unclassified 1254
56 Ga0070672_100002526 3300005543 Bacteria 11648
57 Ga0070672_100003897 3300005543 Bacteria 9722
58 Ga0070665_100000009 3300005548 Bacteria 562640
59 Ga0070665_100006195 3300005548 Bacteria 12241
60 Ga0068855_100001225 3300005563 Bacteria 31850
61 Ga0068855_100045831 3300005563 Bacteria 5170
62 Ga0068855_100049644 3300005563 Bacteria 4948
63 Ga0070664_100071975 3300005564 Bacteria 2964
64 Ga0068857_100001841 3300005577 Bacteria 17068
65 Ga0068857_100030524 3300005577 Bacteria 4759
66 Ga0068854_100154507 3300005578 Unclassified 1772
67 Ga0068856_100277270 3300005614 Bacteria 1693
68 Ga0068852_100000795 3300005616 Bacteria 20782
69 Ga0068852_100016877 3300005616 Bacteria 5711
70 Ga0068852_100044529 3300005616 Bacteria 3769
71 Ga0068852_100102139 3300005616 Bacteria 2590
72 Ga0068852_100262449 3300005616 Bacteria 1659
73 Ga0068852_100476042 3300005616 Bacteria 1240
74 Ga0068859_100032789 3300005617 Bacteria 5218
75 Ga0068864_100002625 3300005618 Bacteria 14840
76 Ga0068864_100398820 3300005618 Bacteria 1307
77 Ga0068861_100087754 3300005719 Bacteria 2448
78 Ga0068851_10003017 3300005834 Bacteria 7435
79 Ga0068870_10024293 3300005840 Bacteria 2998
80 Ga0068863_100012655 3300005841 Bacteria 8138
81 Ga0068858_100005957 3300005842 Bacteria 11905
82 Ga0068860_100000078 3300005843 Bacteria 171062
83 Ga0068860_100009128 3300005843 Bacteria 9864
84 Ga0075366_10013023 3300006195 Bacteria 4729
85 Ga0075366_10172695 3300006195 Bacteria 1312
86 Ga0097621_100210962 3300006237 Bacteria 1690
87 Ga0068871_100024189 3300006358 Bacteria 4707
88 Ga0068871_100083172 3300006358 Unclassified 2655
89 Ga0075431_100038869 3300006847 Bacteria 4902
90 Ga0075429_100018746 3300006880 Bacteria 5992
91 Ga0097620_100032787 3300006931 Bacteria 5218
92 Ga0097620_100197715 3300006931 Bacteria 2095
93 Ga0105240_10000263 3300009093 Bacteria 103973
94 Ga0105240_10001595 3300009093 Bacteria 38516
95 Ga0105240_10002139 3300009093 Bacteria 32274
96 Ga0105240_10002434 3300009093 Bacteria 29930
97 Ga0105240_10011818 3300009093 Bacteria 12124
98 Ga0111539_10010171 3300009094 Bacteria 11856
99 Ga0111539_10034513 3300009094 Bacteria 6133
100 Ga0105247_10098472 3300009101 Bacteria 1867
101 Ga0114129_10013499 3300009147 Bacteria 11641
102 Ga0105241_10000537 3300009174 Bacteria 28565
103 Ga0105241_10001444 3300009174 Bacteria 18210
104 Ga0105241_10079296 3300009174 Unclassified 2567
105 Ga0105242_10305768 3300009176 Bacteria 1453
106 Ga0105242_10401312 3300009176 Bacteria 1280
107 Ga0105237_10000113 3300009545 Bacteria 114034
108 Ga0105237_10003490 3300009545 Bacteria 18656
109 Ga0105237_10006520 3300009545 Bacteria 12919
110 Ga0105237_10085845 3300009545 Unclassified 3137
111 Ga0105237_10265355 3300009545 Bacteria 1720
112 Ga0105238_10003420 3300009551 Bacteria 15826
113 Ga0105238_10021601 3300009551 Bacteria 6556
114 Ga0105238_10051925 3300009551 Bacteria 4122
115 Ga0105238_10113128 3300009551 Bacteria 2694
116 Ga0105249_10027908 3300009553 Bacteria 5095
117 Ga0105249_10037036 3300009553 Bacteria 4427
118 Ga0105239_10000797 3300010375 Bacteria 44708
119 Ga0105239_10009432 3300010375 Bacteria 10998
120 Ga0105239_10021280 3300010375 Bacteria 7150
121 Ga0105239_10021360 3300010375 Bacteria 7137
122 Ga0105239_10075581 3300010375 Bacteria 3704
123 Ga0105239_10094296 3300010375 Unclassified 3306
124 Ga0105239_10355786 3300010375 Bacteria 1653
125 Ga0105239_10369483 3300010375 Bacteria 1621
126 Ga0157373_10146934 3300013100 Unclassified 1658
127 Ga0157371_10055398 3300013102 Bacteria 2814
128 Ga0157370_10002300 3300013104 Bacteria 23142
129 Ga0157370_10013600 3300013104 Bacteria 8375
130 Ga0157370_10020851 3300013104 Bacteria 6539
131 Ga0157369_10176058 3300013105 Bacteria 2252
132 Ga0157369_10283439 3300013105 Bacteria 1725
133 Ga0157374_10000002 3300013296 Bacteria 1054226
134 Ga0157374_10011507 3300013296 Bacteria 7667
135 Ga0157374_10024452 3300013296 Bacteria 5417
136 Ga0157374_10027927 3300013296 Bacteria 5094
137 Ga0157378_10193862 3300013297 Bacteria 1918
138 Ga0163162_10000341 3300013306 Bacteria 42456
139 Ga0163162_10001596 3300013306 Bacteria 21205
140 Ga0163162_10042448 3300013306 Bacteria 4552
141 Ga0157372_10000838 3300013307 Bacteria 33401
142 Ga0157372_10001435 3300013307 Bacteria 25757
143 Ga0157372_10019798 3300013307 Bacteria 7252
144 Ga0157372_10024945 3300013307 Bacteria 6498
145 Ga0157372_10032081 3300013307 Bacteria 5756
146 Ga0157372_10034673 3300013307 Bacteria 5551
147 Ga0157372_10156589 3300013307 Bacteria 2632
148 Ga0157372_10352187 3300013307 Bacteria 1715
149 Ga0157375_10007977 3300013308 Bacteria 9270
150 Ga0157375_10058652 3300013308 Bacteria 3809
151 Ga0157375_10157440 3300013308 Bacteria 2411
152 Ga0163163_10009008 3300014325 Bacteria 8892
153 Ga0157380_10001894 3300014326 Bacteria 13872
154 Ga0157380_10252195 3300014326 Bacteria 1598
155 Ga0157377_10004316 3300014745 Bacteria 6526
156 Ga0157379_10001301 3300014968 Bacteria 20316
157 Ga0157379_10033156 3300014968 Bacteria 4605
158 Ga0157379_10405965 3300014968 Bacteria 1253
159 Ga0157376_10002054 3300014969 Bacteria 13503
160 Ga0209646_1000002 3300025246 Bacteria 1425781
161 Ga0209026_1000627 3300025250 Bacteria 22217
162 Ga0209673_1000096 3300025273 Bacteria 194819
163 Ga0209564_1006836 3300025295 Bacteria 6024
164 Ga0209564_1009150 3300025295 Bacteria 4762
165 Ga0209758_1005330 3300025297 Bacteria 10004
166 Ga0209758_1006375 3300025297 Bacteria 8521
167 Ga0209050_1000207 3300025298 Bacteria 131328
168 Ga0207426_1000009 3300025302 Bacteria 797229
169 Ga0207426_1000571 3300025302 Bacteria 49864
170 Ga0207426_1001112 3300025302 Bacteria 24702
171 Ga0207697_10040236 3300025315 Bacteria 1919
172 Ga0207656_10008985 3300025321 Bacteria 3703
173 Ga0207647_10005334 3300025904 Bacteria 9450
174 Ga0207645_10003861 3300025907 Bacteria 11216
175 Ga0207645_10028243 3300025907 Bacteria 3623
176 Ga0207705_10045028 3300025909 Bacteria 3172
177 Ga0207705_10052804 3300025909 Unclassified 2927
178 Ga0207654_10002512 3300025911 Bacteria 9323
179 Ga0207707_10000051 3300025912 Bacteria 117204
180 Ga0207695_10000016 3300025913 Bacteria 771991
181 Ga0207695_10000128 3300025913 Bacteria 226098
182 Ga0207695_10000296 3300025913 Bacteria 123322
183 Ga0207695_10017314 3300025913 Bacteria 8390
184 Ga0207695_10084186 3300025913 Bacteria 3211
185 Ga0207695_10127731 3300025913 Bacteria 2503
186 Ga0207671_10005552 3300025914 Bacteria 11590
187 Ga0207671_10200718 3300025914 Bacteria 1557
188 Ga0207660_10002571 3300025917 Bacteria 11922
189 Ga0207652_10000384 3300025921 Bacteria 46082
190 Ga0207681_10154128 3300025923 Bacteria 1725
191 Ga0207694_10018106 3300025924 Bacteria 5325
192 Ga0207650_10051307 3300025925 Bacteria 3052
193 Ga0207650_10108978 3300025925 Unclassified 2141
194 Ga0207659_10047897 3300025926 Bacteria 3025
195 Ga0207659_10056442 3300025926 Bacteria 2813
196 Ga0207706_10009946 3300025933 Bacteria 8718
197 Ga0207706_10071824 3300025933 Bacteria 3045
198 Ga0207670_10017121 3300025936 Bacteria 4374
199 Ga0207691_10000001 3300025940 Bacteria 220829
200 Ga0207689_10024584 3300025942 Bacteria 5053
201 Ga0207689_10196366 3300025942 Bacteria 1665
202 Ga0207661_10083862 3300025944 Bacteria 2638
203 Ga0207661_10085557 3300025944 Bacteria 2614
204 Ga0207667_10000143 3300025949 Bacteria 108717
205 Ga0207667_10000275 3300025949 Bacteria 71281
206 Ga0207667_10020057 3300025949 Bacteria 7443
207 Ga0207667_10099883 3300025949 Bacteria 2994
208 Ga0207651_10003677 3300025960 Bacteria 7578
209 Ga0207651_10038168 3300025960 Bacteria 3154
210 Ga0207712_10111605 3300025961 Bacteria 2052
211 Ga0207668_10000540 3300025972 Bacteria 23750
212 Ga0207640_10116970 3300025981 Unclassified 1902
213 Ga0207658_10000946 3300025986 Bacteria 23945
214 Ga0207677_10006862 3300026023 Bacteria 6258
215 Ga0207703_10001644 3300026035 Bacteria 20118
216 Ga0207639_10001509 3300026041 Bacteria 15642
217 Ga0207639_10017324 3300026041 Bacteria 5107
218 Ga0207639_10057641 3300026041 Unclassified 2984
219 Ga0207639_10128934 3300026041 Bacteria 2091
220 Ga0207702_10036132 3300026078 Unclassified 4132
221 Ga0207702_10230139 3300026078 Bacteria 1732
222 Ga0207648_10002506 3300026089 Bacteria 19710
223 Ga0207648_10197345 3300026089 Bacteria 1784
224 Ga0207676_10001871 3300026095 Bacteria 15411
225 Ga0207676_10364889 3300026095 Bacteria 1340
226 Ga0207674_10001433 3300026116 Bacteria 30815
227 Ga0207674_10073922 3300026116 Bacteria 3421
228 Ga0207675_100007111 3300026118 Bacteria 10578
229 Ga0207675_100070723 3300026118 Unclassified 3262
230 Ga0207683_10157407 3300026121 Unclassified 2052
231 Ga0207683_10173691 3300026121 Bacteria 1952
232 Ga0207698_10124311 3300026142 Bacteria 2190
233 Ga0207698_10177333 3300026142 Unclassified 1883
234 Ga0207698_10278376 3300026142 Unclassified 1546
235 Ga0207698_10391918 3300026142 Bacteria 1325
236 Ga0268266_10000014 3300028379 Bacteria 644033
237 Ga0268266_10008318 3300028379 Bacteria 9239
238 Ga0268265_10041680 3300028380 Bacteria 3400
239 Ga0268264_10000105 3300028381 Bacteria 212531
240 Ga0268264_10005175 3300028381 Bacteria 11053
241 Ga0268264_10006865 3300028381 Bacteria 9557
242 Ga0307515_10272024 3300028794 Bacteria 1414
243 Ga0265338_10019995 3300028800 Bacteria 7068
244 Ga0265338_10036027 3300028800 Bacteria 4744
245 Ga0307509_10053309 3300031507 Bacteria 4314
246 Ga0307516_10024872 3300031730 Bacteria 6109
247 Ga0307516_10062688 3300031730 Bacteria 3602
248 Ga0373937_0029713 3300036401 Bacteria 4951
249 Ga0373937_0253874 3300036401 Unclassified 1658
250 Ga0373925_0297374 3300037068 Bacteria 1303
251 Ga0395900_0475155 3300037418 Bacteria 1203
252 Ga0395905_0000001 3300037471 Bacteria 2037079
253 Ga0439436_0023101 3300041404 Bacteria 1840
254 Ga0439449_0043532 3300042007 Unclassified 1667
255 Ga0439457_000201 3300042014 Bacteria 15715
256 Ga0466972_0000064 3300044658 Bacteria 104558
257 Ga0466972_0000523 3300044658 Bacteria 18994
258 Ga0466972_0066066 3300044658 Bacteria 1729
259 Ga0466966_0123840 3300044684 Bacteria 1586
260 Ga0466961_0012025 3300044693 Bacteria 5530
261 Ga0466964_0081747 3300044706 Unclassified 1388
262 Ga0466971_0010759 3300044719 Bacteria 4003
263 Ga0466968_0018461 3300044735 Unclassified 2798
264 Ga0466970_0002271 3300044765 Bacteria 9286
265 Ga0466957_0047475 3300044842 Bacteria 2609
266 Ga0466959_0000111 3300045049 Bacteria 52637
267 Ga0466959_0000979 3300045049 Bacteria 16984
268 Ga0495629_0083433 3300046459 Bacteria 2230
269 Ga0495638_0069434 3300046460 Bacteria 2160
270 Ga0495651_0256483 3300046462 Bacteria 1192
271 Ga0495580_0109420 3300046472 Bacteria 1918
272 Ga0495630_0061855 3300046517 Bacteria 2812
273 Ga0495648_0001767 3300046524 Bacteria 20861
274 Ga0495586_0044389 3300046535 Bacteria 2395
275 Ga0495587_0195461 3300046536 Bacteria 1145
276 Ga0495667_0061769 3300046559 Bacteria 2456
277 Ga0495625_0107477 3300046660 Bacteria 1910
278 Ga0495635_0092401 3300046663 Bacteria 2069
279 Ga0495613_0166134 3300046689 Bacteria 1568
280 Ga0495581_0183139 3300047315 Bacteria 1225
281 Ga0495674_0006964 3300047319 Bacteria 10816
282 Ga0495676_0100217 3300047321 Bacteria 2145
283 Ga0495687_000056 3300047443 Bacteria 188227
284 Ga0495686_0000016 3300047472 Bacteria 443701
285 Ga0501031_0068586 3300049568 Unclassified 2310
286 Ga0501034_0051773 3300049571 Bacteria 4140
287 Ga0501034_0145087 3300049571 Bacteria 2351
288 Ga0501034_0492628 3300049571 Bacteria 1140
289 Ga0501036_0010850 3300049572 Bacteria 7527
290 Ga0501037_0040729 3300049573 Bacteria 3418
291 Ga0501037_0073705 3300049573 Bacteria 2482
292 Ga0501038_0082487 3300049574 Bacteria 2707
293 Ga0501039_0014238 3300049575 Bacteria 6089
294 Ga0501046_0062948 3300049580 Bacteria 2898
295 Ga0501047_0022507 3300049581 Bacteria 6053
296 Ga0501069_0068604 3300049585 Bacteria 1984
297 Ga0501071_0100808 3300049587 Bacteria 2129
298 Ga0501074_0149898 3300049590 Bacteria 1668
299 Ga0501080_0186448 3300049742 Unclassified 1907
300 Ga0501080_0407503 3300049742 Bacteria 1223
301 Ga0501083_0004582 3300049744 Bacteria 9765
302 Ga0501044_0014739 3300049823 Bacteria 8427
303 Ga0501044_0033506 3300049823 Bacteria 5398
304 Ga0501044_0034712 3300049823 Bacteria 5287
305 nmdc:mga0k408_37451_c1 3300050493 Bacteria 2785
306 nmdc:mga0k408_69601_c1 3300050493 Unclassified 2054
307 nmdc:mga05p37_8076_c1 3300050507 Bacteria 12434
308 nmdc:mga09592_203157_c1 3300050508 Unclassified 1716
309 nmdc:mga06r32_48860_c1 3300050510 Bacteria 4045
310 Ga0500635_0010643 3300053080 Bacteria 2591
311 Ga0500578_0001683 3300053086 Bacteria 21230
312 Ga0500583_0000031 3300053092 Bacteria 104319
313 Ga0500583_0000523 3300053092 Bacteria 11716
314 Ga0500642_0083783 3300053130 Bacteria 1467
315 Ga0500652_008642 3300053131 Bacteria 3405
316 Ga0500568_0017864 3300053139 Unclassified 3120
317 Ga0500568_0067807 3300053139 Bacteria 1370
318 Ga0500588_0120381 3300053146 Bacteria 925
319 Ga0500622_0005714 3300053156 Bacteria 7394
320 Ga0500624_000472 3300053157 Bacteria 11992
321 Ga0500639_108758 3300053163 Bacteria 1352
322 Ga0500636_0083565 3300053177 Bacteria 1837
323 Ga0501084_0041605 3300054114 Unclassified 3844

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100005363 Ga0068853_1000053637 279
2 3300005616 Ga0068852_100044529 Ga0068852_1000445294 279
3 3300025913 Ga0207695_10017314 Ga0207695_100173147 279
4 3300026041 Ga0207639_10017324 Ga0207639_100173243 279
5 3300026142 Ga0207698_10278376 Ga0207698_102783762 279
6 3300049742 Ga0501080_0407503 Ga0501080_0407503_126_965 279
7 3300009176 Ga0105242_10401312 Ga0105242_104013121 282
8 3300046536 Ga0495587_0195461 Ga0495587_0195461_29_913 286
9 3300050510 nmdc:mga06r32_48860_c1 nmdc:mga06r32_48860_c1_39_899 286
10 3300005436 Ga0070713_100456541 Ga0070713_1004565411 289
11 3300005539 Ga0068853_100242871 Ga0068853_1002428711 289
12 3300005563 Ga0068855_100045831 Ga0068855_1000458313 289
13 3300005577 Ga0068857_100001841 Ga0068857_1000018414 289
14 3300005578 Ga0068854_100154507 Ga0068854_1001545072 289
15 3300005616 Ga0068852_100000795 Ga0068852_1000007954 289
16 3300025904 Ga0207647_10005334 Ga0207647_100053343 289
17 3300025924 Ga0207694_10018106 Ga0207694_100181065 289
18 3300025949 Ga0207667_10000275 Ga0207667_1000027517 289
19 3300025949 Ga0207667_10099883 Ga0207667_100998832 289
20 3300025981 Ga0207640_10116970 Ga0207640_101169702 289
21 3300026078 Ga0207702_10036132 Ga0207702_100361323 289
22 3300026116 Ga0207674_10001433 Ga0207674_100014334 289
23 3300026142 Ga0207698_10177333 Ga0207698_101773332 289
24 3300003322 rootL2_10177018 rootL2_101770183 290
25 3300005343 Ga0070687_100027217 Ga0070687_1000272173 291
26 3300003322 rootL2_10044712 rootL2_100447122 292
27 3300025913 Ga0207695_10000016 Ga0207695_1000001610 293
28 3300025913 Ga0207695_10000296 Ga0207695_100002969 293
29 3300053146 Ga0500588_0120381 Ga0500588_0120381_30_914 293
30 3300005471 Ga0070698_100011755 Ga0070698_1000117554 296
31 3300006195 Ga0075366_10172695 Ga0075366_101726952 296
32 3300041404 Ga0439436_0023101 Ga0439436_0023101_608_1576 296
33 3300042014 Ga0439457_000201 Ga0439457_000201_8193_9161 296
34 3300006195 Ga0075366_10013023 Ga0075366_100130232 298
35 3300009147 Ga0114129_10013499 Ga0114129_100134997 298
36 3300047472 Ga0495686_0000016 Ga0495686_0000016_75927_76877 298
37 3300050493 nmdc:mga0k408_37451_c1 nmdc:mga0k408_37451_c1_1599_2567 298
38 3300050507 nmdc:mga05p37_8076_c1 nmdc:mga05p37_8076_c1_7649_8617 298
39 3300005564 Ga0070664_100071975 Ga0070664_1000719752 302
40 3300028794 Ga0307515_10272024 Ga0307515_102720242 303
41 3300046460 Ga0495638_0069434 Ga0495638_0069434_494_1444 305
42 3300046524 Ga0495648_0001767 Ga0495648_0001767_9713_10663 305
43 3300053092 Ga0500583_0000523 Ga0500583_0000523_2526_3476 305
44 3300053130 Ga0500642_0083783 Ga0500642_0083783_245_1195 305
45 3300053156 Ga0500622_0005714 Ga0500622_0005714_3091_4041 305
46 3300009551 Ga0105238_10051925 Ga0105238_100519252 306
47 3300010375 Ga0105239_10094296 Ga0105239_100942963 306
48 3300009545 Ga0105237_10000113 Ga0105237_1000011313 309
49 3300025914 Ga0207671_10005552 Ga0207671_100055526 309
50 3300053157 Ga0500624_000472 Ga0500624_000472_7715_8671 309
51 3300036401 Ga0373937_0253874 Ga0373937_0253874_332_1297 310
52 3300006847 Ga0075431_100038869 Ga0075431_1000388695 313
53 3300006880 Ga0075429_100018746 Ga0075429_1000187463 313
54 3300037068 Ga0373925_0297374 Ga0373925_0297374_131_1096 313
55 3300044735 Ga0466968_0018461 Ga0466968_0018461_301_1281 313
56 3300046459 Ga0495629_0083433 Ga0495629_0083433_55_1020 313
57 3300046462 Ga0495651_0256483 Ga0495651_0256483_159_1124 313
58 3300046472 Ga0495580_0109420 Ga0495580_0109420_552_1517 313
59 3300046517 Ga0495630_0061855 Ga0495630_0061855_1509_2474 313
60 3300046535 Ga0495586_0044389 Ga0495586_0044389_409_1374 313
61 3300046559 Ga0495667_0061769 Ga0495667_0061769_884_1849 313
62 3300046663 Ga0495635_0092401 Ga0495635_0092401_755_1720 313
63 3300046689 Ga0495613_0166134 Ga0495613_0166134_579_1544 313
64 3300047319 Ga0495674_0006964 Ga0495674_0006964_397_1362 313
65 3300047321 Ga0495676_0100217 Ga0495676_0100217_403_1368 313
66 3300050508 nmdc:mga09592_203157_c1 nmdc:mga09592_203157_c1_157_1098 313
67 3300053092 Ga0500583_0000031 Ga0500583_0000031_20786_21754 313
68 iso_pu_bacteria 2840677318 2840678610 314
69 iso_pu_bacteria 2896085136 2896086428 314
70 iso_pu_bacteria 2896109856 2896113271 314
71 3300003320 rootH2_10101040 rootH2_101010402 315
72 3300003320 rootH2_10348254 rootH2_103482541 315
73 3300003323 rootH1_10009170 rootH1_100091703 316
74 3300003323 rootH1_10220434 rootH1_102204343 316
75 3300005329 Ga0070683_100104601 Ga0070683_1001046012 316
76 3300005341 Ga0070691_10006462 Ga0070691_100064622 316
77 3300005341 Ga0070691_10033343 Ga0070691_100333432 316
78 3300005535 Ga0070684_100010886 Ga0070684_1000108863 316
79 3300005539 Ga0068853_100419769 Ga0068853_1004197692 316
80 3300005548 Ga0070665_100000009 Ga0070665_100000009399 316
81 3300005563 Ga0068855_100001225 Ga0068855_10000122525 316
82 3300005614 Ga0068856_100277270 Ga0068856_1002772702 316
83 3300005843 Ga0068860_100000078 Ga0068860_10000007886 316
84 3300009093 Ga0105240_10000263 Ga0105240_1000026382 316
85 3300009093 Ga0105240_10002434 Ga0105240_100024347 316
86 3300009093 Ga0105240_10011818 Ga0105240_100118187 316
87 3300009174 Ga0105241_10001444 Ga0105241_1000144414 316
88 3300009174 Ga0105241_10079296 Ga0105241_100792962 316
89 3300009545 Ga0105237_10003490 Ga0105237_1000349014 316
90 3300009545 Ga0105237_10006520 Ga0105237_100065207 316
91 3300009551 Ga0105238_10003420 Ga0105238_100034209 316
92 3300009551 Ga0105238_10021601 Ga0105238_100216014 316
93 3300009551 Ga0105238_10113128 Ga0105238_101131282 316
94 3300010375 Ga0105239_10000797 Ga0105239_1000079710 316
95 3300010375 Ga0105239_10021280 Ga0105239_100212803 316
96 3300010375 Ga0105239_10021360 Ga0105239_100213607 316
97 3300013100 Ga0157373_10146934 Ga0157373_101469341 316
98 3300013104 Ga0157370_10013600 Ga0157370_100136008 316
99 3300013104 Ga0157370_10020851 Ga0157370_100208513 316
100 3300013105 Ga0157369_10176058 Ga0157369_101760582 316
101 3300013296 Ga0157374_10000002 Ga0157374_10000002179 316
102 3300013306 Ga0163162_10000341 Ga0163162_1000034122 316
103 3300013307 Ga0157372_10000838 Ga0157372_100008387 316
104 3300013307 Ga0157372_10001435 Ga0157372_1000143519 316
105 3300013307 Ga0157372_10024945 Ga0157372_100249456 316
106 3300013307 Ga0157372_10032081 Ga0157372_100320814 316
107 3300014969 Ga0157376_10002054 Ga0157376_1000205412 316
108 3300025913 Ga0207695_10000128 Ga0207695_1000012835 316
109 3300025913 Ga0207695_10084186 Ga0207695_100841862 316
110 3300025944 Ga0207661_10083862 Ga0207661_100838623 316
111 3300025949 Ga0207667_10000143 Ga0207667_1000014336 316
112 3300026078 Ga0207702_10230139 Ga0207702_102301392 316
113 3300028379 Ga0268266_10000014 Ga0268266_10000014273 316
114 3300028381 Ga0268264_10000105 Ga0268264_1000010596 316
115 3300031730 Ga0307516_10062688 Ga0307516_100626884 316
116 3300044658 Ga0466972_0000523 Ga0466972_0000523_11154_12104 316
117 3300044693 Ga0466961_0012025 Ga0466961_0012025_1473_2423 316
118 3300044719 Ga0466971_0010759 Ga0466971_0010759_1049_1999 316
119 3300045049 Ga0466959_0000979 Ga0466959_0000979_1251_2201 316
120 3300046660 Ga0495625_0107477 Ga0495625_0107477_408_1358 316
121 3300047443 Ga0495687_000056 Ga0495687_000056_79865_80815 316
122 3300053139 Ga0500568_0017864 Ga0500568_0017864_517_1467 316
123 iso_pu_bacteria 2884791551 2884795771 316
124 iso_pu_bacteria 2929921140 2929923060 316
125 iso_pu_bacteria 8003151029 8003152397 316
126 3300009176 Ga0105242_10305768 Ga0105242_103057681 317
127 3300013297 Ga0157378_10193862 Ga0157378_101938622 317
128 3300013308 Ga0157375_10157440 Ga0157375_101574403 317
129 3300028800 Ga0265338_10036027 Ga0265338_100360272 317
130 3300049581 Ga0501047_0022507 Ga0501047_0022507_1070_2053 317
131 3300049823 Ga0501044_0033506 Ga0501044_0033506_684_1667 317
132 3300003323 rootH1_10352017 rootH1_103520172 318
133 3300005289 Ga0065704_10072793 Ga0065704_100727932 318
134 3300005329 Ga0070683_100089910 Ga0070683_1000899101 318
135 3300005616 Ga0068852_100262449 Ga0068852_1002624492 318
136 3300005616 Ga0068852_100476042 Ga0068852_1004760421 318
137 3300013296 Ga0157374_10027927 Ga0157374_100279273 318
138 3300025923 Ga0207681_10154128 Ga0207681_101541282 318
139 3300025925 Ga0207650_10051307 Ga0207650_100513073 318
140 3300025944 Ga0207661_10085557 Ga0207661_100855573 318
141 3300026041 Ga0207639_10128934 Ga0207639_101289342 318
142 3300026095 Ga0207676_10364889 Ga0207676_103648892 318
143 3300026142 Ga0207698_10391918 Ga0207698_103919182 318
144 3300037418 Ga0395900_0475155 Ga0395900_0475155_177_1133 318
145 3300037471 Ga0395905_0000001 Ga0395905_0000001_2027152_2028120 318
146 3300049571 Ga0501034_0145087 Ga0501034_0145087_245_1231 318
147 3300003354 JGI25160J50197_1010133 JGI25160J50197_10101333 319
148 3300005288 Ga0065714_10087575 Ga0065714_100875753 319
149 3300005328 Ga0070676_10007539 Ga0070676_100075395 319
150 3300005334 Ga0068869_100047770 Ga0068869_1000477704 319
151 3300005335 Ga0070666_10001617 Ga0070666_100016179 319
152 3300005347 Ga0070668_100006287 Ga0070668_1000062877 319
153 3300005364 Ga0070673_100002312 Ga0070673_1000023126 319
154 3300005367 Ga0070667_100000492 Ga0070667_10000049210 319
155 3300005456 Ga0070678_100129423 Ga0070678_1001294232 319
156 3300005457 Ga0070662_100007380 Ga0070662_1000073802 319
157 3300005459 Ga0068867_100049229 Ga0068867_1000492292 319
158 3300005539 Ga0068853_100086887 Ga0068853_1000868873 319
159 3300005543 Ga0070672_100002526 Ga0070672_1000025265 319
160 3300005548 Ga0070665_100006195 Ga0070665_1000061959 319
161 3300005616 Ga0068852_100102139 Ga0068852_1001021393 319
162 3300005618 Ga0068864_100002625 Ga0068864_1000026259 319
163 3300005719 Ga0068861_100087754 Ga0068861_1000877543 319
164 3300005834 Ga0068851_10003017 Ga0068851_100030177 319
165 3300005841 Ga0068863_100012655 Ga0068863_1000126557 319
166 3300005842 Ga0068858_100005957 Ga0068858_1000059575 319
167 3300006358 Ga0068871_100024189 Ga0068871_1000241894 319
168 3300009101 Ga0105247_10098472 Ga0105247_100984722 319
169 3300009553 Ga0105249_10037036 Ga0105249_100370362 319
170 3300010375 Ga0105239_10355786 Ga0105239_103557862 319
171 3300013296 Ga0157374_10011507 Ga0157374_100115072 319
172 3300013306 Ga0163162_10001596 Ga0163162_1000159611 319
173 3300013307 Ga0157372_10352187 Ga0157372_103521872 319
174 3300013308 Ga0157375_10007977 Ga0157375_100079773 319
175 3300014325 Ga0163163_10009008 Ga0163163_100090085 319
176 3300014968 Ga0157379_10001301 Ga0157379_1000130115 319
177 3300025302 Ga0207426_1000009 Ga0207426_1000009267 319
178 3300025321 Ga0207656_10008985 Ga0207656_100089853 319
179 3300025907 Ga0207645_10003861 Ga0207645_100038617 319
180 3300025909 Ga0207705_10045028 Ga0207705_100450282 319
181 3300025933 Ga0207706_10009946 Ga0207706_100099467 319
182 3300025940 Ga0207691_10000001 Ga0207691_100000015 319
183 3300025942 Ga0207689_10196366 Ga0207689_101963662 319
184 3300025960 Ga0207651_10003677 Ga0207651_100036776 319
185 3300025972 Ga0207668_10000540 Ga0207668_1000054015 319
186 3300025986 Ga0207658_10000946 Ga0207658_1000094613 319
187 3300026023 Ga0207677_10006862 Ga0207677_100068624 319
188 3300026035 Ga0207703_10001644 Ga0207703_1000164416 319
189 3300026089 Ga0207648_10002506 Ga0207648_1000250617 319
190 3300026095 Ga0207676_10001871 Ga0207676_1000187113 319
191 3300026118 Ga0207675_100070723 Ga0207675_1000707232 319
192 3300026121 Ga0207683_10173691 Ga0207683_101736912 319
193 3300028379 Ga0268266_10008318 Ga0268266_100083186 319
194 3300028381 Ga0268264_10006865 Ga0268264_100068659 319
195 3300053080 Ga0500635_0010643 Ga0500635_0010643_587_1546 319
196 3300002738 JGI25154J39366_1000001 JGI25154J39366_1000001354 320
197 3300002741 JGI25157J39369_1006806 JGI25157J39369_10068062 320
198 3300003354 JGI25160J50197_1001169 JGI25160J50197_10011694 320
199 3300003771 Ga0055526_1040807 Ga0055526_10408071 320
200 3300003790 Ga0055528_1002064 Ga0055528_100206410 320
201 3300003791 Ga0055530_10000393 Ga0055530_1000039322 320
202 3300005262 Ga0065165_1000105 Ga0065165_1000105135 320
203 3300005262 Ga0065165_1020153 Ga0065165_10201531 320
204 3300005327 Ga0070658_10243964 Ga0070658_102439642 320
205 3300005329 Ga0070683_100066026 Ga0070683_1000660264 320
206 3300005337 Ga0070682_100006447 Ga0070682_1000064473 320
207 3300005341 Ga0070691_10010910 Ga0070691_100109102 320
208 3300005456 Ga0070678_100186365 Ga0070678_1001863652 320
209 3300005539 Ga0068853_100102269 Ga0068853_1001022692 320
210 3300005563 Ga0068855_100049644 Ga0068855_1000496443 320
211 3300005616 Ga0068852_100016877 Ga0068852_1000168771 320
212 3300006237 Ga0097621_100210962 Ga0097621_1002109622 320
213 3300006358 Ga0068871_100083172 Ga0068871_1000831723 320
214 3300006931 Ga0097620_100197715 Ga0097620_1001977152 320
215 3300009093 Ga0105240_10001595 Ga0105240_1000159526 320
216 3300009093 Ga0105240_10002139 Ga0105240_1000213919 320
217 3300009094 Ga0111539_10034513 Ga0111539_100345136 320
218 3300009174 Ga0105241_10000537 Ga0105241_1000053715 320
219 3300009545 Ga0105237_10085845 Ga0105237_100858451 320
220 3300009545 Ga0105237_10265355 Ga0105237_102653552 320
221 3300010375 Ga0105239_10009432 Ga0105239_1000943210 320
222 3300010375 Ga0105239_10075581 Ga0105239_100755813 320
223 3300010375 Ga0105239_10369483 Ga0105239_103694832 320
224 3300013102 Ga0157371_10055398 Ga0157371_100553982 320
225 3300013104 Ga0157370_10002300 Ga0157370_1000230015 320
226 3300013105 Ga0157369_10283439 Ga0157369_102834392 320
227 3300013296 Ga0157374_10024452 Ga0157374_100244525 320
228 3300013306 Ga0163162_10042448 Ga0163162_100424481 320
229 3300013307 Ga0157372_10019798 Ga0157372_100197982 320
230 3300013307 Ga0157372_10034673 Ga0157372_100346735 320
231 3300013307 Ga0157372_10156589 Ga0157372_101565891 320
232 3300013308 Ga0157375_10058652 Ga0157375_100586521 320
233 3300014326 Ga0157380_10252195 Ga0157380_102521952 320
234 3300014968 Ga0157379_10033156 Ga0157379_100331563 320
235 3300014968 Ga0157379_10405965 Ga0157379_104059652 320
236 3300025246 Ga0209646_1000002 Ga0209646_1000002351 320
237 3300025250 Ga0209026_1000627 Ga0209026_100062715 320
238 3300025273 Ga0209673_1000096 Ga0209673_1000096128 320
239 3300025295 Ga0209564_1006836 Ga0209564_10068364 320
240 3300025295 Ga0209564_1009150 Ga0209564_10091505 320
241 3300025297 Ga0209758_1005330 Ga0209758_10053309 320
242 3300025297 Ga0209758_1006375 Ga0209758_10063752 320
243 3300025298 Ga0209050_1000207 Ga0209050_100020781 320
244 3300025302 Ga0207426_1000571 Ga0207426_100057131 320
245 3300025302 Ga0207426_1001112 Ga0207426_100111222 320
246 3300025909 Ga0207705_10052804 Ga0207705_100528042 320
247 3300025911 Ga0207654_10002512 Ga0207654_1000251210 320
248 3300025912 Ga0207707_10000051 Ga0207707_1000005172 320
249 3300025913 Ga0207695_10127731 Ga0207695_101277312 320
250 3300025914 Ga0207671_10200718 Ga0207671_102007182 320
251 3300025917 Ga0207660_10002571 Ga0207660_1000257110 320
252 3300025921 Ga0207652_10000384 Ga0207652_1000038410 320
253 3300025926 Ga0207659_10056442 Ga0207659_100564424 320
254 3300025949 Ga0207667_10020057 Ga0207667_100200574 320
255 3300026041 Ga0207639_10001509 Ga0207639_1000150913 320
256 3300026041 Ga0207639_10057641 Ga0207639_100576413 320
257 3300026121 Ga0207683_10157407 Ga0207683_101574073 320
258 3300026142 Ga0207698_10124311 Ga0207698_101243112 320
259 3300028800 Ga0265338_10019995 Ga0265338_100199955 320
260 3300031507 Ga0307509_10053309 Ga0307509_100533092 320
261 3300031730 Ga0307516_10024872 Ga0307516_100248723 320
262 3300036401 Ga0373937_0029713 Ga0373937_0029713_1043_2020 320
263 3300042007 Ga0439449_0043532 Ga0439449_0043532_298_1302 320
264 3300044658 Ga0466972_0000064 Ga0466972_0000064_17608_18609 320
265 3300044658 Ga0466972_0066066 Ga0466972_0066066_309_1277 320
266 3300044684 Ga0466966_0123840 Ga0466966_0123840_500_1480 320
267 3300044706 Ga0466964_0081747 Ga0466964_0081747_153_1118 320
268 3300044765 Ga0466970_0002271 Ga0466970_0002271_7020_8021 320
269 3300044842 Ga0466957_0047475 Ga0466957_0047475_400_1368 320
270 3300045049 Ga0466959_0000111 Ga0466959_0000111_26608_27588 320
271 3300047315 Ga0495581_0183139 Ga0495581_0183139_20_985 320
272 3300049568 Ga0501031_0068586 Ga0501031_0068586_1131_2099 320
273 3300049571 Ga0501034_0051773 Ga0501034_0051773_2614_3579 320
274 3300049571 Ga0501034_0492628 Ga0501034_0492628_24_992 320
275 3300049572 Ga0501036_0010850 Ga0501036_0010850_2098_3096 320
276 3300049573 Ga0501037_0040729 Ga0501037_0040729_2300_3268 320
277 3300049573 Ga0501037_0073705 Ga0501037_0073705_70_1041 320
278 3300049574 Ga0501038_0082487 Ga0501038_0082487_106_1074 320
279 3300049575 Ga0501039_0014238 Ga0501039_0014238_3172_4170 320
280 3300049580 Ga0501046_0062948 Ga0501046_0062948_1386_2354 320
281 3300049585 Ga0501069_0068604 Ga0501069_0068604_671_1636 320
282 3300049587 Ga0501071_0100808 Ga0501071_0100808_651_1616 320
283 3300049590 Ga0501074_0149898 Ga0501074_0149898_165_1130 320
284 3300049742 Ga0501080_0186448 Ga0501080_0186448_532_1497 320
285 3300049744 Ga0501083_0004582 Ga0501083_0004582_4971_5936 320
286 3300049823 Ga0501044_0014739 Ga0501044_0014739_2668_3666 320
287 3300049823 Ga0501044_0034712 Ga0501044_0034712_699_1667 320
288 3300050493 nmdc:mga0k408_69601_c1 nmdc:mga0k408_69601_c1_218_1222 320
289 3300053086 Ga0500578_0001683 Ga0500578_0001683_2244_3212 320
290 3300053131 Ga0500652_008642 Ga0500652_008642_2083_3075 320
291 3300053139 Ga0500568_0067807 Ga0500568_0067807_67_1059 320
292 3300053163 Ga0500639_108758 Ga0500639_108758_172_1140 320
293 3300053177 Ga0500636_0083565 Ga0500636_0083565_607_1575 320
294 3300054114 Ga0501084_0041605 Ga0501084_0041605_1991_2956 320
295 2162886011 MRS1b_contig_24268 MRS1b_0281.00003220 322
296 3300005290 Ga0065712_10091434 Ga0065712_100914342 322
297 3300005328 Ga0070676_10028012 Ga0070676_100280122 322
298 3300005330 Ga0070690_100130618 Ga0070690_1001306182 322
299 3300005334 Ga0068869_100033230 Ga0068869_1000332303 322
300 3300005340 Ga0070689_100020835 Ga0070689_1000208352 322
301 3300005347 Ga0070668_100037412 Ga0070668_1000374123 322
302 3300005353 Ga0070669_100019758 Ga0070669_1000197584 322
303 3300005354 Ga0070675_100066963 Ga0070675_1000669631 322
304 3300005459 Ga0068867_100107556 Ga0068867_1001075562 322
305 3300005543 Ga0070672_100003897 Ga0070672_1000038976 322
306 3300005577 Ga0068857_100030524 Ga0068857_1000305244 322
307 3300005617 Ga0068859_100032789 Ga0068859_1000327894 322
308 3300005618 Ga0068864_100398820 Ga0068864_1003988201 322
309 3300005840 Ga0068870_10024293 Ga0068870_100242932 322
310 3300005843 Ga0068860_100009128 Ga0068860_1000091289 322
311 3300006931 Ga0097620_100032787 Ga0097620_1000327874 322
312 3300009094 Ga0111539_10010171 Ga0111539_100101715 322
313 3300009553 Ga0105249_10027908 Ga0105249_100279083 322
314 3300014326 Ga0157380_10001894 Ga0157380_100018947 322
315 3300014745 Ga0157377_10004316 Ga0157377_100043164 322
316 3300025315 Ga0207697_10040236 Ga0207697_100402361 322
317 3300025907 Ga0207645_10028243 Ga0207645_100282432 322
318 3300025925 Ga0207650_10108978 Ga0207650_101089782 322
319 3300025926 Ga0207659_10047897 Ga0207659_100478972 322
320 3300025933 Ga0207706_10071824 Ga0207706_100718241 322
321 3300025936 Ga0207670_10017121 Ga0207670_100171214 322
322 3300025942 Ga0207689_10024584 Ga0207689_100245844 322
323 3300025960 Ga0207651_10038168 Ga0207651_100381685 322
324 3300025961 Ga0207712_10111605 Ga0207712_101116052 322
325 3300026089 Ga0207648_10197345 Ga0207648_101973451 322
326 3300026116 Ga0207674_10073922 Ga0207674_100739222 322
327 3300026118 Ga0207675_100007111 Ga0207675_1000071114 322
328 3300028380 Ga0268265_10041680 Ga0268265_100416804 322
329 3300028381 Ga0268264_10005175 Ga0268264_100051753 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01944

SpoIIM

Stage II sporulation protein M

123

302

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tcd-assembly1.cif.gz_A lov2-darpin fusion: d13 0.3737 150 265
7o3v-assembly1.cif.gz_I stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.3681 107 307
7o3v-assembly1.cif.gz_I stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.3576 107 307
3aou-assembly1.cif.gz_B structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase 0.3413 144 307
3aou-assembly1.cif.gz_B structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase 0.3381 144 307
ID Description Score Start End Superfamily
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6739 1 94 1.20.120.330
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.602 1 94 1.20.120.330
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4051 164 270 1.10.1760.20
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3775 164 270 1.10.1760.20
af_P47987_32_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3704 154 268 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A432IEX6-F1-model_v4 Stage II sporulation protein M 0.9728 148 316 GO:0016020
AF-A0A642C545-F1-model_v4 Stage II sporulation protein M 0.9705 162 304 GO:0016020
AF-A0A4Q3SK05-F1-model_v4 Stage II sporulation protein M 0.9659 87 311 GO:0016020
AF-A0A520B1X1-F1-model_v4 Stage II sporulation protein M 0.9612 105 311 GO:0016020
AF-A0A0M3CFY5-F1-model_v4 deleted 0.9595 98 310

Feature Viewer

pLDDT pTM Quality
80.18 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map