F409603

General Info

Members Datasets Scaffolds Average Seq Length
329 191 658 182

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10071214|Ga0075365_100712142
Length 202
Sequence VARGLRTASCSHLSDGSSCPEVGWGRPIVKVMESSAGDRLALEDLLAQIQPRVRRICGRMLLFHEDAEEASQDALLLVATKIHTFGGRSRFTTWLHAVASNSARSTYRSLKRRAAERPTAELPVHADPRTTSVIAGSRLDLLDALEVIGTDHPELVEPLVLRDVQELDYNEIAALLDVPLGTVKSRIHSARNAVRPLLRVTD

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
105 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
106 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
107 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
108 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
109 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
110 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
115 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
116 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2643221561 Nocardioides sp. Root151 Isolate Unclassified
182 2643221576 Nocardioides sp. Root614 Isolate Unclassified
183 2643221590 Nocardioides sp. Root682 Isolate Unclassified
184 2643221604 Nocardioides sp. Root190 Isolate Unclassified
185 2643221617 Nocardioides sp. Root79 Isolate Unclassified
186 2643221620 Nocardioides sp. Root240 Isolate Unclassified
187 2643221696 Nocardioides sp. Root140 Isolate Unclassified
188 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
189 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
190 2738541305 Nocardioides sp. CF167 Isolate Unclassified
191 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.15
Nodule 0
Rhizoplane 10.64
Rhizosphere 62.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10071214 3300006038 Bacteria 2340
2 rootH2_10006881 3300003320 Bacteria 1266
3 Ga0070658_10051834 3300005327 Bacteria 3326
4 Ga0070683_100011640 3300005329 Bacteria 7615
5 Ga0070683_100119787 3300005329 Bacteria 2486
6 Ga0070682_100001104 3300005337 Bacteria 15491
7 Ga0068868_100410724 3300005338 Bacteria 1170
8 Ga0070691_10328555 3300005341 Bacteria 843
9 Ga0070687_100048521 3300005343 Bacteria 2183
10 Ga0070661_100305059 3300005344 Bacteria 1240
11 Ga0070668_100250238 3300005347 Bacteria 1471
12 Ga0070674_100335797 3300005356 Bacteria 1216
13 Ga0070667_100091772 3300005367 Bacteria 2612
14 Ga0070667_100183161 3300005367 Bacteria 1853
15 Ga0070667_100363733 3300005367 Bacteria 1312
16 Ga0070667_100372648 3300005367 Bacteria 1296
17 Ga0070678_100150019 3300005456 Bacteria 1877
18 Ga0070678_100471513 3300005456 Bacteria 1103
19 Ga0070678_100771971 3300005456 Bacteria 871
20 Ga0070685_10248946 3300005466 Bacteria 1176
21 Ga0070679_100166320 3300005530 Bacteria 2179
22 Ga0070684_100007406 3300005535 Bacteria 8530
23 Ga0070672_100239382 3300005543 Bacteria 1526
24 Ga0070665_100001439 3300005548 Bacteria 27904
25 Ga0070665_100082281 3300005548 Bacteria 3225
26 Ga0068855_100032470 3300005563 Bacteria 6234
27 Ga0070664_100076401 3300005564 Bacteria 2878
28 Ga0070664_100133870 3300005564 Bacteria 2178
29 Ga0068857_100004764 3300005577 Bacteria 11490
30 Ga0068856_100449131 3300005614 Bacteria 1310
31 Ga0070702_100014560 3300005615 Bacteria 3992
32 Ga0068852_100262103 3300005616 Bacteria 1660
33 Ga0068852_100461908 3300005616 Bacteria 1259
34 Ga0068864_100254312 3300005618 Bacteria 1632
35 Ga0068864_100348409 3300005618 Bacteria 1397
36 Ga0068861_100494899 3300005719 Bacteria 1104
37 Ga0068870_10667557 3300005840 Bacteria 714
38 Ga0068858_100082355 3300005842 Bacteria 2991
39 Ga0068860_100001297 3300005843 Bacteria 27144
40 Ga0068860_100082238 3300005843 Bacteria 3063
41 Ga0068862_100561580 3300005844 Bacteria 1091
42 Ga0075365_10003425 3300006038 Bacteria 8163
43 Ga0075365_10010934 3300006038 Bacteria 5316
44 Ga0075365_10027432 3300006038 Bacteria 3624
45 Ga0075365_10037951 3300006038 Bacteria 3128
46 Ga0075365_10077986 3300006038 Bacteria 2239
47 Ga0075365_10088018 3300006038 Bacteria 2112
48 Ga0075365_10113788 3300006038 Bacteria 1861
49 Ga0075365_10136819 3300006038 Bacteria 1698
50 Ga0075365_10149552 3300006038 Bacteria 1624
51 Ga0075365_10352545 3300006038 Bacteria 1037
52 Ga0075368_10002230 3300006042 Bacteria 6298
53 Ga0075368_10011024 3300006042 Bacteria 3282
54 Ga0075368_10040799 3300006042 Bacteria 1823
55 Ga0075368_10088533 3300006042 Bacteria 1265
56 Ga0075363_100005699 3300006048 Bacteria 5576
57 Ga0075363_100017690 3300006048 Bacteria 3539
58 Ga0075363_100025132 3300006048 Bacteria 3034
59 Ga0075364_10012631 3300006051 Bacteria 5172
60 Ga0075364_10037461 3300006051 Bacteria 3140
61 Ga0075364_10591155 3300006051 Bacteria 758
62 Ga0075362_10001668 3300006177 Bacteria 7203
63 Ga0075362_10366528 3300006177 Bacteria 723
64 Ga0075367_10033481 3300006178 Bacteria 2962
65 Ga0075367_10077908 3300006178 Bacteria 2001
66 Ga0097621_100546387 3300006237 Bacteria 1054
67 Ga0097621_100626635 3300006237 Bacteria 985
68 Ga0075370_10021137 3300006353 Bacteria 3565
69 Ga0075370_10041781 3300006353 Bacteria 2589
70 Ga0075370_10138021 3300006353 Bacteria 1425
71 Ga0075370_10187537 3300006353 Bacteria 1218
72 Ga0068865_100022151 3300006881 Bacteria 4140
73 Ga0068865_100358769 3300006881 Bacteria 1183
74 Ga0105245_10022730 3300009098 Bacteria 5504
75 Ga0105243_10126282 3300009148 Bacteria 2164
76 Ga0105241_10963964 3300009174 Bacteria 796
77 Ga0105242_11369800 3300009176 Bacteria 734
78 Ga0105242_11375474 3300009176 Bacteria 732
79 Ga0105248_10060941 3300009177 Bacteria 4236
80 Ga0105237_10510178 3300009545 Bacteria 1209
81 Ga0105238_10161408 3300009551 Bacteria 2217
82 Ga0105249_10497332 3300009553 Bacteria 1264
83 Ga0105249_10753460 3300009553 Bacteria 1036
84 Ga0105239_10010776 3300010375 Bacteria 10214
85 Ga0105246_10000298 3300011119 Bacteria 26116
86 Ga0105246_10302158 3300011119 Bacteria 1292
87 Ga0105246_10595159 3300011119 Bacteria 955
88 Ga0157371_10392295 3300013102 Bacteria 1015
89 Ga0157369_10103603 3300013105 Bacteria 3031
90 Ga0157369_10589305 3300013105 Bacteria 1148
91 Ga0157369_11054740 3300013105 Bacteria 831
92 Ga0157374_10322385 3300013296 Bacteria 1531
93 Ga0163162_10050977 3300013306 Bacteria 4152
94 Ga0163162_10860016 3300013306 Bacteria 1022
95 Ga0157372_10006674 3300013307 Bacteria 12276
96 Ga0157375_10004579 3300013308 Bacteria 12013
97 Ga0157375_10032769 3300013308 Bacteria 4930
98 Ga0157375_10240909 3300013308 Bacteria 1968
99 Ga0163163_10014742 3300014325 Bacteria 7193
100 Ga0163163_10233008 3300014325 Bacteria 1891
101 Ga0157380_10146620 3300014326 Bacteria 2035
102 Ga0163161_10068767 3300017792 Bacteria 2588
103 Ga0207642_10084710 3300025899 Bacteria 1549
104 Ga0207688_10023028 3300025901 Bacteria 3408
105 Ga0207647_10054354 3300025904 Bacteria 2464
106 Ga0207662_10049813 3300025918 Bacteria 2486
107 Ga0207657_10048748 3300025919 Bacteria 3697
108 Ga0207652_10247250 3300025921 Bacteria 1608
109 Ga0207687_10023791 3300025927 Bacteria 4086
110 Ga0207687_10246809 3300025927 Bacteria 1417
111 Ga0207690_10093464 3300025932 Bacteria 2131
112 Ga0207669_10118486 3300025937 Bacteria 1792
113 Ga0207691_10151294 3300025940 Bacteria 2040
114 Ga0207689_10043822 3300025942 Bacteria 3698
115 Ga0207661_10322632 3300025944 Bacteria 1389
116 Ga0207679_10014302 3300025945 Bacteria 5214
117 Ga0207651_10359270 3300025960 Bacteria 1229
118 Ga0207668_10291969 3300025972 Bacteria 1342
119 Ga0207658_10211026 3300025986 Bacteria 1627
120 Ga0207658_10264708 3300025986 Bacteria 1467
121 Ga0207677_10381913 3300026023 Bacteria 1189
122 Ga0207677_10491357 3300026023 Bacteria 1059
123 Ga0207703_10604525 3300026035 Bacteria 1037
124 Ga0207678_10436513 3300026067 Bacteria 1137
125 Ga0207702_10374779 3300026078 Bacteria 1367
126 Ga0207702_11451444 3300026078 Bacteria 680
127 Ga0207648_10396486 3300026089 Bacteria 1250
128 Ga0207674_10003805 3300026116 Bacteria 18404
129 Ga0207675_100040876 3300026118 Bacteria 4331
130 Ga0207675_100830369 3300026118 Bacteria 938
131 Ga0207683_10148230 3300026121 Bacteria 2117
132 Ga0207698_10045547 3300026142 Bacteria 3306
133 Ga0207698_10383101 3300026142 Bacteria 1338
134 Ga0209813_10001575 3300027866 Bacteria 5124
135 Ga0209813_10009858 3300027866 Bacteria 2456
136 Ga0268266_10000937 3300028379 Bacteria 37178
137 Ga0268266_10075708 3300028379 Bacteria 2924
138 Ga0268264_10000226 3300028381 Bacteria 109817
139 Ga0268264_10069820 3300028381 Bacteria 2972
140 Ga0268264_11136702 3300028381 Bacteria 790
141 Ga0307515_10049506 3300028794 Bacteria 6318
142 Ga0307512_10028015 3300030522 Bacteria 4946
143 Ga0307512_10157927 3300030522 Bacteria 1337
144 Ga0307516_10034316 3300031730 Bacteria 5099
145 Ga0307413_10605118 3300031824 Bacteria 898
146 Ga0307410_10669054 3300031852 Bacteria 872
147 Ga0307410_11251196 3300031852 Bacteria 648
148 Ga0307406_10132822 3300031901 Bacteria 1750
149 Ga0307407_10010906 3300031903 Bacteria 4304
150 Ga0307412_10114838 3300031911 Bacteria 1929
151 Ga0307412_10394129 3300031911 Bacteria 1125
152 Ga0307409_100105949 3300031995 Bacteria 2345
153 Ga0307409_100283566 3300031995 Bacteria 1532
154 Ga0307409_100740191 3300031995 Bacteria 986
155 Ga0307416_100814508 3300032002 Bacteria 1030
156 Ga0307414_10126489 3300032004 Bacteria 1976
157 Ga0307411_10220038 3300032005 Bacteria 1472
158 Ga0307415_100058178 3300032126 Bacteria 2660
159 Ga0307415_100108371 3300032126 Bacteria 2055
160 Ga0373948_0006341 3300034817 Bacteria 1952
161 Ga0373939_0134461 3300035114 Bacteria 886
162 Ga0373962_0012659 3300035242 Bacteria 2129
163 Ga0316584_0700987 3300036712 Bacteria 694
164 Ga0395900_0039253 3300037418 Bacteria 4878
165 Ga0439438_035059 3300041405 Bacteria 1319
166 Ga0439461_0002571 3300041410 Bacteria 2916
167 Ga0451795_1685511 3300041456 Bacteria 880
168 Ga0451837_0214160 3300041494 Bacteria 863
169 Ga0451837_1843204 3300041494 Bacteria 775
170 Ga0451843_0650905 3300041509 Bacteria 1546
171 Ga0451853_0669789 3300041512 Bacteria 1808
172 Ga0451853_1190888 3300041512 Bacteria 7404
173 Ga0439431_0015675 3300041997 Bacteria 1765
174 Ga0439445_0112921 3300042004 Bacteria 776
175 Ga0439432_047421 3300042006 Bacteria 1348
176 Ga0439462_0142019 3300042015 Bacteria 673
177 Ga0450906_017953 3300042145 Bacteria 1272
178 Ga0450907_043289 3300042146 Bacteria 771
179 Ga0439434_0001358 3300042435 Bacteria 7051
180 Ga0466972_0036611 3300044658 Bacteria 2400
181 Ga0466966_0037671 3300044684 Bacteria 3117
182 Ga0466963_0457624 3300044694 Bacteria 900
183 Ga0466964_0344266 3300044706 Bacteria 764
184 Ga0466971_0160923 3300044719 Bacteria 1051
185 Ga0466970_0020433 3300044765 Bacteria 3440
186 Ga0466970_0071084 3300044765 Bacteria 1871
187 Ga0466970_0175021 3300044765 Bacteria 1190
188 Ga0466957_0180265 3300044842 Bacteria 1379
189 Ga0466958_0086829 3300045836 Bacteria 1931
190 Ga0466958_0287874 3300045836 Bacteria 1054
191 Ga0466967_0051509 3300045976 Bacteria 3608
192 Ga0466967_0081109 3300045976 Bacteria 2929
193 Ga0466967_0135133 3300045976 Bacteria 2293
194 Ga0466967_0421338 3300045976 Bacteria 1301
195 Ga0466967_0517221 3300045976 Bacteria 1172
196 Ga0466967_0809955 3300045976 Bacteria 930
197 Ga0495635_0236333 3300046663 Bacteria 1234
198 Ga0495676_0321598 3300047321 Bacteria 1039
199 Ga0496100_0051543 3300048903 Bacteria 2672
200 Ga0496100_0211506 3300048903 Bacteria 1419
201 Ga0496100_0331145 3300048903 Bacteria 1146
202 Ga0496101_0106012 3300048904 Bacteria 2110
203 Ga0496102_0012669 3300048905 Bacteria 7304
204 Ga0496102_0328979 3300048905 Bacteria 1439
205 Ga0496103_0043445 3300048906 Bacteria 2767
206 Ga0496103_0063695 3300048906 Bacteria 2297
207 Ga0496103_0112941 3300048906 Bacteria 1727
208 Ga0496105_0307331 3300048908 Bacteria 1274
209 Ga0496105_0456883 3300048908 Bacteria 1007
210 Ga0496106_0097457 3300048909 Bacteria 2277
211 Ga0496107_0147588 3300048910 Bacteria 1739
212 Ga0496107_0187227 3300048910 Bacteria 1537
213 Ga0496108_0044861 3300048911 Bacteria 3691
214 Ga0496108_0049462 3300048911 Bacteria 3516
215 Ga0496108_0399403 3300048911 Bacteria 1200
216 Ga0496109_0004707 3300048912 Bacteria 11391
217 Ga0496109_0084798 3300048912 Bacteria 2923
218 Ga0496109_0191118 3300048912 Bacteria 1924
219 Ga0496110_0065136 3300048913 Bacteria 3221
220 Ga0496110_0202244 3300048913 Bacteria 1805
221 Ga0496110_0296384 3300048913 Bacteria 1473
222 Ga0496111_0006076 3300048914 Bacteria 7806
223 Ga0496111_0042592 3300048914 Bacteria 3261
224 Ga0496113_0011465 3300048916 Bacteria 5915
225 Ga0496114_0005217 3300048917 Bacteria 10149
226 Ga0496114_0043107 3300048917 Bacteria 3742
227 Ga0496114_0043740 3300048917 Bacteria 3714
228 Ga0496114_0106380 3300048917 Bacteria 2400
229 Ga0496114_0173821 3300048917 Bacteria 1878
230 Ga0496114_0968850 3300048917 Bacteria 733
231 Ga0496115_0077599 3300048918 Bacteria 2701
232 Ga0496115_0111839 3300048918 Bacteria 2244
233 Ga0496122_0239499 3300048925 Bacteria 1024
234 Ga0496124_0049447 3300048927 Bacteria 3587
235 Ga0501031_0082983 3300049568 Bacteria 2089
236 Ga0501031_0358999 3300049568 Bacteria 943
237 Ga0501031_0375851 3300049568 Bacteria 919
238 Ga0501034_0033488 3300049571 Bacteria 5212
239 Ga0501034_0411115 3300049571 Bacteria 1275
240 Ga0501036_0170531 3300049572 Bacteria 1834
241 Ga0501037_0431618 3300049573 Bacteria 901
242 Ga0501038_0157267 3300049574 Bacteria 1850
243 Ga0501039_0017386 3300049575 Bacteria 5516
244 Ga0501041_0050816 3300049577 Bacteria 2526
245 Ga0501041_0071471 3300049577 Bacteria 2131
246 Ga0501047_0228939 3300049581 Bacteria 1713
247 Ga0501047_0869769 3300049581 Bacteria 715
248 Ga0501067_0002330 3300049583 Bacteria 10499
249 Ga0501067_0016959 3300049583 Bacteria 4023
250 Ga0501067_0018736 3300049583 Bacteria 3832
251 Ga0501067_0082020 3300049583 Bacteria 1788
252 Ga0501068_0008660 3300049584 Bacteria 5672
253 Ga0501068_0023054 3300049584 Bacteria 3646
254 Ga0501068_0034632 3300049584 Bacteria 3012
255 Ga0501069_0051401 3300049585 Bacteria 2293
256 Ga0501070_0001111 3300049586 Bacteria 24148
257 Ga0501070_0013573 3300049586 Bacteria 6866
258 Ga0501070_0051702 3300049586 Bacteria 3410
259 Ga0501070_0177029 3300049586 Bacteria 1756
260 Ga0501070_0243001 3300049586 Bacteria 1473
261 Ga0501070_0419212 3300049586 Bacteria 1081
262 Ga0501071_0003203 3300049587 Bacteria 10195
263 Ga0501072_0101276 3300049588 Bacteria 2289
264 Ga0501072_0417714 3300049588 Bacteria 1063
265 Ga0501072_0573832 3300049588 Bacteria 890
266 Ga0501073_0070866 3300049589 Bacteria 2428
267 Ga0501074_0020668 3300049590 Bacteria 4783
268 Ga0501074_0022466 3300049590 Bacteria 4583
269 Ga0501074_0052347 3300049590 Bacteria 2947
270 Ga0501077_0018640 3300049593 Bacteria 4389
271 Ga0501077_0027078 3300049593 Bacteria 3640
272 Ga0501079_0029157 3300049741 Bacteria 4235
273 Ga0501079_0304415 3300049741 Bacteria 1247
274 Ga0501080_0007937 3300049742 Bacteria 9614
275 Ga0501080_0030632 3300049742 Bacteria 5013
276 Ga0501080_0078826 3300049742 Bacteria 3063
277 Ga0501081_0227744 3300049743 Bacteria 1357
278 Ga0501083_0018564 3300049744 Bacteria 4847
279 Ga0501035_0435418 3300049822 Bacteria 1087
280 Ga0501045_0058623 3300049824 Bacteria 2820
281 nmdc:mga03683_46917_c1 3300050489 Bacteria 1792
282 nmdc:mga03n38_110707_c1 3300050490 Bacteria 1337
283 nmdc:mga03n38_11885_c1 3300050490 Bacteria 3258
284 nmdc:mga03n38_50678_c1 3300050490 Bacteria 1851
285 nmdc:mga00v17_121302_c1 3300050491 Bacteria 1665
286 nmdc:mga00v17_148281_c1 3300050491 Bacteria 1506
287 nmdc:mga00v17_166318_c1 3300050491 Bacteria 1421
288 nmdc:mga00v17_19585_c1 3300050491 Bacteria 3866
289 nmdc:mga0yw44_110867_c1 3300050492 Bacteria 1758
290 nmdc:mga0yw44_121039_c1 3300050492 Bacteria 1686
291 nmdc:mga0yw44_13344_c1 3300050492 Bacteria 4323
292 nmdc:mga0yw44_16620_c1 3300050492 Bacteria 3981
293 nmdc:mga0yw44_265598_c1 3300050492 Bacteria 1145
294 nmdc:mga0yw44_3998_c1 3300050492 Bacteria 6664
295 nmdc:mga0yw44_53144_c1 3300050492 Bacteria 2459
296 nmdc:mga0yw44_64030_c1 3300050492 Bacteria 2262
297 nmdc:mga0yw44_73541_c1 3300050492 Bacteria 2126
298 nmdc:mga0yw44_8857_c1 3300050492 Bacteria 5042
299 nmdc:mga0yw44_94674_c1 3300050492 Bacteria 1893
300 nmdc:mga0yw44_96277_c1 3300050492 Bacteria 1879
301 nmdc:mga06z11_15948_c1 3300050494 Bacteria 3370
302 nmdc:mga06z11_583442_c1 3300050494 Bacteria 680
303 nmdc:mga06z11_72690_c1 3300050494 Bacteria 1824
304 nmdc:mga06z11_94884_c1 3300050494 Bacteria 1627
305 nmdc:mga04h51_3451_c1 3300050495 Bacteria 3841
306 nmdc:mga04h51_5415_c2 3300050495 Bacteria 2456
307 nmdc:mga07m45_19357_c1 3300050496 Bacteria 3688
308 nmdc:mga07m45_50192_c2 3300050496 Bacteria 1479
309 nmdc:mga07m45_86560_c1 3300050496 Bacteria 1793
310 Ga0495619_0788508 3300053085 Bacteria 643
311 Ga0500644_0000203 3300053088 Bacteria 35985
312 Ga0500641_0076153 3300053096 Bacteria 1419
313 Ga0500573_0017445 3300053140 Bacteria 4086
314 Ga0501084_0013997 3300054114 Bacteria 6641
315 Ga0501082_0007309 3300060353 Bacteria 9530
316 Ga0501082_0144689 3300060353 Bacteria 2063
317 Ga0530510_0640209 3300061734 Bacteria 809
318 2643827227 2643221561 Bacteria 4984412
319 2643890862 2643221576 Bacteria 5214352
320 2643959918 2643221590 Bacteria 5214697
321 2644032672 2643221604 Bacteria 5014917
322 2644100904 2643221617 Bacteria 5139111
323 2644117313 2643221620 Bacteria 5134593
324 2644533946 2643221696 Bacteria 5431823
325 2645722079 2643221961 Bacteria 3919167
326 2645724921 2643221962 Bacteria 3874254
327 2645726861 2643221962 Bacteria 3874254
328 2738869096 2738541305 Bacteria 4910150
329 2855389608 2855386786 Bacteria 4752232
330 Ga0075365_10071214
331 rootH2_10006881
332 Ga0070658_10051834
333 Ga0070683_100011640
334 Ga0070683_100119787
335 Ga0070682_100001104
336 Ga0068868_100410724
337 Ga0070691_10328555
338 Ga0070687_100048521
339 Ga0070661_100305059
340 Ga0070668_100250238
341 Ga0070674_100335797
342 Ga0070667_100091772
343 Ga0070667_100183161
344 Ga0070667_100363733
345 Ga0070667_100372648
346 Ga0070678_100150019
347 Ga0070678_100471513
348 Ga0070678_100771971
349 Ga0070685_10248946
350 Ga0070679_100166320
351 Ga0070684_100007406
352 Ga0070672_100239382
353 Ga0070665_100001439
354 Ga0070665_100082281
355 Ga0068855_100032470
356 Ga0070664_100076401
357 Ga0070664_100133870
358 Ga0068857_100004764
359 Ga0068856_100449131
360 Ga0070702_100014560
361 Ga0068852_100262103
362 Ga0068852_100461908
363 Ga0068864_100254312
364 Ga0068864_100348409
365 Ga0068861_100494899
366 Ga0068870_10667557
367 Ga0068858_100082355
368 Ga0068860_100001297
369 Ga0068860_100082238
370 Ga0068862_100561580
371 Ga0075365_10003425
372 Ga0075365_10010934
373 Ga0075365_10027432
374 Ga0075365_10037951
375 Ga0075365_10077986
376 Ga0075365_10088018
377 Ga0075365_10113788
378 Ga0075365_10136819
379 Ga0075365_10149552
380 Ga0075365_10352545
381 Ga0075368_10002230
382 Ga0075368_10011024
383 Ga0075368_10040799
384 Ga0075368_10088533
385 Ga0075363_100005699
386 Ga0075363_100017690
387 Ga0075363_100025132
388 Ga0075364_10012631
389 Ga0075364_10037461
390 Ga0075364_10591155
391 Ga0075362_10001668
392 Ga0075362_10366528
393 Ga0075367_10033481
394 Ga0075367_10077908
395 Ga0097621_100546387
396 Ga0097621_100626635
397 Ga0075370_10021137
398 Ga0075370_10041781
399 Ga0075370_10138021
400 Ga0075370_10187537
401 Ga0068865_100022151
402 Ga0068865_100358769
403 Ga0105245_10022730
404 Ga0105243_10126282
405 Ga0105241_10963964
406 Ga0105242_11369800
407 Ga0105242_11375474
408 Ga0105248_10060941
409 Ga0105237_10510178
410 Ga0105238_10161408
411 Ga0105249_10497332
412 Ga0105249_10753460
413 Ga0105239_10010776
414 Ga0105246_10000298
415 Ga0105246_10302158
416 Ga0105246_10595159
417 Ga0157371_10392295
418 Ga0157369_10103603
419 Ga0157369_10589305
420 Ga0157369_11054740
421 Ga0157374_10322385
422 Ga0163162_10050977
423 Ga0163162_10860016
424 Ga0157372_10006674
425 Ga0157375_10004579
426 Ga0157375_10032769
427 Ga0157375_10240909
428 Ga0163163_10014742
429 Ga0163163_10233008
430 Ga0157380_10146620
431 Ga0163161_10068767
432 Ga0207642_10084710
433 Ga0207688_10023028
434 Ga0207647_10054354
435 Ga0207662_10049813
436 Ga0207657_10048748
437 Ga0207652_10247250
438 Ga0207687_10023791
439 Ga0207687_10246809
440 Ga0207690_10093464
441 Ga0207669_10118486
442 Ga0207691_10151294
443 Ga0207689_10043822
444 Ga0207661_10322632
445 Ga0207679_10014302
446 Ga0207651_10359270
447 Ga0207668_10291969
448 Ga0207658_10211026
449 Ga0207658_10264708
450 Ga0207677_10381913
451 Ga0207677_10491357
452 Ga0207703_10604525
453 Ga0207678_10436513
454 Ga0207702_10374779
455 Ga0207702_11451444
456 Ga0207648_10396486
457 Ga0207674_10003805
458 Ga0207675_100040876
459 Ga0207675_100830369
460 Ga0207683_10148230
461 Ga0207698_10045547
462 Ga0207698_10383101
463 Ga0209813_10001575
464 Ga0209813_10009858
465 Ga0268266_10000937
466 Ga0268266_10075708
467 Ga0268264_10000226
468 Ga0268264_10069820
469 Ga0268264_11136702
470 Ga0307515_10049506
471 Ga0307512_10028015
472 Ga0307512_10157927
473 Ga0307516_10034316
474 Ga0307413_10605118
475 Ga0307410_10669054
476 Ga0307410_11251196
477 Ga0307406_10132822
478 Ga0307407_10010906
479 Ga0307412_10114838
480 Ga0307412_10394129
481 Ga0307409_100105949
482 Ga0307409_100283566
483 Ga0307409_100740191
484 Ga0307416_100814508
485 Ga0307414_10126489
486 Ga0307411_10220038
487 Ga0307415_100058178
488 Ga0307415_100108371
489 Ga0373948_0006341
490 Ga0373939_0134461
491 Ga0373962_0012659
492 Ga0316584_0700987
493 Ga0395900_0039253
494 Ga0439438_035059
495 Ga0439461_0002571
496 Ga0451795_1685511
497 Ga0451837_0214160
498 Ga0451837_1843204
499 Ga0451843_0650905
500 Ga0451853_0669789
501 Ga0451853_1190888
502 Ga0439431_0015675
503 Ga0439445_0112921
504 Ga0439432_047421
505 Ga0439462_0142019
506 Ga0450906_017953
507 Ga0450907_043289
508 Ga0439434_0001358
509 Ga0466972_0036611
510 Ga0466966_0037671
511 Ga0466963_0457624
512 Ga0466964_0344266
513 Ga0466971_0160923
514 Ga0466970_0020433
515 Ga0466970_0071084
516 Ga0466970_0175021
517 Ga0466957_0180265
518 Ga0466958_0086829
519 Ga0466958_0287874
520 Ga0466967_0051509
521 Ga0466967_0081109
522 Ga0466967_0135133
523 Ga0466967_0421338
524 Ga0466967_0517221
525 Ga0466967_0809955
526 Ga0495635_0236333
527 Ga0495676_0321598
528 Ga0496100_0051543
529 Ga0496100_0211506
530 Ga0496100_0331145
531 Ga0496101_0106012
532 Ga0496102_0012669
533 Ga0496102_0328979
534 Ga0496103_0043445
535 Ga0496103_0063695
536 Ga0496103_0112941
537 Ga0496105_0307331
538 Ga0496105_0456883
539 Ga0496106_0097457
540 Ga0496107_0147588
541 Ga0496107_0187227
542 Ga0496108_0044861
543 Ga0496108_0049462
544 Ga0496108_0399403
545 Ga0496109_0004707
546 Ga0496109_0084798
547 Ga0496109_0191118
548 Ga0496110_0065136
549 Ga0496110_0202244
550 Ga0496110_0296384
551 Ga0496111_0006076
552 Ga0496111_0042592
553 Ga0496113_0011465
554 Ga0496114_0005217
555 Ga0496114_0043107
556 Ga0496114_0043740
557 Ga0496114_0106380
558 Ga0496114_0173821
559 Ga0496114_0968850
560 Ga0496115_0077599
561 Ga0496115_0111839
562 Ga0496122_0239499
563 Ga0496124_0049447
564 Ga0501031_0082983
565 Ga0501031_0358999
566 Ga0501031_0375851
567 Ga0501034_0033488
568 Ga0501034_0411115
569 Ga0501036_0170531
570 Ga0501037_0431618
571 Ga0501038_0157267
572 Ga0501039_0017386
573 Ga0501041_0050816
574 Ga0501041_0071471
575 Ga0501047_0228939
576 Ga0501047_0869769
577 Ga0501067_0002330
578 Ga0501067_0016959
579 Ga0501067_0018736
580 Ga0501067_0082020
581 Ga0501068_0008660
582 Ga0501068_0023054
583 Ga0501068_0034632
584 Ga0501069_0051401
585 Ga0501070_0001111
586 Ga0501070_0013573
587 Ga0501070_0051702
588 Ga0501070_0177029
589 Ga0501070_0243001
590 Ga0501070_0419212
591 Ga0501071_0003203
592 Ga0501072_0101276
593 Ga0501072_0417714
594 Ga0501072_0573832
595 Ga0501073_0070866
596 Ga0501074_0020668
597 Ga0501074_0022466
598 Ga0501074_0052347
599 Ga0501077_0018640
600 Ga0501077_0027078
601 Ga0501079_0029157
602 Ga0501079_0304415
603 Ga0501080_0007937
604 Ga0501080_0030632
605 Ga0501080_0078826
606 Ga0501081_0227744
607 Ga0501083_0018564
608 Ga0501035_0435418
609 Ga0501045_0058623
610 nmdc:mga03683_46917_c1
611 nmdc:mga03n38_110707_c1
612 nmdc:mga03n38_11885_c1
613 nmdc:mga03n38_50678_c1
614 nmdc:mga00v17_121302_c1
615 nmdc:mga00v17_148281_c1
616 nmdc:mga00v17_166318_c1
617 nmdc:mga00v17_19585_c1
618 nmdc:mga0yw44_110867_c1
619 nmdc:mga0yw44_121039_c1
620 nmdc:mga0yw44_13344_c1
621 nmdc:mga0yw44_16620_c1
622 nmdc:mga0yw44_265598_c1
623 nmdc:mga0yw44_3998_c1
624 nmdc:mga0yw44_53144_c1
625 nmdc:mga0yw44_64030_c1
626 nmdc:mga0yw44_73541_c1
627 nmdc:mga0yw44_8857_c1
628 nmdc:mga0yw44_94674_c1
629 nmdc:mga0yw44_96277_c1
630 nmdc:mga06z11_15948_c1
631 nmdc:mga06z11_583442_c1
632 nmdc:mga06z11_72690_c1
633 nmdc:mga06z11_94884_c1
634 nmdc:mga04h51_3451_c1
635 nmdc:mga04h51_5415_c2
636 nmdc:mga07m45_19357_c1
637 nmdc:mga07m45_50192_c2
638 nmdc:mga07m45_86560_c1
639 Ga0495619_0788508
640 Ga0500644_0000203
641 Ga0500641_0076153
642 Ga0500573_0017445
643 Ga0501084_0013997
644 Ga0501082_0007309
645 Ga0501082_0144689
646 Ga0530510_0640209
647 2643827227
648 2643890862
649 2643959918
650 2644032672
651 2644100904
652 2644117313
653 2644533946
654 2645722079
655 2645724921
656 2645726861
657 2738869096
658 2855389608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

45

113

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

154

196

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

153

194

0.93

PF07638

Sigma70_ECF

ECF sigma factor

28

200

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o7g-assembly1.cif.gz_A crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis 0.9466 1 89
2o7g-assembly1.cif.gz_A crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis 0.9365 1 89
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9281 120 181
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9132 11 96
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.904 136 179
ID Description Score Start End Superfamily
2o7gB00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9507 2 89 1.10.1740.10
2o7gA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9466 1 89 1.10.1740.10
af_P9WGH1_1_91_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9421 1 89 1.10.1740.10
2o7gA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9365 1 89 1.10.1740.10
2o7gB00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9203 2 89 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A0Q8WSQ7-F1-model_v4 RNA polymerase subunit sigma-24 0.9382 8 178 GO:0003677
GO:0006352
GO:0016987
AF-A0A561BMM1-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.9311 5 179 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W3LWU7-F1-model_v4 RNA polymerase sigma-70 factor (ECF subfamily) 0.9225 8 181 GO:0003677
GO:0006352
GO:0016987
AF-A0A2E2Q0H5-F1-model_v4 RNA polymerase subunit sigma-24 0.912 5 181 GO:0003677
GO:0006352
GO:0016987
AF-A0A4R0K0H6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8939 5 179 GO:0003677
GO:0006352
GO:0016987

Map