F409554

General Info

Members Datasets Scaffolds Average Seq Length
329 165 658 322

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100348960|Ga0070714_1003489602
Length 373
Sequence MATLRERLVTVAFRAGWSLVCRLPESWARSLFEFGADLAWRRQGPGVQVLEGNLVRVLRTRAGDSLTPSEFGAELRALSRAVMRSYARYYLEAFRLQVIPDERILSGMHVNMEQLELTLEYMRGGRGVIYALPHMGDFEQAGRWVILAGAGSIVAPAERLKPESVFQMFLAFRQGLGMEIVPTSGGPHPFGVMAQRLRAGKLVTIVADRDLSDTGVEVDFFGEKALFPAGPAALAVQTGAALMPVACWFVGEDEWGARIYDEIPVPADGDRKQKVAAMTQAMVRVFEQGISEHPEHWHMLQKVFVNDLDPERLARTRARAMNGNGRAAADVAGPGVTPDDRGTPGTMAEPSSAQRGVRGVVPPGDDGGAPTCA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
83 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 2643221711 Terrabacter sp. Root85 Isolate Unclassified
158 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
159 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
160 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
161 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
162 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
163 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
164 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
165 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.96
Metatranscriptomes 0.3
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.94
Rhizosphere 85.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100348960 3300005435 Bacteria 1389
2 Ga0070660_100064886 3300005339 Bacteria 2842
3 Ga0070709_10000283 3300005434 Bacteria 32257
4 Ga0070709_10010613 3300005434 Bacteria 5106
5 Ga0070709_10045942 3300005434 Bacteria 2713
6 Ga0070714_100000190 3300005435 Bacteria 49579
7 Ga0070714_100000403 3300005435 Bacteria 31860
8 Ga0070714_100120170 3300005435 Bacteria 2336
9 Ga0070714_100208543 3300005435 Bacteria 1790
10 Ga0070714_100539409 3300005435 Bacteria 1116
11 Ga0070713_100000848 3300005436 Bacteria 19595
12 Ga0070713_100058709 3300005436 Bacteria 3210
13 Ga0070713_100079830 3300005436 Bacteria 2788
14 Ga0070713_100106250 3300005436 Bacteria 2440
15 Ga0070713_100388596 3300005436 Bacteria 1301
16 Ga0070710_10000160 3300005437 Bacteria 31176
17 Ga0070710_10056636 3300005437 Bacteria 2218
18 Ga0070711_100000349 3300005439 Bacteria 23811
19 Ga0070711_100215210 3300005439 Bacteria 1490
20 Ga0070711_100292016 3300005439 Bacteria 1293
21 Ga0070705_100024227 3300005440 Bacteria 3273
22 Ga0070708_100040258 3300005445 Bacteria 4092
23 Ga0070708_100173116 3300005445 Bacteria 2016
24 Ga0070708_100234489 3300005445 Bacteria 1722
25 Ga0070663_100270632 3300005455 Bacteria 1350
26 Ga0070681_10049324 3300005458 Bacteria 4205
27 Ga0070706_100008821 3300005467 Bacteria 9395
28 Ga0070706_100047459 3300005467 Bacteria 3962
29 Ga0070706_100053186 3300005467 Bacteria 3737
30 Ga0070706_100133490 3300005467 Bacteria 2317
31 Ga0070706_100151355 3300005467 Bacteria 2166
32 Ga0070706_100334404 3300005467 Bacteria 1412
33 Ga0070707_100001347 3300005468 Bacteria 24122
34 Ga0070707_100009928 3300005468 Bacteria 8860
35 Ga0070707_100015657 3300005468 Bacteria 7118
36 Ga0070707_100054998 3300005468 Bacteria 3816
37 Ga0070707_100141771 3300005468 Bacteria 2339
38 Ga0070707_100383429 3300005468 Bacteria 1365
39 Ga0070698_100001666 3300005471 Bacteria 24785
40 Ga0070698_100004413 3300005471 Bacteria 15458
41 Ga0070698_100006398 3300005471 Bacteria 12784
42 Ga0070698_100025502 3300005471 Bacteria 6162
43 Ga0070698_100235103 3300005471 Bacteria 1765
44 Ga0070698_100324353 3300005471 Bacteria 1471
45 Ga0070698_100349689 3300005471 Bacteria 1410
46 Ga0070699_100012274 3300005518 Bacteria 7390
47 Ga0070679_100272698 3300005530 Bacteria 1645
48 Ga0070697_100096704 3300005536 Bacteria 2450
49 Ga0070695_100046689 3300005545 Bacteria 2764
50 Ga0068855_100032385 3300005563 Bacteria 6243
51 Ga0068857_100116072 3300005577 Bacteria 2408
52 Ga0068856_100064115 3300005614 Bacteria 3630
53 Ga0068856_100191925 3300005614 Bacteria 2056
54 Ga0068856_100328716 3300005614 Bacteria 1546
55 Ga0068864_100086274 3300005618 Bacteria 2761
56 Ga0068858_100021000 3300005842 Bacteria 6101
57 Ga0068860_100132647 3300005843 Bacteria 2391
58 Ga0070717_10001151 3300006028 Bacteria 17860
59 Ga0070717_10016182 3300006028 Bacteria 5779
60 Ga0070717_10053813 3300006028 Bacteria 3318
61 Ga0070717_10067333 3300006028 Bacteria 2979
62 Ga0070717_10101141 3300006028 Bacteria 2448
63 Ga0070715_10054249 3300006163 Bacteria 1735
64 Ga0070716_100000732 3300006173 Bacteria 14013
65 Ga0070712_100002043 3300006175 Bacteria 12364
66 Ga0070712_100022493 3300006175 Bacteria 4154
67 Ga0070712_100196248 3300006175 Bacteria 1583
68 Ga0070712_100232620 3300006175 Bacteria 1464
69 Ga0097621_100055957 3300006237 Bacteria 3222
70 Ga0075434_100137363 3300006871 Bacteria 2464
71 Ga0075435_100133534 3300007076 Bacteria 2078
72 Ga0105245_10012611 3300009098 Bacteria 7359
73 Ga0105242_10405186 3300009176 Bacteria 1274
74 Ga0105237_10109466 3300009545 Bacteria 2755
75 Ga0105238_10118632 3300009551 Bacteria 2626
76 Ga0105249_10292845 3300009553 Bacteria 1630
77 Ga0157370_10031020 3300013104 Bacteria 5233
78 Ga0157370_10090813 3300013104 Bacteria 2868
79 Ga0157369_10297191 3300013105 Bacteria 1680
80 Ga0157374_10090760 3300013296 Bacteria 2913
81 Ga0163162_10031339 3300013306 Bacteria 5274
82 Ga0157379_10044517 3300014968 Bacteria 3962
83 Ga0157376_10131116 3300014969 Bacteria 2237
84 Ga0157376_10388562 3300014969 Bacteria 1346
85 Ga0154015_1162151 3300020610 Bacteria 2024
86 Ga0213875_10000176 3300021388 Bacteria 67409
87 Ga0213875_10000419 3300021388 Bacteria 37296
88 Ga0207692_10000102 3300025898 Bacteria 25160
89 Ga0207692_10015285 3300025898 Bacteria 3374
90 Ga0207685_10005223 3300025905 Bacteria 3404
91 Ga0207685_10019755 3300025905 Bacteria 2225
92 Ga0207699_10000332 3300025906 Bacteria 25007
93 Ga0207699_10006274 3300025906 Bacteria 5744
94 Ga0207699_10025475 3300025906 Bacteria 3247
95 Ga0207684_10081170 3300025910 Bacteria 2759
96 Ga0207684_10208364 3300025910 Bacteria 1686
97 Ga0207707_10013467 3300025912 Bacteria 7127
98 Ga0207707_10064164 3300025912 Bacteria 3197
99 Ga0207671_10065321 3300025914 Bacteria 2706
100 Ga0207693_10005592 3300025915 Bacteria 10447
101 Ga0207693_10022597 3300025915 Bacteria 4997
102 Ga0207693_10044924 3300025915 Bacteria 3471
103 Ga0207693_10044951 3300025915 Bacteria 3470
104 Ga0207693_10220304 3300025915 Bacteria 1491
105 Ga0207663_10000446 3300025916 Bacteria 17922
106 Ga0207663_10005910 3300025916 Bacteria 6211
107 Ga0207663_10028598 3300025916 Bacteria 3264
108 Ga0207652_10207518 3300025921 Bacteria 1764
109 Ga0207646_10003961 3300025922 Bacteria 16427
110 Ga0207646_10024171 3300025922 Bacteria 5570
111 Ga0207646_10102890 3300025922 Bacteria 2561
112 Ga0207646_10130238 3300025922 Bacteria 2264
113 Ga0207646_10195963 3300025922 Bacteria 1824
114 Ga0207646_10238866 3300025922 Bacteria 1641
115 Ga0207646_10334427 3300025922 Bacteria 1368
116 Ga0207687_10045597 3300025927 Bacteria 3031
117 Ga0207700_10000139 3300025928 Bacteria 43579
118 Ga0207700_10003646 3300025928 Bacteria 8982
119 Ga0207700_10008409 3300025928 Bacteria 6393
120 Ga0207700_10013924 3300025928 Bacteria 5255
121 Ga0207700_10025108 3300025928 Bacteria 4133
122 Ga0207700_10086677 3300025928 Bacteria 2461
123 Ga0207700_10127524 3300025928 Bacteria 2072
124 Ga0207700_10474818 3300025928 Bacteria 1104
125 Ga0207664_10000108 3300025929 Bacteria 72754
126 Ga0207664_10000209 3300025929 Bacteria 44400
127 Ga0207664_10003668 3300025929 Bacteria 10287
128 Ga0207664_10035533 3300025929 Bacteria 3845
129 Ga0207664_10111940 3300025929 Bacteria 2272
130 Ga0207664_10264250 3300025929 Bacteria 1506
131 Ga0207665_10000753 3300025939 Bacteria 21805
132 Ga0207665_10013553 3300025939 Bacteria 5362
133 Ga0207665_10232937 3300025939 Bacteria 1354
134 Ga0207661_10113007 3300025944 Bacteria 2300
135 Ga0207703_10008002 3300026035 Bacteria 8354
136 Ga0207678_10022511 3300026067 Bacteria 5518
137 Ga0207702_10165211 3300026078 Bacteria 2024
138 Ga0207674_10031076 3300026116 Bacteria 5611
139 Ga0207674_10031563 3300026116 Bacteria 5563
140 Ga0268264_10094994 3300028381 Bacteria 2579
141 Ga0265337_1000743 3300028556 Bacteria 17209
142 Ga0265326_10024390 3300028558 Bacteria 1726
143 Ga0265334_10000299 3300028573 Bacteria 27741
144 Ga0265323_10002444 3300028653 Bacteria 8506
145 Ga0265336_10004015 3300028666 Bacteria 5621
146 Ga0265338_10002286 3300028800 Bacteria 29188
147 Ga0265338_10002589 3300028800 Bacteria 26744
148 Ga0265338_10006407 3300028800 Bacteria 15001
149 Ga0265324_10002757 3300029957 Bacteria 8722
150 Ga0265332_10023962 3300031238 Bacteria 2689
151 Ga0265320_10010077 3300031240 Bacteria 5651
152 Ga0265325_10009760 3300031241 Bacteria 5593
153 Ga0265340_10010078 3300031247 Bacteria 5060
154 Ga0265339_10090602 3300031249 Bacteria 1603
155 Ga0265316_10046226 3300031344 Bacteria 3451
156 Ga0265313_10007666 3300031595 Bacteria 7314
157 Ga0265314_10008636 3300031711 Bacteria 8715
158 Ga0307409_100091295 3300031995 Bacteria 2496
159 Ga0316214_1007220 3300033545 Bacteria 1479
160 Ga0373934_0000739 3300035086 Bacteria 11679
161 Ga0373949_0007286 3300035090 Bacteria 2422
162 Ga0373951_0016336 3300035091 Bacteria 1674
163 Ga0373923_0041591 3300035111 Bacteria 1895
164 Ga0373945_0062384 3300035116 Bacteria 1393
165 Ga0373953_0000215 3300035117 Bacteria 15784
166 Ga0373954_0008476 3300035118 Bacteria 4515
167 Ga0373956_0001535 3300035119 Bacteria 9527
168 Ga0373956_0082104 3300035119 Bacteria 1480
169 Ga0373957_0000144 3300035120 Bacteria 17836
170 Ga0373946_0065405 3300035171 Bacteria 1557
171 Ga0373955_0000420 3300035172 Bacteria 17929
172 Ga0373955_0009781 3300035172 Bacteria 4506
173 Ga0373955_0050659 3300035172 Bacteria 2259
174 Ga0373961_0038291 3300035241 Bacteria 1373
175 Ga0373924_0018335 3300035410 Bacteria 2695
176 Ga0373931_0010121 3300035691 Bacteria 4524
177 Ga0373931_0036921 3300035691 Bacteria 2549
178 Ga0373931_0151583 3300035691 Bacteria 1352
179 Ga0373935_0112500 3300035692 Bacteria 1808
180 Ga0373933_0000169 3300035724 Bacteria 42826
181 Ga0373933_0030394 3300035724 Bacteria 3127
182 Ga0373947_0056916 3300035725 Bacteria 2364
183 Ga0373937_0001816 3300036401 Bacteria 17916
184 Ga0373937_0098198 3300036401 Bacteria 2716
185 Ga0373937_0170133 3300036401 Bacteria 2044
186 Ga0373937_0438616 3300036401 Bacteria 1240
187 Ga0373925_0000030 3300037068 Bacteria 146196
188 Ga0373925_0014478 3300037068 Bacteria 5700
189 Ga0373925_0024705 3300037068 Bacteria 4388
190 Ga0395900_0353965 3300037418 Bacteria 1441
191 Ga0395898_0038401 3300037466 Bacteria 4746
192 Ga0395898_0065122 3300037466 Bacteria 3534
193 Ga0436364_0014047 3300037853 Bacteria 2642
194 Ga0436364_0303129 3300037853 Bacteria 102080
195 Ga0436364_1281565 3300037853 Bacteria 7992
196 Ga0395901_0022567 3300038443 Bacteria 6451
197 Ga0466963_0006273 3300044694 Bacteria 7029
198 Ga0495592_0001208 3300046454 Bacteria 17934
199 Ga0495592_0034957 3300046454 Bacteria 3787
200 Ga0495651_0001519 3300046462 Bacteria 17944
201 Ga0495651_0022257 3300046462 Bacteria 4927
202 Ga0495653_0008395 3300046463 Bacteria 8467
203 Ga0495653_0015735 3300046463 Bacteria 6168
204 Ga0495653_0031280 3300046463 Bacteria 4230
205 Ga0495653_0059302 3300046463 Bacteria 2905
206 Ga0495662_0054965 3300046476 Bacteria 1923
207 Ga0495662_0056022 3300046476 Bacteria 1904
208 Ga0495664_0027282 3300046477 Bacteria 3328
209 Ga0495664_0040826 3300046477 Bacteria 2744
210 Ga0495664_0142659 3300046477 Bacteria 1452
211 Ga0495608_0001287 3300046511 Bacteria 17813
212 Ga0495608_0003912 3300046511 Bacteria 10708
213 Ga0495608_0013142 3300046511 Bacteria 5746
214 Ga0495608_0027452 3300046511 Bacteria 3872
215 Ga0495618_0020845 3300046514 Bacteria 4034
216 Ga0495618_0032496 3300046514 Bacteria 3268
217 Ga0495628_0020744 3300046516 Bacteria 5415
218 Ga0495628_0039665 3300046516 Bacteria 3765
219 Ga0495628_0096069 3300046516 Bacteria 2289
220 Ga0495630_0039116 3300046517 Bacteria 3547
221 Ga0495652_0009477 3300046529 Bacteria 8846
222 Ga0495652_0019130 3300046529 Bacteria 6100
223 Ga0495652_0019523 3300046529 Bacteria 6033
224 Ga0495652_0022081 3300046529 Bacteria 5651
225 Ga0495652_0043267 3300046529 Bacteria 3880
226 Ga0495640_0018588 3300046533 Bacteria 5148
227 Ga0495640_0020041 3300046533 Bacteria 4930
228 Ga0495586_0047915 3300046535 Bacteria 2308
229 Ga0495587_0000934 3300046536 Bacteria 19235
230 Ga0495587_0005674 3300046536 Bacteria 8136
231 Ga0495645_0039140 3300046543 Bacteria 3458
232 Ga0495645_0117780 3300046543 Bacteria 1873
233 Ga0495667_0001051 3300046559 Bacteria 17934
234 Ga0495667_0013681 3300046559 Bacteria 5483
235 Ga0495667_0044600 3300046559 Bacteria 2936
236 Ga0495634_0060342 3300046642 Bacteria 2523
237 Ga0495634_0112104 3300046642 Bacteria 1753
238 Ga0495635_0076682 3300046663 Bacteria 2290
239 Ga0495657_0001875 3300046675 Bacteria 17880
240 Ga0495657_0018682 3300046675 Bacteria 5009
241 Ga0495657_0080283 3300046675 Bacteria 2111
242 Ga0495657_0093421 3300046675 Bacteria 1925
243 Ga0495599_0000780 3300046678 Bacteria 17939
244 Ga0495599_0007148 3300046678 Bacteria 6760
245 Ga0495599_0012278 3300046678 Bacteria 5277
246 Ga0495623_0001166 3300046679 Bacteria 17826
247 Ga0495646_0009435 3300046680 Bacteria 6191
248 Ga0495646_0015047 3300046680 Bacteria 4914
249 Ga0495646_0017416 3300046680 Bacteria 4558
250 Ga0495647_0104147 3300046681 Bacteria 1178
251 Ga0495613_0188598 3300046689 Bacteria 1458
252 Ga0495624_0067319 3300046690 Bacteria 2234
253 Ga0495600_0004783 3300046809 Bacteria 8125
254 Ga0495600_0007875 3300046809 Bacteria 6525
255 Ga0495600_0018626 3300046809 Bacteria 4425
256 Ga0495604_0001722 3300047317 Bacteria 17944
257 Ga0495604_0008350 3300047317 Bacteria 8189
258 Ga0495604_0023936 3300047317 Bacteria 4875
259 Ga0495604_0035144 3300047317 Bacteria 3959
260 Ga0495674_0005465 3300047319 Bacteria 12207
261 Ga0495674_0011055 3300047319 Bacteria 8523
262 Ga0495674_0018780 3300047319 Bacteria 6433
263 Ga0495674_0071948 3300047319 Bacteria 2983
264 Ga0495676_0027993 3300047321 Bacteria 4823
265 Ga0495676_0150322 3300047321 Bacteria 1658
266 Ga0495680_0002692 3300047322 Bacteria 17940
267 Ga0495680_0004311 3300047322 Bacteria 13638
268 Ga0495680_0008277 3300047322 Bacteria 9469
269 Ga0495680_0135552 3300047322 Bacteria 1805
270 Ga0495675_0001261 3300047444 Bacteria 15328
271 Ga0495684_0002620 3300047471 Bacteria 14279
272 Ga0495684_0019682 3300047471 Bacteria 5200
273 Ga0495602_0002762 3300048088 Bacteria 17934
274 Ga0495602_0003953 3300048088 Bacteria 15447
275 Ga0495602_0017160 3300048088 Bacteria 7260
276 Ga0495602_0040064 3300048088 Bacteria 4303
277 Ga0496100_0051159 3300048903 Bacteria 2680
278 Ga0496100_0060162 3300048903 Bacteria 2499
279 Ga0496100_0224003 3300048903 Bacteria 1381
280 Ga0496101_0006849 3300048904 Bacteria 7356
281 Ga0496101_0074808 3300048904 Bacteria 2492
282 Ga0496102_0015061 3300048905 Bacteria 6731
283 Ga0496102_0115572 3300048905 Bacteria 2504
284 Ga0496104_0010245 3300048907 Bacteria 8370
285 Ga0496104_0021703 3300048907 Bacteria 5897
286 Ga0496104_0058411 3300048907 Bacteria 3651
287 Ga0496104_0140553 3300048907 Bacteria 2319
288 Ga0496105_0019348 3300048908 Bacteria 5491
289 Ga0496105_0025590 3300048908 Bacteria 4806
290 Ga0496105_0032293 3300048908 Bacteria 4295
291 Ga0496105_0082266 3300048908 Bacteria 2659
292 Ga0496105_0102009 3300048908 Bacteria 2369
293 Ga0496105_0172046 3300048908 Bacteria 1775
294 Ga0496106_0082818 3300048909 Bacteria 2467
295 Ga0496107_0057681 3300048910 Bacteria 2807
296 Ga0496108_0006298 3300048911 Bacteria 9620
297 Ga0496108_0094893 3300048911 Bacteria 2539
298 Ga0496109_0016165 3300048912 Bacteria 6522
299 Ga0496110_0010232 3300048913 Bacteria 7620
300 Ga0496110_0057022 3300048913 Bacteria 3438
301 Ga0496110_0296026 3300048913 Bacteria 1474
302 Ga0496111_0044071 3300048914 Bacteria 3207
303 Ga0496111_0130091 3300048914 Bacteria 1862
304 Ga0496112_0046609 3300048915 Bacteria 4252
305 Ga0496112_0214731 3300048915 Bacteria 1880
306 Ga0496113_0057681 3300048916 Bacteria 2919
307 Ga0496113_0074570 3300048916 Bacteria 2587
308 Ga0496113_0215159 3300048916 Bacteria 1530
309 Ga0496114_0042766 3300048917 Bacteria 3755
310 Ga0496114_0116852 3300048917 Bacteria 2291
311 Ga0496115_0007481 3300048918 Bacteria 8039
312 Ga0496115_0048078 3300048918 Bacteria 3412
313 Ga0496126_0021473 3300048929 Bacteria 6304
314 Ga0496126_0026688 3300048929 Bacteria 5531
315 nmdc:mga0rr50_226598_c1 3300050513 Bacteria 1545
316 nmdc:mga0rr50_330850_c1 3300050513 Bacteria 1279
317 Ga0495601_0035003 3300053077 Bacteria 3133
318 Ga0495601_0128844 3300053077 Bacteria 1647
319 Ga0495595_0038267 3300053084 Bacteria 2184
320 Ga0495619_0157110 3300053085 Bacteria 1570
321 2644609621 2643221711 Bacteria 4865335
322 2812374855 2811994882 Bacteria 4688362
323 2819427592 2818991318 Bacteria 5266538
324 2819666450 2818991458 Bacteria 4794049
325 2819691616 2818991462 Bacteria 4320267
326 2819729604 2818991469 Bacteria 4644110
327 2839988391 2839986021 Bacteria 3685650
328 2887446457 2887443736 Bacteria 4426037
329 2932431984 2932431166 Bacteria 4215299
330 Ga0070714_100348960
331 Ga0070660_100064886
332 Ga0070709_10000283
333 Ga0070709_10010613
334 Ga0070709_10045942
335 Ga0070714_100000190
336 Ga0070714_100000403
337 Ga0070714_100120170
338 Ga0070714_100208543
339 Ga0070714_100539409
340 Ga0070713_100000848
341 Ga0070713_100058709
342 Ga0070713_100079830
343 Ga0070713_100106250
344 Ga0070713_100388596
345 Ga0070710_10000160
346 Ga0070710_10056636
347 Ga0070711_100000349
348 Ga0070711_100215210
349 Ga0070711_100292016
350 Ga0070705_100024227
351 Ga0070708_100040258
352 Ga0070708_100173116
353 Ga0070708_100234489
354 Ga0070663_100270632
355 Ga0070681_10049324
356 Ga0070706_100008821
357 Ga0070706_100047459
358 Ga0070706_100053186
359 Ga0070706_100133490
360 Ga0070706_100151355
361 Ga0070706_100334404
362 Ga0070707_100001347
363 Ga0070707_100009928
364 Ga0070707_100015657
365 Ga0070707_100054998
366 Ga0070707_100141771
367 Ga0070707_100383429
368 Ga0070698_100001666
369 Ga0070698_100004413
370 Ga0070698_100006398
371 Ga0070698_100025502
372 Ga0070698_100235103
373 Ga0070698_100324353
374 Ga0070698_100349689
375 Ga0070699_100012274
376 Ga0070679_100272698
377 Ga0070697_100096704
378 Ga0070695_100046689
379 Ga0068855_100032385
380 Ga0068857_100116072
381 Ga0068856_100064115
382 Ga0068856_100191925
383 Ga0068856_100328716
384 Ga0068864_100086274
385 Ga0068858_100021000
386 Ga0068860_100132647
387 Ga0070717_10001151
388 Ga0070717_10016182
389 Ga0070717_10053813
390 Ga0070717_10067333
391 Ga0070717_10101141
392 Ga0070715_10054249
393 Ga0070716_100000732
394 Ga0070712_100002043
395 Ga0070712_100022493
396 Ga0070712_100196248
397 Ga0070712_100232620
398 Ga0097621_100055957
399 Ga0075434_100137363
400 Ga0075435_100133534
401 Ga0105245_10012611
402 Ga0105242_10405186
403 Ga0105237_10109466
404 Ga0105238_10118632
405 Ga0105249_10292845
406 Ga0157370_10031020
407 Ga0157370_10090813
408 Ga0157369_10297191
409 Ga0157374_10090760
410 Ga0163162_10031339
411 Ga0157379_10044517
412 Ga0157376_10131116
413 Ga0157376_10388562
414 Ga0154015_1162151
415 Ga0213875_10000176
416 Ga0213875_10000419
417 Ga0207692_10000102
418 Ga0207692_10015285
419 Ga0207685_10005223
420 Ga0207685_10019755
421 Ga0207699_10000332
422 Ga0207699_10006274
423 Ga0207699_10025475
424 Ga0207684_10081170
425 Ga0207684_10208364
426 Ga0207707_10013467
427 Ga0207707_10064164
428 Ga0207671_10065321
429 Ga0207693_10005592
430 Ga0207693_10022597
431 Ga0207693_10044924
432 Ga0207693_10044951
433 Ga0207693_10220304
434 Ga0207663_10000446
435 Ga0207663_10005910
436 Ga0207663_10028598
437 Ga0207652_10207518
438 Ga0207646_10003961
439 Ga0207646_10024171
440 Ga0207646_10102890
441 Ga0207646_10130238
442 Ga0207646_10195963
443 Ga0207646_10238866
444 Ga0207646_10334427
445 Ga0207687_10045597
446 Ga0207700_10000139
447 Ga0207700_10003646
448 Ga0207700_10008409
449 Ga0207700_10013924
450 Ga0207700_10025108
451 Ga0207700_10086677
452 Ga0207700_10127524
453 Ga0207700_10474818
454 Ga0207664_10000108
455 Ga0207664_10000209
456 Ga0207664_10003668
457 Ga0207664_10035533
458 Ga0207664_10111940
459 Ga0207664_10264250
460 Ga0207665_10000753
461 Ga0207665_10013553
462 Ga0207665_10232937
463 Ga0207661_10113007
464 Ga0207703_10008002
465 Ga0207678_10022511
466 Ga0207702_10165211
467 Ga0207674_10031076
468 Ga0207674_10031563
469 Ga0268264_10094994
470 Ga0265337_1000743
471 Ga0265326_10024390
472 Ga0265334_10000299
473 Ga0265323_10002444
474 Ga0265336_10004015
475 Ga0265338_10002286
476 Ga0265338_10002589
477 Ga0265338_10006407
478 Ga0265324_10002757
479 Ga0265332_10023962
480 Ga0265320_10010077
481 Ga0265325_10009760
482 Ga0265340_10010078
483 Ga0265339_10090602
484 Ga0265316_10046226
485 Ga0265313_10007666
486 Ga0265314_10008636
487 Ga0307409_100091295
488 Ga0316214_1007220
489 Ga0373934_0000739
490 Ga0373949_0007286
491 Ga0373951_0016336
492 Ga0373923_0041591
493 Ga0373945_0062384
494 Ga0373953_0000215
495 Ga0373954_0008476
496 Ga0373956_0001535
497 Ga0373956_0082104
498 Ga0373957_0000144
499 Ga0373946_0065405
500 Ga0373955_0000420
501 Ga0373955_0009781
502 Ga0373955_0050659
503 Ga0373961_0038291
504 Ga0373924_0018335
505 Ga0373931_0010121
506 Ga0373931_0036921
507 Ga0373931_0151583
508 Ga0373935_0112500
509 Ga0373933_0000169
510 Ga0373933_0030394
511 Ga0373947_0056916
512 Ga0373937_0001816
513 Ga0373937_0098198
514 Ga0373937_0170133
515 Ga0373937_0438616
516 Ga0373925_0000030
517 Ga0373925_0014478
518 Ga0373925_0024705
519 Ga0395900_0353965
520 Ga0395898_0038401
521 Ga0395898_0065122
522 Ga0436364_0014047
523 Ga0436364_0303129
524 Ga0436364_1281565
525 Ga0395901_0022567
526 Ga0466963_0006273
527 Ga0495592_0001208
528 Ga0495592_0034957
529 Ga0495651_0001519
530 Ga0495651_0022257
531 Ga0495653_0008395
532 Ga0495653_0015735
533 Ga0495653_0031280
534 Ga0495653_0059302
535 Ga0495662_0054965
536 Ga0495662_0056022
537 Ga0495664_0027282
538 Ga0495664_0040826
539 Ga0495664_0142659
540 Ga0495608_0001287
541 Ga0495608_0003912
542 Ga0495608_0013142
543 Ga0495608_0027452
544 Ga0495618_0020845
545 Ga0495618_0032496
546 Ga0495628_0020744
547 Ga0495628_0039665
548 Ga0495628_0096069
549 Ga0495630_0039116
550 Ga0495652_0009477
551 Ga0495652_0019130
552 Ga0495652_0019523
553 Ga0495652_0022081
554 Ga0495652_0043267
555 Ga0495640_0018588
556 Ga0495640_0020041
557 Ga0495586_0047915
558 Ga0495587_0000934
559 Ga0495587_0005674
560 Ga0495645_0039140
561 Ga0495645_0117780
562 Ga0495667_0001051
563 Ga0495667_0013681
564 Ga0495667_0044600
565 Ga0495634_0060342
566 Ga0495634_0112104
567 Ga0495635_0076682
568 Ga0495657_0001875
569 Ga0495657_0018682
570 Ga0495657_0080283
571 Ga0495657_0093421
572 Ga0495599_0000780
573 Ga0495599_0007148
574 Ga0495599_0012278
575 Ga0495623_0001166
576 Ga0495646_0009435
577 Ga0495646_0015047
578 Ga0495646_0017416
579 Ga0495647_0104147
580 Ga0495613_0188598
581 Ga0495624_0067319
582 Ga0495600_0004783
583 Ga0495600_0007875
584 Ga0495600_0018626
585 Ga0495604_0001722
586 Ga0495604_0008350
587 Ga0495604_0023936
588 Ga0495604_0035144
589 Ga0495674_0005465
590 Ga0495674_0011055
591 Ga0495674_0018780
592 Ga0495674_0071948
593 Ga0495676_0027993
594 Ga0495676_0150322
595 Ga0495680_0002692
596 Ga0495680_0004311
597 Ga0495680_0008277
598 Ga0495680_0135552
599 Ga0495675_0001261
600 Ga0495684_0002620
601 Ga0495684_0019682
602 Ga0495602_0002762
603 Ga0495602_0003953
604 Ga0495602_0017160
605 Ga0495602_0040064
606 Ga0496100_0051159
607 Ga0496100_0060162
608 Ga0496100_0224003
609 Ga0496101_0006849
610 Ga0496101_0074808
611 Ga0496102_0015061
612 Ga0496102_0115572
613 Ga0496104_0010245
614 Ga0496104_0021703
615 Ga0496104_0058411
616 Ga0496104_0140553
617 Ga0496105_0019348
618 Ga0496105_0025590
619 Ga0496105_0032293
620 Ga0496105_0082266
621 Ga0496105_0102009
622 Ga0496105_0172046
623 Ga0496106_0082818
624 Ga0496107_0057681
625 Ga0496108_0006298
626 Ga0496108_0094893
627 Ga0496109_0016165
628 Ga0496110_0010232
629 Ga0496110_0057022
630 Ga0496110_0296026
631 Ga0496111_0044071
632 Ga0496111_0130091
633 Ga0496112_0046609
634 Ga0496112_0214731
635 Ga0496113_0057681
636 Ga0496113_0074570
637 Ga0496113_0215159
638 Ga0496114_0042766
639 Ga0496114_0116852
640 Ga0496115_0007481
641 Ga0496115_0048078
642 Ga0496126_0021473
643 Ga0496126_0026688
644 nmdc:mga0rr50_226598_c1
645 nmdc:mga0rr50_330850_c1
646 Ga0495601_0035003
647 Ga0495601_0128844
648 Ga0495595_0038267
649 Ga0495619_0157110
650 2644609621
651 2812374855
652 2819427592
653 2819666450
654 2819691616
655 2819729604
656 2839988391
657 2887446457
658 2932431984

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

3

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.9263 105 343
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8466 105 343
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7173 24 350
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.6971 1 350
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.6607 24 350
ID Description Score Start End Superfamily
af_Q5JK26_123_351_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.6652 131 320 3.40.1130.10
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6533 147 274 3.40.1010.10
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6508 156 278 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6405 150 274 3.40.50.2000
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6351 137 274 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A6I3H7H8-F1-model_v4 Phosphatidylinositol mannoside acyltransferase 0.9606 13 337 GO:0005886
GO:0009247
GO:0016746
AF-A0A6I3H7H8-F1-model_v4 Phosphatidylinositol mannoside acyltransferase 0.9509 13 337 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W9MTI9-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase (EC 2.3.1.241) 0.9448 31 333 GO:0005886
GO:0008913
GO:0009247
AF-A0A7V9IV65-F1-model_v4 Phosphatidylinositol mannoside acyltransferase 0.9433 7 341 GO:0005886
GO:0009247
GO:0016746
AF-A0A1X4H3D2-F1-model_v4 deleted 0.943 4 339

Map