F409554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 329 | 165 | 658 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100348960|Ga0070714_1003489602 |
| Length | 373 |
| Sequence | MATLRERLVTVAFRAGWSLVCRLPESWARSLFEFGADLAWRRQGPGVQVLEGNLVRVLRTRAGDSLTPSEFGAELRALSRAVMRSYARYYLEAFRLQVIPDERILSGMHVNMEQLELTLEYMRGGRGVIYALPHMGDFEQAGRWVILAGAGSIVAPAERLKPESVFQMFLAFRQGLGMEIVPTSGGPHPFGVMAQRLRAGKLVTIVADRDLSDTGVEVDFFGEKALFPAGPAALAVQTGAALMPVACWFVGEDEWGARIYDEIPVPADGDRKQKVAAMTQAMVRVFEQGISEHPEHWHMLQKVFVNDLDPERLARTRARAMNGNGRAAADVAGPGVTPDDRGTPGTMAEPSSAQRGVRGVVPPGDDGGAPTCA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 30 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 43 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 44 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 65 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 66 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 67 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 68 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 69 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 70 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 71 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 73 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 74 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 75 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 77 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 80 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 81 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 82 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 83 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 84 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 85 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 86 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 87 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 90 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 92 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 93 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 94 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 97 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 98 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 105 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 158 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 159 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 160 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 161 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 162 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 163 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 164 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 165 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.96 |
| Metatranscriptomes | 0.3 |
| Isolates | 2.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.94 |
| Rhizosphere | 85.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100348960 | 3300005435 | Bacteria | 1389 |
| 2 | Ga0070660_100064886 | 3300005339 | Bacteria | 2842 |
| 3 | Ga0070709_10000283 | 3300005434 | Bacteria | 32257 |
| 4 | Ga0070709_10010613 | 3300005434 | Bacteria | 5106 |
| 5 | Ga0070709_10045942 | 3300005434 | Bacteria | 2713 |
| 6 | Ga0070714_100000190 | 3300005435 | Bacteria | 49579 |
| 7 | Ga0070714_100000403 | 3300005435 | Bacteria | 31860 |
| 8 | Ga0070714_100120170 | 3300005435 | Bacteria | 2336 |
| 9 | Ga0070714_100208543 | 3300005435 | Bacteria | 1790 |
| 10 | Ga0070714_100539409 | 3300005435 | Bacteria | 1116 |
| 11 | Ga0070713_100000848 | 3300005436 | Bacteria | 19595 |
| 12 | Ga0070713_100058709 | 3300005436 | Bacteria | 3210 |
| 13 | Ga0070713_100079830 | 3300005436 | Bacteria | 2788 |
| 14 | Ga0070713_100106250 | 3300005436 | Bacteria | 2440 |
| 15 | Ga0070713_100388596 | 3300005436 | Bacteria | 1301 |
| 16 | Ga0070710_10000160 | 3300005437 | Bacteria | 31176 |
| 17 | Ga0070710_10056636 | 3300005437 | Bacteria | 2218 |
| 18 | Ga0070711_100000349 | 3300005439 | Bacteria | 23811 |
| 19 | Ga0070711_100215210 | 3300005439 | Bacteria | 1490 |
| 20 | Ga0070711_100292016 | 3300005439 | Bacteria | 1293 |
| 21 | Ga0070705_100024227 | 3300005440 | Bacteria | 3273 |
| 22 | Ga0070708_100040258 | 3300005445 | Bacteria | 4092 |
| 23 | Ga0070708_100173116 | 3300005445 | Bacteria | 2016 |
| 24 | Ga0070708_100234489 | 3300005445 | Bacteria | 1722 |
| 25 | Ga0070663_100270632 | 3300005455 | Bacteria | 1350 |
| 26 | Ga0070681_10049324 | 3300005458 | Bacteria | 4205 |
| 27 | Ga0070706_100008821 | 3300005467 | Bacteria | 9395 |
| 28 | Ga0070706_100047459 | 3300005467 | Bacteria | 3962 |
| 29 | Ga0070706_100053186 | 3300005467 | Bacteria | 3737 |
| 30 | Ga0070706_100133490 | 3300005467 | Bacteria | 2317 |
| 31 | Ga0070706_100151355 | 3300005467 | Bacteria | 2166 |
| 32 | Ga0070706_100334404 | 3300005467 | Bacteria | 1412 |
| 33 | Ga0070707_100001347 | 3300005468 | Bacteria | 24122 |
| 34 | Ga0070707_100009928 | 3300005468 | Bacteria | 8860 |
| 35 | Ga0070707_100015657 | 3300005468 | Bacteria | 7118 |
| 36 | Ga0070707_100054998 | 3300005468 | Bacteria | 3816 |
| 37 | Ga0070707_100141771 | 3300005468 | Bacteria | 2339 |
| 38 | Ga0070707_100383429 | 3300005468 | Bacteria | 1365 |
| 39 | Ga0070698_100001666 | 3300005471 | Bacteria | 24785 |
| 40 | Ga0070698_100004413 | 3300005471 | Bacteria | 15458 |
| 41 | Ga0070698_100006398 | 3300005471 | Bacteria | 12784 |
| 42 | Ga0070698_100025502 | 3300005471 | Bacteria | 6162 |
| 43 | Ga0070698_100235103 | 3300005471 | Bacteria | 1765 |
| 44 | Ga0070698_100324353 | 3300005471 | Bacteria | 1471 |
| 45 | Ga0070698_100349689 | 3300005471 | Bacteria | 1410 |
| 46 | Ga0070699_100012274 | 3300005518 | Bacteria | 7390 |
| 47 | Ga0070679_100272698 | 3300005530 | Bacteria | 1645 |
| 48 | Ga0070697_100096704 | 3300005536 | Bacteria | 2450 |
| 49 | Ga0070695_100046689 | 3300005545 | Bacteria | 2764 |
| 50 | Ga0068855_100032385 | 3300005563 | Bacteria | 6243 |
| 51 | Ga0068857_100116072 | 3300005577 | Bacteria | 2408 |
| 52 | Ga0068856_100064115 | 3300005614 | Bacteria | 3630 |
| 53 | Ga0068856_100191925 | 3300005614 | Bacteria | 2056 |
| 54 | Ga0068856_100328716 | 3300005614 | Bacteria | 1546 |
| 55 | Ga0068864_100086274 | 3300005618 | Bacteria | 2761 |
| 56 | Ga0068858_100021000 | 3300005842 | Bacteria | 6101 |
| 57 | Ga0068860_100132647 | 3300005843 | Bacteria | 2391 |
| 58 | Ga0070717_10001151 | 3300006028 | Bacteria | 17860 |
| 59 | Ga0070717_10016182 | 3300006028 | Bacteria | 5779 |
| 60 | Ga0070717_10053813 | 3300006028 | Bacteria | 3318 |
| 61 | Ga0070717_10067333 | 3300006028 | Bacteria | 2979 |
| 62 | Ga0070717_10101141 | 3300006028 | Bacteria | 2448 |
| 63 | Ga0070715_10054249 | 3300006163 | Bacteria | 1735 |
| 64 | Ga0070716_100000732 | 3300006173 | Bacteria | 14013 |
| 65 | Ga0070712_100002043 | 3300006175 | Bacteria | 12364 |
| 66 | Ga0070712_100022493 | 3300006175 | Bacteria | 4154 |
| 67 | Ga0070712_100196248 | 3300006175 | Bacteria | 1583 |
| 68 | Ga0070712_100232620 | 3300006175 | Bacteria | 1464 |
| 69 | Ga0097621_100055957 | 3300006237 | Bacteria | 3222 |
| 70 | Ga0075434_100137363 | 3300006871 | Bacteria | 2464 |
| 71 | Ga0075435_100133534 | 3300007076 | Bacteria | 2078 |
| 72 | Ga0105245_10012611 | 3300009098 | Bacteria | 7359 |
| 73 | Ga0105242_10405186 | 3300009176 | Bacteria | 1274 |
| 74 | Ga0105237_10109466 | 3300009545 | Bacteria | 2755 |
| 75 | Ga0105238_10118632 | 3300009551 | Bacteria | 2626 |
| 76 | Ga0105249_10292845 | 3300009553 | Bacteria | 1630 |
| 77 | Ga0157370_10031020 | 3300013104 | Bacteria | 5233 |
| 78 | Ga0157370_10090813 | 3300013104 | Bacteria | 2868 |
| 79 | Ga0157369_10297191 | 3300013105 | Bacteria | 1680 |
| 80 | Ga0157374_10090760 | 3300013296 | Bacteria | 2913 |
| 81 | Ga0163162_10031339 | 3300013306 | Bacteria | 5274 |
| 82 | Ga0157379_10044517 | 3300014968 | Bacteria | 3962 |
| 83 | Ga0157376_10131116 | 3300014969 | Bacteria | 2237 |
| 84 | Ga0157376_10388562 | 3300014969 | Bacteria | 1346 |
| 85 | Ga0154015_1162151 | 3300020610 | Bacteria | 2024 |
| 86 | Ga0213875_10000176 | 3300021388 | Bacteria | 67409 |
| 87 | Ga0213875_10000419 | 3300021388 | Bacteria | 37296 |
| 88 | Ga0207692_10000102 | 3300025898 | Bacteria | 25160 |
| 89 | Ga0207692_10015285 | 3300025898 | Bacteria | 3374 |
| 90 | Ga0207685_10005223 | 3300025905 | Bacteria | 3404 |
| 91 | Ga0207685_10019755 | 3300025905 | Bacteria | 2225 |
| 92 | Ga0207699_10000332 | 3300025906 | Bacteria | 25007 |
| 93 | Ga0207699_10006274 | 3300025906 | Bacteria | 5744 |
| 94 | Ga0207699_10025475 | 3300025906 | Bacteria | 3247 |
| 95 | Ga0207684_10081170 | 3300025910 | Bacteria | 2759 |
| 96 | Ga0207684_10208364 | 3300025910 | Bacteria | 1686 |
| 97 | Ga0207707_10013467 | 3300025912 | Bacteria | 7127 |
| 98 | Ga0207707_10064164 | 3300025912 | Bacteria | 3197 |
| 99 | Ga0207671_10065321 | 3300025914 | Bacteria | 2706 |
| 100 | Ga0207693_10005592 | 3300025915 | Bacteria | 10447 |
| 101 | Ga0207693_10022597 | 3300025915 | Bacteria | 4997 |
| 102 | Ga0207693_10044924 | 3300025915 | Bacteria | 3471 |
| 103 | Ga0207693_10044951 | 3300025915 | Bacteria | 3470 |
| 104 | Ga0207693_10220304 | 3300025915 | Bacteria | 1491 |
| 105 | Ga0207663_10000446 | 3300025916 | Bacteria | 17922 |
| 106 | Ga0207663_10005910 | 3300025916 | Bacteria | 6211 |
| 107 | Ga0207663_10028598 | 3300025916 | Bacteria | 3264 |
| 108 | Ga0207652_10207518 | 3300025921 | Bacteria | 1764 |
| 109 | Ga0207646_10003961 | 3300025922 | Bacteria | 16427 |
| 110 | Ga0207646_10024171 | 3300025922 | Bacteria | 5570 |
| 111 | Ga0207646_10102890 | 3300025922 | Bacteria | 2561 |
| 112 | Ga0207646_10130238 | 3300025922 | Bacteria | 2264 |
| 113 | Ga0207646_10195963 | 3300025922 | Bacteria | 1824 |
| 114 | Ga0207646_10238866 | 3300025922 | Bacteria | 1641 |
| 115 | Ga0207646_10334427 | 3300025922 | Bacteria | 1368 |
| 116 | Ga0207687_10045597 | 3300025927 | Bacteria | 3031 |
| 117 | Ga0207700_10000139 | 3300025928 | Bacteria | 43579 |
| 118 | Ga0207700_10003646 | 3300025928 | Bacteria | 8982 |
| 119 | Ga0207700_10008409 | 3300025928 | Bacteria | 6393 |
| 120 | Ga0207700_10013924 | 3300025928 | Bacteria | 5255 |
| 121 | Ga0207700_10025108 | 3300025928 | Bacteria | 4133 |
| 122 | Ga0207700_10086677 | 3300025928 | Bacteria | 2461 |
| 123 | Ga0207700_10127524 | 3300025928 | Bacteria | 2072 |
| 124 | Ga0207700_10474818 | 3300025928 | Bacteria | 1104 |
| 125 | Ga0207664_10000108 | 3300025929 | Bacteria | 72754 |
| 126 | Ga0207664_10000209 | 3300025929 | Bacteria | 44400 |
| 127 | Ga0207664_10003668 | 3300025929 | Bacteria | 10287 |
| 128 | Ga0207664_10035533 | 3300025929 | Bacteria | 3845 |
| 129 | Ga0207664_10111940 | 3300025929 | Bacteria | 2272 |
| 130 | Ga0207664_10264250 | 3300025929 | Bacteria | 1506 |
| 131 | Ga0207665_10000753 | 3300025939 | Bacteria | 21805 |
| 132 | Ga0207665_10013553 | 3300025939 | Bacteria | 5362 |
| 133 | Ga0207665_10232937 | 3300025939 | Bacteria | 1354 |
| 134 | Ga0207661_10113007 | 3300025944 | Bacteria | 2300 |
| 135 | Ga0207703_10008002 | 3300026035 | Bacteria | 8354 |
| 136 | Ga0207678_10022511 | 3300026067 | Bacteria | 5518 |
| 137 | Ga0207702_10165211 | 3300026078 | Bacteria | 2024 |
| 138 | Ga0207674_10031076 | 3300026116 | Bacteria | 5611 |
| 139 | Ga0207674_10031563 | 3300026116 | Bacteria | 5563 |
| 140 | Ga0268264_10094994 | 3300028381 | Bacteria | 2579 |
| 141 | Ga0265337_1000743 | 3300028556 | Bacteria | 17209 |
| 142 | Ga0265326_10024390 | 3300028558 | Bacteria | 1726 |
| 143 | Ga0265334_10000299 | 3300028573 | Bacteria | 27741 |
| 144 | Ga0265323_10002444 | 3300028653 | Bacteria | 8506 |
| 145 | Ga0265336_10004015 | 3300028666 | Bacteria | 5621 |
| 146 | Ga0265338_10002286 | 3300028800 | Bacteria | 29188 |
| 147 | Ga0265338_10002589 | 3300028800 | Bacteria | 26744 |
| 148 | Ga0265338_10006407 | 3300028800 | Bacteria | 15001 |
| 149 | Ga0265324_10002757 | 3300029957 | Bacteria | 8722 |
| 150 | Ga0265332_10023962 | 3300031238 | Bacteria | 2689 |
| 151 | Ga0265320_10010077 | 3300031240 | Bacteria | 5651 |
| 152 | Ga0265325_10009760 | 3300031241 | Bacteria | 5593 |
| 153 | Ga0265340_10010078 | 3300031247 | Bacteria | 5060 |
| 154 | Ga0265339_10090602 | 3300031249 | Bacteria | 1603 |
| 155 | Ga0265316_10046226 | 3300031344 | Bacteria | 3451 |
| 156 | Ga0265313_10007666 | 3300031595 | Bacteria | 7314 |
| 157 | Ga0265314_10008636 | 3300031711 | Bacteria | 8715 |
| 158 | Ga0307409_100091295 | 3300031995 | Bacteria | 2496 |
| 159 | Ga0316214_1007220 | 3300033545 | Bacteria | 1479 |
| 160 | Ga0373934_0000739 | 3300035086 | Bacteria | 11679 |
| 161 | Ga0373949_0007286 | 3300035090 | Bacteria | 2422 |
| 162 | Ga0373951_0016336 | 3300035091 | Bacteria | 1674 |
| 163 | Ga0373923_0041591 | 3300035111 | Bacteria | 1895 |
| 164 | Ga0373945_0062384 | 3300035116 | Bacteria | 1393 |
| 165 | Ga0373953_0000215 | 3300035117 | Bacteria | 15784 |
| 166 | Ga0373954_0008476 | 3300035118 | Bacteria | 4515 |
| 167 | Ga0373956_0001535 | 3300035119 | Bacteria | 9527 |
| 168 | Ga0373956_0082104 | 3300035119 | Bacteria | 1480 |
| 169 | Ga0373957_0000144 | 3300035120 | Bacteria | 17836 |
| 170 | Ga0373946_0065405 | 3300035171 | Bacteria | 1557 |
| 171 | Ga0373955_0000420 | 3300035172 | Bacteria | 17929 |
| 172 | Ga0373955_0009781 | 3300035172 | Bacteria | 4506 |
| 173 | Ga0373955_0050659 | 3300035172 | Bacteria | 2259 |
| 174 | Ga0373961_0038291 | 3300035241 | Bacteria | 1373 |
| 175 | Ga0373924_0018335 | 3300035410 | Bacteria | 2695 |
| 176 | Ga0373931_0010121 | 3300035691 | Bacteria | 4524 |
| 177 | Ga0373931_0036921 | 3300035691 | Bacteria | 2549 |
| 178 | Ga0373931_0151583 | 3300035691 | Bacteria | 1352 |
| 179 | Ga0373935_0112500 | 3300035692 | Bacteria | 1808 |
| 180 | Ga0373933_0000169 | 3300035724 | Bacteria | 42826 |
| 181 | Ga0373933_0030394 | 3300035724 | Bacteria | 3127 |
| 182 | Ga0373947_0056916 | 3300035725 | Bacteria | 2364 |
| 183 | Ga0373937_0001816 | 3300036401 | Bacteria | 17916 |
| 184 | Ga0373937_0098198 | 3300036401 | Bacteria | 2716 |
| 185 | Ga0373937_0170133 | 3300036401 | Bacteria | 2044 |
| 186 | Ga0373937_0438616 | 3300036401 | Bacteria | 1240 |
| 187 | Ga0373925_0000030 | 3300037068 | Bacteria | 146196 |
| 188 | Ga0373925_0014478 | 3300037068 | Bacteria | 5700 |
| 189 | Ga0373925_0024705 | 3300037068 | Bacteria | 4388 |
| 190 | Ga0395900_0353965 | 3300037418 | Bacteria | 1441 |
| 191 | Ga0395898_0038401 | 3300037466 | Bacteria | 4746 |
| 192 | Ga0395898_0065122 | 3300037466 | Bacteria | 3534 |
| 193 | Ga0436364_0014047 | 3300037853 | Bacteria | 2642 |
| 194 | Ga0436364_0303129 | 3300037853 | Bacteria | 102080 |
| 195 | Ga0436364_1281565 | 3300037853 | Bacteria | 7992 |
| 196 | Ga0395901_0022567 | 3300038443 | Bacteria | 6451 |
| 197 | Ga0466963_0006273 | 3300044694 | Bacteria | 7029 |
| 198 | Ga0495592_0001208 | 3300046454 | Bacteria | 17934 |
| 199 | Ga0495592_0034957 | 3300046454 | Bacteria | 3787 |
| 200 | Ga0495651_0001519 | 3300046462 | Bacteria | 17944 |
| 201 | Ga0495651_0022257 | 3300046462 | Bacteria | 4927 |
| 202 | Ga0495653_0008395 | 3300046463 | Bacteria | 8467 |
| 203 | Ga0495653_0015735 | 3300046463 | Bacteria | 6168 |
| 204 | Ga0495653_0031280 | 3300046463 | Bacteria | 4230 |
| 205 | Ga0495653_0059302 | 3300046463 | Bacteria | 2905 |
| 206 | Ga0495662_0054965 | 3300046476 | Bacteria | 1923 |
| 207 | Ga0495662_0056022 | 3300046476 | Bacteria | 1904 |
| 208 | Ga0495664_0027282 | 3300046477 | Bacteria | 3328 |
| 209 | Ga0495664_0040826 | 3300046477 | Bacteria | 2744 |
| 210 | Ga0495664_0142659 | 3300046477 | Bacteria | 1452 |
| 211 | Ga0495608_0001287 | 3300046511 | Bacteria | 17813 |
| 212 | Ga0495608_0003912 | 3300046511 | Bacteria | 10708 |
| 213 | Ga0495608_0013142 | 3300046511 | Bacteria | 5746 |
| 214 | Ga0495608_0027452 | 3300046511 | Bacteria | 3872 |
| 215 | Ga0495618_0020845 | 3300046514 | Bacteria | 4034 |
| 216 | Ga0495618_0032496 | 3300046514 | Bacteria | 3268 |
| 217 | Ga0495628_0020744 | 3300046516 | Bacteria | 5415 |
| 218 | Ga0495628_0039665 | 3300046516 | Bacteria | 3765 |
| 219 | Ga0495628_0096069 | 3300046516 | Bacteria | 2289 |
| 220 | Ga0495630_0039116 | 3300046517 | Bacteria | 3547 |
| 221 | Ga0495652_0009477 | 3300046529 | Bacteria | 8846 |
| 222 | Ga0495652_0019130 | 3300046529 | Bacteria | 6100 |
| 223 | Ga0495652_0019523 | 3300046529 | Bacteria | 6033 |
| 224 | Ga0495652_0022081 | 3300046529 | Bacteria | 5651 |
| 225 | Ga0495652_0043267 | 3300046529 | Bacteria | 3880 |
| 226 | Ga0495640_0018588 | 3300046533 | Bacteria | 5148 |
| 227 | Ga0495640_0020041 | 3300046533 | Bacteria | 4930 |
| 228 | Ga0495586_0047915 | 3300046535 | Bacteria | 2308 |
| 229 | Ga0495587_0000934 | 3300046536 | Bacteria | 19235 |
| 230 | Ga0495587_0005674 | 3300046536 | Bacteria | 8136 |
| 231 | Ga0495645_0039140 | 3300046543 | Bacteria | 3458 |
| 232 | Ga0495645_0117780 | 3300046543 | Bacteria | 1873 |
| 233 | Ga0495667_0001051 | 3300046559 | Bacteria | 17934 |
| 234 | Ga0495667_0013681 | 3300046559 | Bacteria | 5483 |
| 235 | Ga0495667_0044600 | 3300046559 | Bacteria | 2936 |
| 236 | Ga0495634_0060342 | 3300046642 | Bacteria | 2523 |
| 237 | Ga0495634_0112104 | 3300046642 | Bacteria | 1753 |
| 238 | Ga0495635_0076682 | 3300046663 | Bacteria | 2290 |
| 239 | Ga0495657_0001875 | 3300046675 | Bacteria | 17880 |
| 240 | Ga0495657_0018682 | 3300046675 | Bacteria | 5009 |
| 241 | Ga0495657_0080283 | 3300046675 | Bacteria | 2111 |
| 242 | Ga0495657_0093421 | 3300046675 | Bacteria | 1925 |
| 243 | Ga0495599_0000780 | 3300046678 | Bacteria | 17939 |
| 244 | Ga0495599_0007148 | 3300046678 | Bacteria | 6760 |
| 245 | Ga0495599_0012278 | 3300046678 | Bacteria | 5277 |
| 246 | Ga0495623_0001166 | 3300046679 | Bacteria | 17826 |
| 247 | Ga0495646_0009435 | 3300046680 | Bacteria | 6191 |
| 248 | Ga0495646_0015047 | 3300046680 | Bacteria | 4914 |
| 249 | Ga0495646_0017416 | 3300046680 | Bacteria | 4558 |
| 250 | Ga0495647_0104147 | 3300046681 | Bacteria | 1178 |
| 251 | Ga0495613_0188598 | 3300046689 | Bacteria | 1458 |
| 252 | Ga0495624_0067319 | 3300046690 | Bacteria | 2234 |
| 253 | Ga0495600_0004783 | 3300046809 | Bacteria | 8125 |
| 254 | Ga0495600_0007875 | 3300046809 | Bacteria | 6525 |
| 255 | Ga0495600_0018626 | 3300046809 | Bacteria | 4425 |
| 256 | Ga0495604_0001722 | 3300047317 | Bacteria | 17944 |
| 257 | Ga0495604_0008350 | 3300047317 | Bacteria | 8189 |
| 258 | Ga0495604_0023936 | 3300047317 | Bacteria | 4875 |
| 259 | Ga0495604_0035144 | 3300047317 | Bacteria | 3959 |
| 260 | Ga0495674_0005465 | 3300047319 | Bacteria | 12207 |
| 261 | Ga0495674_0011055 | 3300047319 | Bacteria | 8523 |
| 262 | Ga0495674_0018780 | 3300047319 | Bacteria | 6433 |
| 263 | Ga0495674_0071948 | 3300047319 | Bacteria | 2983 |
| 264 | Ga0495676_0027993 | 3300047321 | Bacteria | 4823 |
| 265 | Ga0495676_0150322 | 3300047321 | Bacteria | 1658 |
| 266 | Ga0495680_0002692 | 3300047322 | Bacteria | 17940 |
| 267 | Ga0495680_0004311 | 3300047322 | Bacteria | 13638 |
| 268 | Ga0495680_0008277 | 3300047322 | Bacteria | 9469 |
| 269 | Ga0495680_0135552 | 3300047322 | Bacteria | 1805 |
| 270 | Ga0495675_0001261 | 3300047444 | Bacteria | 15328 |
| 271 | Ga0495684_0002620 | 3300047471 | Bacteria | 14279 |
| 272 | Ga0495684_0019682 | 3300047471 | Bacteria | 5200 |
| 273 | Ga0495602_0002762 | 3300048088 | Bacteria | 17934 |
| 274 | Ga0495602_0003953 | 3300048088 | Bacteria | 15447 |
| 275 | Ga0495602_0017160 | 3300048088 | Bacteria | 7260 |
| 276 | Ga0495602_0040064 | 3300048088 | Bacteria | 4303 |
| 277 | Ga0496100_0051159 | 3300048903 | Bacteria | 2680 |
| 278 | Ga0496100_0060162 | 3300048903 | Bacteria | 2499 |
| 279 | Ga0496100_0224003 | 3300048903 | Bacteria | 1381 |
| 280 | Ga0496101_0006849 | 3300048904 | Bacteria | 7356 |
| 281 | Ga0496101_0074808 | 3300048904 | Bacteria | 2492 |
| 282 | Ga0496102_0015061 | 3300048905 | Bacteria | 6731 |
| 283 | Ga0496102_0115572 | 3300048905 | Bacteria | 2504 |
| 284 | Ga0496104_0010245 | 3300048907 | Bacteria | 8370 |
| 285 | Ga0496104_0021703 | 3300048907 | Bacteria | 5897 |
| 286 | Ga0496104_0058411 | 3300048907 | Bacteria | 3651 |
| 287 | Ga0496104_0140553 | 3300048907 | Bacteria | 2319 |
| 288 | Ga0496105_0019348 | 3300048908 | Bacteria | 5491 |
| 289 | Ga0496105_0025590 | 3300048908 | Bacteria | 4806 |
| 290 | Ga0496105_0032293 | 3300048908 | Bacteria | 4295 |
| 291 | Ga0496105_0082266 | 3300048908 | Bacteria | 2659 |
| 292 | Ga0496105_0102009 | 3300048908 | Bacteria | 2369 |
| 293 | Ga0496105_0172046 | 3300048908 | Bacteria | 1775 |
| 294 | Ga0496106_0082818 | 3300048909 | Bacteria | 2467 |
| 295 | Ga0496107_0057681 | 3300048910 | Bacteria | 2807 |
| 296 | Ga0496108_0006298 | 3300048911 | Bacteria | 9620 |
| 297 | Ga0496108_0094893 | 3300048911 | Bacteria | 2539 |
| 298 | Ga0496109_0016165 | 3300048912 | Bacteria | 6522 |
| 299 | Ga0496110_0010232 | 3300048913 | Bacteria | 7620 |
| 300 | Ga0496110_0057022 | 3300048913 | Bacteria | 3438 |
| 301 | Ga0496110_0296026 | 3300048913 | Bacteria | 1474 |
| 302 | Ga0496111_0044071 | 3300048914 | Bacteria | 3207 |
| 303 | Ga0496111_0130091 | 3300048914 | Bacteria | 1862 |
| 304 | Ga0496112_0046609 | 3300048915 | Bacteria | 4252 |
| 305 | Ga0496112_0214731 | 3300048915 | Bacteria | 1880 |
| 306 | Ga0496113_0057681 | 3300048916 | Bacteria | 2919 |
| 307 | Ga0496113_0074570 | 3300048916 | Bacteria | 2587 |
| 308 | Ga0496113_0215159 | 3300048916 | Bacteria | 1530 |
| 309 | Ga0496114_0042766 | 3300048917 | Bacteria | 3755 |
| 310 | Ga0496114_0116852 | 3300048917 | Bacteria | 2291 |
| 311 | Ga0496115_0007481 | 3300048918 | Bacteria | 8039 |
| 312 | Ga0496115_0048078 | 3300048918 | Bacteria | 3412 |
| 313 | Ga0496126_0021473 | 3300048929 | Bacteria | 6304 |
| 314 | Ga0496126_0026688 | 3300048929 | Bacteria | 5531 |
| 315 | nmdc:mga0rr50_226598_c1 | 3300050513 | Bacteria | 1545 |
| 316 | nmdc:mga0rr50_330850_c1 | 3300050513 | Bacteria | 1279 |
| 317 | Ga0495601_0035003 | 3300053077 | Bacteria | 3133 |
| 318 | Ga0495601_0128844 | 3300053077 | Bacteria | 1647 |
| 319 | Ga0495595_0038267 | 3300053084 | Bacteria | 2184 |
| 320 | Ga0495619_0157110 | 3300053085 | Bacteria | 1570 |
| 321 | 2644609621 | 2643221711 | Bacteria | 4865335 |
| 322 | 2812374855 | 2811994882 | Bacteria | 4688362 |
| 323 | 2819427592 | 2818991318 | Bacteria | 5266538 |
| 324 | 2819666450 | 2818991458 | Bacteria | 4794049 |
| 325 | 2819691616 | 2818991462 | Bacteria | 4320267 |
| 326 | 2819729604 | 2818991469 | Bacteria | 4644110 |
| 327 | 2839988391 | 2839986021 | Bacteria | 3685650 |
| 328 | 2887446457 | 2887443736 | Bacteria | 4426037 |
| 329 | 2932431984 | 2932431166 | Bacteria | 4215299 |
| 330 | Ga0070714_100348960 | |||
| 331 | Ga0070660_100064886 | |||
| 332 | Ga0070709_10000283 | |||
| 333 | Ga0070709_10010613 | |||
| 334 | Ga0070709_10045942 | |||
| 335 | Ga0070714_100000190 | |||
| 336 | Ga0070714_100000403 | |||
| 337 | Ga0070714_100120170 | |||
| 338 | Ga0070714_100208543 | |||
| 339 | Ga0070714_100539409 | |||
| 340 | Ga0070713_100000848 | |||
| 341 | Ga0070713_100058709 | |||
| 342 | Ga0070713_100079830 | |||
| 343 | Ga0070713_100106250 | |||
| 344 | Ga0070713_100388596 | |||
| 345 | Ga0070710_10000160 | |||
| 346 | Ga0070710_10056636 | |||
| 347 | Ga0070711_100000349 | |||
| 348 | Ga0070711_100215210 | |||
| 349 | Ga0070711_100292016 | |||
| 350 | Ga0070705_100024227 | |||
| 351 | Ga0070708_100040258 | |||
| 352 | Ga0070708_100173116 | |||
| 353 | Ga0070708_100234489 | |||
| 354 | Ga0070663_100270632 | |||
| 355 | Ga0070681_10049324 | |||
| 356 | Ga0070706_100008821 | |||
| 357 | Ga0070706_100047459 | |||
| 358 | Ga0070706_100053186 | |||
| 359 | Ga0070706_100133490 | |||
| 360 | Ga0070706_100151355 | |||
| 361 | Ga0070706_100334404 | |||
| 362 | Ga0070707_100001347 | |||
| 363 | Ga0070707_100009928 | |||
| 364 | Ga0070707_100015657 | |||
| 365 | Ga0070707_100054998 | |||
| 366 | Ga0070707_100141771 | |||
| 367 | Ga0070707_100383429 | |||
| 368 | Ga0070698_100001666 | |||
| 369 | Ga0070698_100004413 | |||
| 370 | Ga0070698_100006398 | |||
| 371 | Ga0070698_100025502 | |||
| 372 | Ga0070698_100235103 | |||
| 373 | Ga0070698_100324353 | |||
| 374 | Ga0070698_100349689 | |||
| 375 | Ga0070699_100012274 | |||
| 376 | Ga0070679_100272698 | |||
| 377 | Ga0070697_100096704 | |||
| 378 | Ga0070695_100046689 | |||
| 379 | Ga0068855_100032385 | |||
| 380 | Ga0068857_100116072 | |||
| 381 | Ga0068856_100064115 | |||
| 382 | Ga0068856_100191925 | |||
| 383 | Ga0068856_100328716 | |||
| 384 | Ga0068864_100086274 | |||
| 385 | Ga0068858_100021000 | |||
| 386 | Ga0068860_100132647 | |||
| 387 | Ga0070717_10001151 | |||
| 388 | Ga0070717_10016182 | |||
| 389 | Ga0070717_10053813 | |||
| 390 | Ga0070717_10067333 | |||
| 391 | Ga0070717_10101141 | |||
| 392 | Ga0070715_10054249 | |||
| 393 | Ga0070716_100000732 | |||
| 394 | Ga0070712_100002043 | |||
| 395 | Ga0070712_100022493 | |||
| 396 | Ga0070712_100196248 | |||
| 397 | Ga0070712_100232620 | |||
| 398 | Ga0097621_100055957 | |||
| 399 | Ga0075434_100137363 | |||
| 400 | Ga0075435_100133534 | |||
| 401 | Ga0105245_10012611 | |||
| 402 | Ga0105242_10405186 | |||
| 403 | Ga0105237_10109466 | |||
| 404 | Ga0105238_10118632 | |||
| 405 | Ga0105249_10292845 | |||
| 406 | Ga0157370_10031020 | |||
| 407 | Ga0157370_10090813 | |||
| 408 | Ga0157369_10297191 | |||
| 409 | Ga0157374_10090760 | |||
| 410 | Ga0163162_10031339 | |||
| 411 | Ga0157379_10044517 | |||
| 412 | Ga0157376_10131116 | |||
| 413 | Ga0157376_10388562 | |||
| 414 | Ga0154015_1162151 | |||
| 415 | Ga0213875_10000176 | |||
| 416 | Ga0213875_10000419 | |||
| 417 | Ga0207692_10000102 | |||
| 418 | Ga0207692_10015285 | |||
| 419 | Ga0207685_10005223 | |||
| 420 | Ga0207685_10019755 | |||
| 421 | Ga0207699_10000332 | |||
| 422 | Ga0207699_10006274 | |||
| 423 | Ga0207699_10025475 | |||
| 424 | Ga0207684_10081170 | |||
| 425 | Ga0207684_10208364 | |||
| 426 | Ga0207707_10013467 | |||
| 427 | Ga0207707_10064164 | |||
| 428 | Ga0207671_10065321 | |||
| 429 | Ga0207693_10005592 | |||
| 430 | Ga0207693_10022597 | |||
| 431 | Ga0207693_10044924 | |||
| 432 | Ga0207693_10044951 | |||
| 433 | Ga0207693_10220304 | |||
| 434 | Ga0207663_10000446 | |||
| 435 | Ga0207663_10005910 | |||
| 436 | Ga0207663_10028598 | |||
| 437 | Ga0207652_10207518 | |||
| 438 | Ga0207646_10003961 | |||
| 439 | Ga0207646_10024171 | |||
| 440 | Ga0207646_10102890 | |||
| 441 | Ga0207646_10130238 | |||
| 442 | Ga0207646_10195963 | |||
| 443 | Ga0207646_10238866 | |||
| 444 | Ga0207646_10334427 | |||
| 445 | Ga0207687_10045597 | |||
| 446 | Ga0207700_10000139 | |||
| 447 | Ga0207700_10003646 | |||
| 448 | Ga0207700_10008409 | |||
| 449 | Ga0207700_10013924 | |||
| 450 | Ga0207700_10025108 | |||
| 451 | Ga0207700_10086677 | |||
| 452 | Ga0207700_10127524 | |||
| 453 | Ga0207700_10474818 | |||
| 454 | Ga0207664_10000108 | |||
| 455 | Ga0207664_10000209 | |||
| 456 | Ga0207664_10003668 | |||
| 457 | Ga0207664_10035533 | |||
| 458 | Ga0207664_10111940 | |||
| 459 | Ga0207664_10264250 | |||
| 460 | Ga0207665_10000753 | |||
| 461 | Ga0207665_10013553 | |||
| 462 | Ga0207665_10232937 | |||
| 463 | Ga0207661_10113007 | |||
| 464 | Ga0207703_10008002 | |||
| 465 | Ga0207678_10022511 | |||
| 466 | Ga0207702_10165211 | |||
| 467 | Ga0207674_10031076 | |||
| 468 | Ga0207674_10031563 | |||
| 469 | Ga0268264_10094994 | |||
| 470 | Ga0265337_1000743 | |||
| 471 | Ga0265326_10024390 | |||
| 472 | Ga0265334_10000299 | |||
| 473 | Ga0265323_10002444 | |||
| 474 | Ga0265336_10004015 | |||
| 475 | Ga0265338_10002286 | |||
| 476 | Ga0265338_10002589 | |||
| 477 | Ga0265338_10006407 | |||
| 478 | Ga0265324_10002757 | |||
| 479 | Ga0265332_10023962 | |||
| 480 | Ga0265320_10010077 | |||
| 481 | Ga0265325_10009760 | |||
| 482 | Ga0265340_10010078 | |||
| 483 | Ga0265339_10090602 | |||
| 484 | Ga0265316_10046226 | |||
| 485 | Ga0265313_10007666 | |||
| 486 | Ga0265314_10008636 | |||
| 487 | Ga0307409_100091295 | |||
| 488 | Ga0316214_1007220 | |||
| 489 | Ga0373934_0000739 | |||
| 490 | Ga0373949_0007286 | |||
| 491 | Ga0373951_0016336 | |||
| 492 | Ga0373923_0041591 | |||
| 493 | Ga0373945_0062384 | |||
| 494 | Ga0373953_0000215 | |||
| 495 | Ga0373954_0008476 | |||
| 496 | Ga0373956_0001535 | |||
| 497 | Ga0373956_0082104 | |||
| 498 | Ga0373957_0000144 | |||
| 499 | Ga0373946_0065405 | |||
| 500 | Ga0373955_0000420 | |||
| 501 | Ga0373955_0009781 | |||
| 502 | Ga0373955_0050659 | |||
| 503 | Ga0373961_0038291 | |||
| 504 | Ga0373924_0018335 | |||
| 505 | Ga0373931_0010121 | |||
| 506 | Ga0373931_0036921 | |||
| 507 | Ga0373931_0151583 | |||
| 508 | Ga0373935_0112500 | |||
| 509 | Ga0373933_0000169 | |||
| 510 | Ga0373933_0030394 | |||
| 511 | Ga0373947_0056916 | |||
| 512 | Ga0373937_0001816 | |||
| 513 | Ga0373937_0098198 | |||
| 514 | Ga0373937_0170133 | |||
| 515 | Ga0373937_0438616 | |||
| 516 | Ga0373925_0000030 | |||
| 517 | Ga0373925_0014478 | |||
| 518 | Ga0373925_0024705 | |||
| 519 | Ga0395900_0353965 | |||
| 520 | Ga0395898_0038401 | |||
| 521 | Ga0395898_0065122 | |||
| 522 | Ga0436364_0014047 | |||
| 523 | Ga0436364_0303129 | |||
| 524 | Ga0436364_1281565 | |||
| 525 | Ga0395901_0022567 | |||
| 526 | Ga0466963_0006273 | |||
| 527 | Ga0495592_0001208 | |||
| 528 | Ga0495592_0034957 | |||
| 529 | Ga0495651_0001519 | |||
| 530 | Ga0495651_0022257 | |||
| 531 | Ga0495653_0008395 | |||
| 532 | Ga0495653_0015735 | |||
| 533 | Ga0495653_0031280 | |||
| 534 | Ga0495653_0059302 | |||
| 535 | Ga0495662_0054965 | |||
| 536 | Ga0495662_0056022 | |||
| 537 | Ga0495664_0027282 | |||
| 538 | Ga0495664_0040826 | |||
| 539 | Ga0495664_0142659 | |||
| 540 | Ga0495608_0001287 | |||
| 541 | Ga0495608_0003912 | |||
| 542 | Ga0495608_0013142 | |||
| 543 | Ga0495608_0027452 | |||
| 544 | Ga0495618_0020845 | |||
| 545 | Ga0495618_0032496 | |||
| 546 | Ga0495628_0020744 | |||
| 547 | Ga0495628_0039665 | |||
| 548 | Ga0495628_0096069 | |||
| 549 | Ga0495630_0039116 | |||
| 550 | Ga0495652_0009477 | |||
| 551 | Ga0495652_0019130 | |||
| 552 | Ga0495652_0019523 | |||
| 553 | Ga0495652_0022081 | |||
| 554 | Ga0495652_0043267 | |||
| 555 | Ga0495640_0018588 | |||
| 556 | Ga0495640_0020041 | |||
| 557 | Ga0495586_0047915 | |||
| 558 | Ga0495587_0000934 | |||
| 559 | Ga0495587_0005674 | |||
| 560 | Ga0495645_0039140 | |||
| 561 | Ga0495645_0117780 | |||
| 562 | Ga0495667_0001051 | |||
| 563 | Ga0495667_0013681 | |||
| 564 | Ga0495667_0044600 | |||
| 565 | Ga0495634_0060342 | |||
| 566 | Ga0495634_0112104 | |||
| 567 | Ga0495635_0076682 | |||
| 568 | Ga0495657_0001875 | |||
| 569 | Ga0495657_0018682 | |||
| 570 | Ga0495657_0080283 | |||
| 571 | Ga0495657_0093421 | |||
| 572 | Ga0495599_0000780 | |||
| 573 | Ga0495599_0007148 | |||
| 574 | Ga0495599_0012278 | |||
| 575 | Ga0495623_0001166 | |||
| 576 | Ga0495646_0009435 | |||
| 577 | Ga0495646_0015047 | |||
| 578 | Ga0495646_0017416 | |||
| 579 | Ga0495647_0104147 | |||
| 580 | Ga0495613_0188598 | |||
| 581 | Ga0495624_0067319 | |||
| 582 | Ga0495600_0004783 | |||
| 583 | Ga0495600_0007875 | |||
| 584 | Ga0495600_0018626 | |||
| 585 | Ga0495604_0001722 | |||
| 586 | Ga0495604_0008350 | |||
| 587 | Ga0495604_0023936 | |||
| 588 | Ga0495604_0035144 | |||
| 589 | Ga0495674_0005465 | |||
| 590 | Ga0495674_0011055 | |||
| 591 | Ga0495674_0018780 | |||
| 592 | Ga0495674_0071948 | |||
| 593 | Ga0495676_0027993 | |||
| 594 | Ga0495676_0150322 | |||
| 595 | Ga0495680_0002692 | |||
| 596 | Ga0495680_0004311 | |||
| 597 | Ga0495680_0008277 | |||
| 598 | Ga0495680_0135552 | |||
| 599 | Ga0495675_0001261 | |||
| 600 | Ga0495684_0002620 | |||
| 601 | Ga0495684_0019682 | |||
| 602 | Ga0495602_0002762 | |||
| 603 | Ga0495602_0003953 | |||
| 604 | Ga0495602_0017160 | |||
| 605 | Ga0495602_0040064 | |||
| 606 | Ga0496100_0051159 | |||
| 607 | Ga0496100_0060162 | |||
| 608 | Ga0496100_0224003 | |||
| 609 | Ga0496101_0006849 | |||
| 610 | Ga0496101_0074808 | |||
| 611 | Ga0496102_0015061 | |||
| 612 | Ga0496102_0115572 | |||
| 613 | Ga0496104_0010245 | |||
| 614 | Ga0496104_0021703 | |||
| 615 | Ga0496104_0058411 | |||
| 616 | Ga0496104_0140553 | |||
| 617 | Ga0496105_0019348 | |||
| 618 | Ga0496105_0025590 | |||
| 619 | Ga0496105_0032293 | |||
| 620 | Ga0496105_0082266 | |||
| 621 | Ga0496105_0102009 | |||
| 622 | Ga0496105_0172046 | |||
| 623 | Ga0496106_0082818 | |||
| 624 | Ga0496107_0057681 | |||
| 625 | Ga0496108_0006298 | |||
| 626 | Ga0496108_0094893 | |||
| 627 | Ga0496109_0016165 | |||
| 628 | Ga0496110_0010232 | |||
| 629 | Ga0496110_0057022 | |||
| 630 | Ga0496110_0296026 | |||
| 631 | Ga0496111_0044071 | |||
| 632 | Ga0496111_0130091 | |||
| 633 | Ga0496112_0046609 | |||
| 634 | Ga0496112_0214731 | |||
| 635 | Ga0496113_0057681 | |||
| 636 | Ga0496113_0074570 | |||
| 637 | Ga0496113_0215159 | |||
| 638 | Ga0496114_0042766 | |||
| 639 | Ga0496114_0116852 | |||
| 640 | Ga0496115_0007481 | |||
| 641 | Ga0496115_0048078 | |||
| 642 | Ga0496126_0021473 | |||
| 643 | Ga0496126_0026688 | |||
| 644 | nmdc:mga0rr50_226598_c1 | |||
| 645 | nmdc:mga0rr50_330850_c1 | |||
| 646 | Ga0495601_0035003 | |||
| 647 | Ga0495601_0128844 | |||
| 648 | Ga0495595_0038267 | |||
| 649 | Ga0495619_0157110 | |||
| 650 | 2644609621 | |||
| 651 | 2812374855 | |||
| 652 | 2819427592 | |||
| 653 | 2819666450 | |||
| 654 | 2819691616 | |||
| 655 | 2819729604 | |||
| 656 | 2839988391 | |||
| 657 | 2887446457 | |||
| 658 | 2932431984 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5f34-assembly1.cif.gz_A | crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group | 0.9263 | 105 | 343 |
| 5f34-assembly1.cif.gz_A | crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group | 0.8466 | 105 | 343 |
| 5kn7-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii | 0.7173 | 24 | 350 |
| 5knk-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) | 0.6971 | 1 | 350 |
| 5kn7-assembly1.cif.gz_B-2 | lipid a secondary acyltransferase lpxm from acinetobacter baumannii | 0.6607 | 24 | 350 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5JK26_123_351_3.40.1130.10 | Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase | 0.6652 | 131 | 320 | 3.40.1130.10 |
| af_P31119_15_138_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.6533 | 147 | 274 | 3.40.1010.10 |
| af_Q2FXJ7_19_144_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6508 | 156 | 278 | 3.40.50.2000 |
| af_O07809_23_150_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6405 | 150 | 274 | 3.40.50.2000 |
| af_Q54I12_580_724_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.6351 | 137 | 274 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3H7H8-F1-model_v4 | Phosphatidylinositol mannoside acyltransferase | 0.9606 | 13 | 337 |
GO:0005886
GO:0009247 GO:0016746 |
| AF-A0A6I3H7H8-F1-model_v4 | Phosphatidylinositol mannoside acyltransferase | 0.9509 | 13 | 337 |
GO:0005886
GO:0009247 GO:0016746 |
| AF-A0A7W9MTI9-F1-model_v4 | KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) | 0.9448 | 31 | 333 |
GO:0005886
GO:0008913 GO:0009247 |
| AF-A0A7V9IV65-F1-model_v4 | Phosphatidylinositol mannoside acyltransferase | 0.9433 | 7 | 341 |
GO:0005886
GO:0009247 GO:0016746 |
| AF-A0A1X4H3D2-F1-model_v4 | deleted | 0.943 | 4 | 339 |
|