F409430

General Info

Members Datasets Scaffolds Average Seq Length
328 209 656 149

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0000128|Ga0501069_0000128_15145_15696
Length 176
Sequence LGPLVAALTMRISIGSDHAGFPLKQHLIEVLRDAGHEVFDHGTSSTEPVDYPGYCAAAARSVARGEADFGVVVGGSGQGEQLAANSVAGVRAALCNDLYTARMARAHNDANVLSMGARVVGEGLADEILELFLTTPFDGGRHLRRVDQLSALDAAAALXXQLLAGPAGSAPSGDQQ

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
130 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 1.83
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0000128 3300049585 Bacteria 33014
2 JGI25407J50210_10000292 3300003373 Bacteria 9073
3 Ga0065712_10026427 3300005290 Bacteria 1149
4 Ga0070658_10648668 3300005327 Bacteria 916
5 Ga0070683_100148644 3300005329 Bacteria 2221
6 Ga0070670_100097750 3300005331 Bacteria 2526
7 Ga0070670_101435351 3300005331 Bacteria 633
8 Ga0070666_10780268 3300005335 Unclassified 703
9 Ga0070680_100057800 3300005336 Bacteria 3172
10 Ga0068868_100014184 3300005338 Bacteria 5868
11 Ga0070660_100021581 3300005339 Bacteria 4751
12 Ga0070691_10004619 3300005341 Bacteria 6258
13 Ga0070661_100206034 3300005344 Bacteria 1504
14 Ga0070675_100029921 3300005354 Bacteria 4394
15 Ga0070673_101366726 3300005364 Bacteria 666
16 Ga0070688_100560314 3300005365 Bacteria 870
17 Ga0070667_100115260 3300005367 Bacteria 2334
18 Ga0070701_10072084 3300005438 Bacteria 1849
19 Ga0070708_100161479 3300005445 Bacteria 2088
20 Ga0070681_10001630 3300005458 Bacteria 20007
21 Ga0068867_100100241 3300005459 Bacteria 2211
22 Ga0070685_10045459 3300005466 Bacteria 2518
23 Ga0070706_100024887 3300005467 Bacteria 5511
24 Ga0070707_100333170 3300005468 Bacteria 1474
25 Ga0070707_100659418 3300005468 Bacteria 1009
26 Ga0070699_101089477 3300005518 Bacteria 733
27 Ga0070699_101102825 3300005518 Bacteria 728
28 Ga0070679_100001659 3300005530 Bacteria 20069
29 Ga0070679_100344074 3300005530 Bacteria 1439
30 Ga0070684_100002002 3300005535 Bacteria 14988
31 Ga0070697_100240109 3300005536 Bacteria 1547
32 Ga0068853_100137834 3300005539 Bacteria 2189
33 Ga0068853_100151338 3300005539 Bacteria 2089
34 Ga0070672_100451145 3300005543 Bacteria 1108
35 Ga0070695_100003854 3300005545 Bacteria 8752
36 Ga0070696_100072941 3300005546 Bacteria 2418
37 Ga0070665_100037006 3300005548 Bacteria 4908
38 Ga0070704_100014698 3300005549 Bacteria 4895
39 Ga0070704_100296266 3300005549 Bacteria 1346
40 Ga0068855_100154553 3300005563 Bacteria 2607
41 Ga0070664_100798930 3300005564 Bacteria 882
42 Ga0068857_100026821 3300005577 Bacteria 5080
43 Ga0068857_100049700 3300005577 Bacteria 3720
44 Ga0068854_100719465 3300005578 Unclassified 863
45 Ga0068856_100001622 3300005614 Bacteria 23563
46 Ga0068852_100009285 3300005616 Bacteria 7292
47 Ga0068859_100480527 3300005617 Bacteria 1338
48 Ga0068864_100732273 3300005618 Bacteria 968
49 Ga0068866_10085081 3300005718 Bacteria 1708
50 Ga0068861_100050083 3300005719 Bacteria 3165
51 Ga0068870_10133780 3300005840 Bacteria 1443
52 Ga0068863_100838482 3300005841 Bacteria 918
53 Ga0068860_100503766 3300005843 Bacteria 1209
54 Ga0068860_101839292 3300005843 Bacteria 627
55 Ga0068862_100429750 3300005844 Bacteria 1241
56 Ga0068862_101130870 3300005844 Bacteria 779
57 Ga0081538_10000157 3300005981 Bacteria 71165
58 Ga0075367_10077482 3300006178 Bacteria 2007
59 Ga0075370_10419224 3300006353 Bacteria 804
60 Ga0068871_100161854 3300006358 Unclassified 1915
61 Ga0068871_100207104 3300006358 Bacteria 1695
62 Ga0068871_100264690 3300006358 Bacteria 1500
63 Ga0075428_100048901 3300006844 Bacteria 4641
64 Ga0075428_100586773 3300006844 Bacteria 1191
65 Ga0075430_100648131 3300006846 Bacteria 871
66 Ga0075431_100008941 3300006847 Bacteria 10038
67 Ga0075431_100346932 3300006847 Bacteria 1493
68 Ga0075431_100726048 3300006847 Bacteria 970
69 Ga0075431_101382423 3300006847 Bacteria 664
70 Ga0075433_10069569 3300006852 Bacteria 3091
71 Ga0075434_100004468 3300006871 Bacteria 12616
72 Ga0075429_100033102 3300006880 Bacteria 4491
73 Ga0075436_100082548 3300006914 Bacteria 2229
74 Ga0075436_100094687 3300006914 Bacteria 2077
75 Ga0097620_100480545 3300006931 Bacteria 1338
76 Ga0075435_100154653 3300007076 Bacteria 1929
77 Ga0105240_10032577 3300009093 Bacteria 6747
78 Ga0105240_10409291 3300009093 Bacteria 1526
79 Ga0111539_10064517 3300009094 Bacteria 4331
80 Ga0105245_10140841 3300009098 Bacteria 2271
81 Ga0114129_10225723 3300009147 Bacteria 2524
82 Ga0105243_10058407 3300009148 Bacteria 3074
83 Ga0105243_10099425 3300009148 Bacteria 2411
84 Ga0105243_10345423 3300009148 Bacteria 1364
85 Ga0105241_10083595 3300009174 Bacteria 2505
86 Ga0105242_10465392 3300009176 Bacteria 1195
87 Ga0105248_10046417 3300009177 Bacteria 4869
88 Ga0105248_10826657 3300009177 Bacteria 1045
89 Ga0105237_10008794 3300009545 Bacteria 10891
90 Ga0105237_10009439 3300009545 Bacteria 10450
91 Ga0105238_10011328 3300009551 Bacteria 8972
92 Ga0105238_10156719 3300009551 Bacteria 2252
93 Ga0105249_10051389 3300009553 Bacteria 3760
94 Ga0105249_11005515 3300009553 Bacteria 903
95 Ga0105239_10002755 3300010375 Bacteria 22064
96 Ga0105239_11154904 3300010375 Bacteria 892
97 Ga0105239_11511569 3300010375 Unclassified 776
98 Ga0105246_10857414 3300011119 Bacteria 811
99 Ga0157370_10059543 3300013104 Bacteria 3629
100 Ga0157369_10015903 3300013105 Bacteria 8472
101 Ga0157374_10099144 3300013296 Bacteria 2790
102 Ga0157372_10006626 3300013307 Bacteria 12328
103 Ga0163163_10159993 3300014325 Bacteria 2297
104 Ga0163163_10325786 3300014325 Bacteria 1590
105 Ga0163163_10765670 3300014325 Bacteria 1029
106 Ga0163163_11870359 3300014325 Bacteria 660
107 Ga0157380_10018791 3300014326 Bacteria 5139
108 Ga0157379_10201074 3300014968 Bacteria 1802
109 Ga0207642_10392013 3300025899 Bacteria 829
110 Ga0207680_10366178 3300025903 Unclassified 1014
111 Ga0207643_10280051 3300025908 Unclassified 1034
112 Ga0207705_11031611 3300025909 Bacteria 635
113 Ga0207654_10020861 3300025911 Bacteria 3479
114 Ga0207707_10001605 3300025912 Bacteria 20849
115 Ga0207707_10278088 3300025912 Bacteria 1450
116 Ga0207695_10000264 3300025913 Bacteria 132624
117 Ga0207695_10018819 3300025913 Bacteria 7970
118 Ga0207671_10014437 3300025914 Bacteria 6242
119 Ga0207660_10041220 3300025917 Bacteria 3235
120 Ga0207649_10320792 3300025920 Bacteria 1138
121 Ga0207652_10002681 3300025921 Bacteria 14932
122 Ga0207646_10142450 3300025922 Bacteria 2159
123 Ga0207694_10000543 3300025924 Bacteria 34172
124 Ga0207659_10096947 3300025926 Bacteria 2214
125 Ga0207709_10109481 3300025935 Bacteria 1844
126 Ga0207709_10341079 3300025935 Bacteria 1128
127 Ga0207670_10326412 3300025936 Bacteria 1209
128 Ga0207661_10002231 3300025944 Bacteria 13365
129 Ga0207661_10121222 3300025944 Bacteria 2227
130 Ga0207661_10298920 3300025944 Bacteria 1443
131 Ga0207667_10000179 3300025949 Bacteria 92219
132 Ga0207651_10192740 3300025960 Bacteria 1627
133 Ga0207712_10029937 3300025961 Bacteria 3657
134 Ga0207640_10733959 3300025981 Bacteria 850
135 Ga0207658_10316095 3300025986 Unclassified 1350
136 Ga0207677_10021308 3300026023 Bacteria 3957
137 Ga0207639_10190808 3300026041 Bacteria 1750
138 Ga0207639_10194560 3300026041 Bacteria 1734
139 Ga0207708_10302591 3300026075 Bacteria 1301
140 Ga0207702_10040361 3300026078 Bacteria 3913
141 Ga0207648_11747531 3300026089 Unclassified 584
142 Ga0207676_10645907 3300026095 Bacteria 1021
143 Ga0207676_12082377 3300026095 Unclassified 566
144 Ga0207674_10000936 3300026116 Bacteria 38032
145 Ga0207674_10022543 3300026116 Bacteria 6760
146 Ga0207698_10023636 3300026142 Bacteria 4297
147 Ga0207428_10064152 3300027907 Bacteria 2901
148 Ga0268266_10027839 3300028379 Bacteria 4805
149 Ga0268265_11011909 3300028380 Bacteria 821
150 Ga0268264_10105024 3300028381 Bacteria 2463
151 Ga0268264_10397260 3300028381 Bacteria 1324
152 Ga0268264_10895044 3300028381 Bacteria 891
153 Ga0265313_10003265 3300031595 Bacteria 13319
154 Ga0373936_0119343 3300035113 Unclassified 1125
155 Ga0373945_0437681 3300035116 Unclassified 577
156 Ga0373956_0205194 3300035119 Bacteria 934
157 Ga0373943_0030797 3300035170 Bacteria 2542
158 Ga0316574_0014805 3300035398 Bacteria 4515
159 Ga0373931_0018250 3300035691 Bacteria 3487
160 Ga0373935_0583087 3300035692 Bacteria 817
161 Ga0373935_0925744 3300035692 Unclassified 646
162 Ga0373947_0003153 3300035725 Bacteria 9819
163 Ga0373947_0791644 3300035725 Bacteria 647
164 Ga0373937_0095004 3300036401 Bacteria 2764
165 Ga0373925_0005661 3300037068 Bacteria 9297
166 Ga0395900_0012258 3300037418 Bacteria 8766
167 Ga0395905_0062480 3300037471 Bacteria 3484
168 Ga0436364_1379023 3300037853 Bacteria 1130
169 Ga0439438_144770 3300041405 Bacteria 568
170 Ga0451789_1278149 3300041443 Bacteria 900
171 Ga0451577_0978436 3300042876 Bacteria 760
172 Ga0466960_0014199 3300044901 Bacteria 3403
173 Ga0451576_0053669 3300045051 Bacteria 4221
174 Ga0451576_0171434 3300045051 Bacteria 2265
175 Ga0451576_1557444 3300045051 Bacteria 686
176 Ga0495629_0000930 3300046459 Bacteria 23556
177 Ga0495629_0093422 3300046459 Bacteria 2099
178 Ga0495653_0621516 3300046463 Unclassified 662
179 Ga0495580_0157153 3300046472 Bacteria 1574
180 Ga0495582_0050847 3300046473 Unclassified 2284
181 Ga0495639_0029935 3300046475 Bacteria 2418
182 Ga0495662_0124500 3300046476 Unclassified 1266
183 Ga0495594_0030029 3300046499 Unclassified 2939
184 Ga0495594_0050530 3300046499 Bacteria 2287
185 Ga0495630_0130573 3300046517 Bacteria 1908
186 Ga0495666_0242365 3300046526 Bacteria 822
187 Ga0495652_0066344 3300046529 Bacteria 3029
188 Ga0495652_0067900 3300046529 Bacteria 2988
189 Ga0495665_0153952 3300046531 Unclassified 1199
190 Ga0495640_0070231 3300046533 Bacteria 2354
191 Ga0495587_0169899 3300046536 Unclassified 1239
192 Ga0495645_0038633 3300046543 Bacteria 3482
193 Ga0495622_0134588 3300046557 Bacteria 1124
194 Ga0495667_0138989 3300046559 Bacteria 1566
195 Ga0495634_0208636 3300046642 Unclassified 1210
196 Ga0495635_0000997 3300046663 Bacteria 18689
197 Ga0495599_0048975 3300046678 Bacteria 2649
198 Ga0495647_0005822 3300046681 Bacteria 4055
199 Ga0495658_0000349 3300046683 Bacteria 25998
200 Ga0495613_0025346 3300046689 Bacteria 4419
201 Ga0495581_0000650 3300047315 Bacteria 18214
202 Ga0495676_0201625 3300047321 Bacteria 1382
203 Ga0495680_0022308 3300047322 Bacteria 5279
204 Ga0495684_0256551 3300047471 Bacteria 1270
205 Ga0495684_0957735 3300047471 Bacteria 547
206 Ga0495593_0127886 3300047673 Bacteria 1291
207 Ga0496102_0358220 3300048905 Bacteria 1373
208 Ga0496104_0444773 3300048907 Bacteria 1208
209 Ga0496113_1279255 3300048916 Bacteria 571
210 Ga0496114_0501815 3300048917 Bacteria 1073
211 Ga0496114_1372231 3300048917 Unclassified 594
212 Ga0501031_0005623 3300049568 Bacteria 8167
213 Ga0501031_0039578 3300049568 Bacteria 3077
214 Ga0501031_0055255 3300049568 Bacteria 2587
215 Ga0501032_0039968 3300049569 Bacteria 3189
216 Ga0501032_0122380 3300049569 Bacteria 1719
217 Ga0501033_0001615 3300049570 Bacteria 19802
218 Ga0501033_0005444 3300049570 Bacteria 10087
219 Ga0501034_0015834 3300049571 Bacteria 7743
220 Ga0501034_0052973 3300049571 Bacteria 4087
221 Ga0501034_0149405 3300049571 Bacteria 2312
222 Ga0501034_1367870 3300049571 Bacteria 583
223 Ga0501036_0003677 3300049572 Bacteria 12274
224 Ga0501036_0006972 3300049572 Bacteria 9193
225 Ga0501036_0325263 3300049572 Bacteria 1285
226 Ga0501036_1010091 3300049572 Bacteria 681
227 Ga0501037_0004038 3300049573 Bacteria 10644
228 Ga0501037_0025308 3300049573 Bacteria 4384
229 Ga0501037_0039749 3300049573 Bacteria 3462
230 Ga0501037_0174332 3300049573 Bacteria 1528
231 Ga0501038_0001251 3300049574 Bacteria 23057
232 Ga0501038_0025641 3300049574 Bacteria 5252
233 Ga0501038_0073362 3300049574 Bacteria 2898
234 Ga0501038_0897405 3300049574 Bacteria 654
235 Ga0501039_0176896 3300049575 Bacteria 1678
236 Ga0501039_0544940 3300049575 Bacteria 910
237 Ga0501041_0070970 3300049577 Bacteria 2138
238 Ga0501042_0056335 3300049578 Bacteria 2805
239 Ga0501042_0063820 3300049578 Bacteria 2632
240 Ga0501042_0182254 3300049578 Bacteria 1515
241 Ga0501043_0059183 3300049579 Bacteria 3006
242 Ga0501043_0237994 3300049579 Bacteria 1405
243 Ga0501046_0002703 3300049580 Bacteria 16497
244 Ga0501046_0035407 3300049580 Bacteria 4023
245 Ga0501046_0075139 3300049580 Bacteria 2620
246 Ga0501047_0008664 3300049581 Bacteria 9605
247 Ga0501047_0067176 3300049581 Bacteria 3455
248 Ga0501047_0111577 3300049581 Bacteria 2617
249 Ga0501047_0325883 3300049581 Bacteria 1375
250 Ga0501047_0347758 3300049581 Bacteria 1319
251 Ga0501048_0004727 3300049582 Bacteria 10365
252 Ga0501048_0006747 3300049582 Bacteria 8720
253 Ga0501048_0035971 3300049582 Bacteria 3562
254 Ga0501048_0042680 3300049582 Bacteria 3246
255 Ga0501067_0006278 3300049583 Bacteria 6594
256 Ga0501067_0009502 3300049583 Bacteria 5386
257 Ga0501067_0030311 3300049583 Bacteria 3000
258 Ga0501068_0007496 3300049584 Bacteria 6039
259 Ga0501068_0085821 3300049584 Bacteria 1937
260 Ga0501068_0394685 3300049584 Bacteria 892
261 Ga0501069_0011863 3300049585 Bacteria 4620
262 Ga0501070_0000230 3300049586 Bacteria 52769
263 Ga0501070_0006085 3300049586 Bacteria 10281
264 Ga0501071_0002354 3300049587 Bacteria 11435
265 Ga0501071_0012598 3300049587 Bacteria 5742
266 Ga0501071_0077845 3300049587 Bacteria 2423
267 Ga0501071_0840216 3300049587 Bacteria 708
268 Ga0501071_0857817 3300049587 Bacteria 700
269 Ga0501072_0086405 3300049588 Bacteria 2489
270 Ga0501072_0120432 3300049588 Bacteria 2091
271 Ga0501072_0365544 3300049588 Bacteria 1145
272 Ga0501073_0000941 3300049589 Bacteria 20935
273 Ga0501073_0010376 3300049589 Bacteria 6831
274 Ga0501073_0021180 3300049589 Bacteria 4688
275 Ga0501074_0001638 3300049590 Bacteria 15167
276 Ga0501074_0023377 3300049590 Bacteria 4494
277 Ga0501074_0193567 3300049590 Bacteria 1450
278 Ga0501074_1105773 3300049590 Bacteria 556
279 Ga0501075_0037515 3300049591 Bacteria 3621
280 Ga0501076_0045581 3300049592 Bacteria 3462
281 Ga0501076_0213512 3300049592 Bacteria 1577
282 Ga0501076_0573868 3300049592 Bacteria 930
283 Ga0501076_0650725 3300049592 Bacteria 870
284 Ga0501079_0005253 3300049741 Bacteria 9628
285 Ga0501079_0047024 3300049741 Bacteria 3329
286 Ga0501079_0096998 3300049741 Bacteria 2285
287 Ga0501079_0114776 3300049741 Bacteria 2093
288 Ga0501080_0015890 3300049742 Bacteria 6942
289 Ga0501080_0192780 3300049742 Bacteria 1872
290 Ga0501080_0223716 3300049742 Bacteria 1721
291 Ga0501080_0446675 3300049742 Bacteria 1160
292 Ga0501081_0037324 3300049743 Bacteria 3315
293 Ga0501083_0001573 3300049744 Bacteria 15589
294 Ga0501083_0051716 3300049744 Bacteria 2762
295 Ga0501035_0004014 3300049822 Bacteria 14037
296 Ga0501035_0014455 3300049822 Bacteria 7285
297 Ga0501035_0015978 3300049822 Bacteria 6927
298 Ga0501035_0222602 3300049822 Bacteria 1610
299 Ga0501044_0035205 3300049823 Bacteria 5244
300 Ga0501044_0468321 3300049823 Bacteria 1164
301 Ga0501045_0035059 3300049824 Bacteria 3643
302 Ga0501045_0080792 3300049824 Bacteria 2397
303 nmdc:mga06z11_57406_c1 3300050494 Bacteria 2016
304 nmdc:mga05p37_191496_c1 3300050507 Bacteria 2483
305 nmdc:mga09592_108880_c1 3300050508 Bacteria 2377
306 nmdc:mga0qj67_616898_c1 3300050509 Bacteria 867
307 nmdc:mga06r32_1104100_c1 3300050510 Bacteria 742
308 nmdc:mga06r32_1532093_c1 3300050510 Bacteria 606
309 nmdc:mga06r32_83293_c1 3300050510 Bacteria 3117
310 nmdc:mga08y16_269556_c1 3300050511 Bacteria 1758
311 nmdc:mga0n895_215109_c1 3300050512 Bacteria 1952
312 nmdc:mga0n895_445021_c1 3300050512 Bacteria 1308
313 nmdc:mga0rr50_41162_c1 3300050513 Bacteria 3365
314 nmdc:mga08x19_32653_c1 3300050514 Bacteria 3282
315 nmdc:mga08x19_92643_c1 3300050514 Bacteria 1996
316 nmdc:mga0a205_125091_c1 3300050515 Bacteria 2471
317 Ga0495619_0008505 3300053085 Bacteria 6490
318 Ga0495619_0182978 3300053085 Bacteria 1450
319 Ga0500566_0051512 3300053094 Bacteria 2354
320 Ga0501084_0005770 3300054114 Bacteria 10181
321 Ga0501084_0044367 3300054114 Bacteria 3722
322 Ga0501084_0246196 3300054114 Bacteria 1509
323 Ga0501084_0354752 3300054114 Bacteria 1239
324 Ga0501082_0004676 3300060353 Bacteria 11938
325 Ga0501082_0027957 3300060353 Bacteria 4857
326 Ga0501082_0095709 3300060353 Bacteria 2566
327 Ga0530510_0044802 3300061734 Bacteria 3197
328 Ga0530510_0156581 3300061734 Bacteria 1684
329 Ga0501069_0000128
330 JGI25407J50210_10000292
331 Ga0065712_10026427
332 Ga0070658_10648668
333 Ga0070683_100148644
334 Ga0070670_100097750
335 Ga0070670_101435351
336 Ga0070666_10780268
337 Ga0070680_100057800
338 Ga0068868_100014184
339 Ga0070660_100021581
340 Ga0070691_10004619
341 Ga0070661_100206034
342 Ga0070675_100029921
343 Ga0070673_101366726
344 Ga0070688_100560314
345 Ga0070667_100115260
346 Ga0070701_10072084
347 Ga0070708_100161479
348 Ga0070681_10001630
349 Ga0068867_100100241
350 Ga0070685_10045459
351 Ga0070706_100024887
352 Ga0070707_100333170
353 Ga0070707_100659418
354 Ga0070699_101089477
355 Ga0070699_101102825
356 Ga0070679_100001659
357 Ga0070679_100344074
358 Ga0070684_100002002
359 Ga0070697_100240109
360 Ga0068853_100137834
361 Ga0068853_100151338
362 Ga0070672_100451145
363 Ga0070695_100003854
364 Ga0070696_100072941
365 Ga0070665_100037006
366 Ga0070704_100014698
367 Ga0070704_100296266
368 Ga0068855_100154553
369 Ga0070664_100798930
370 Ga0068857_100026821
371 Ga0068857_100049700
372 Ga0068854_100719465
373 Ga0068856_100001622
374 Ga0068852_100009285
375 Ga0068859_100480527
376 Ga0068864_100732273
377 Ga0068866_10085081
378 Ga0068861_100050083
379 Ga0068870_10133780
380 Ga0068863_100838482
381 Ga0068860_100503766
382 Ga0068860_101839292
383 Ga0068862_100429750
384 Ga0068862_101130870
385 Ga0081538_10000157
386 Ga0075367_10077482
387 Ga0075370_10419224
388 Ga0068871_100161854
389 Ga0068871_100207104
390 Ga0068871_100264690
391 Ga0075428_100048901
392 Ga0075428_100586773
393 Ga0075430_100648131
394 Ga0075431_100008941
395 Ga0075431_100346932
396 Ga0075431_100726048
397 Ga0075431_101382423
398 Ga0075433_10069569
399 Ga0075434_100004468
400 Ga0075429_100033102
401 Ga0075436_100082548
402 Ga0075436_100094687
403 Ga0097620_100480545
404 Ga0075435_100154653
405 Ga0105240_10032577
406 Ga0105240_10409291
407 Ga0111539_10064517
408 Ga0105245_10140841
409 Ga0114129_10225723
410 Ga0105243_10058407
411 Ga0105243_10099425
412 Ga0105243_10345423
413 Ga0105241_10083595
414 Ga0105242_10465392
415 Ga0105248_10046417
416 Ga0105248_10826657
417 Ga0105237_10008794
418 Ga0105237_10009439
419 Ga0105238_10011328
420 Ga0105238_10156719
421 Ga0105249_10051389
422 Ga0105249_11005515
423 Ga0105239_10002755
424 Ga0105239_11154904
425 Ga0105239_11511569
426 Ga0105246_10857414
427 Ga0157370_10059543
428 Ga0157369_10015903
429 Ga0157374_10099144
430 Ga0157372_10006626
431 Ga0163163_10159993
432 Ga0163163_10325786
433 Ga0163163_10765670
434 Ga0163163_11870359
435 Ga0157380_10018791
436 Ga0157379_10201074
437 Ga0207642_10392013
438 Ga0207680_10366178
439 Ga0207643_10280051
440 Ga0207705_11031611
441 Ga0207654_10020861
442 Ga0207707_10001605
443 Ga0207707_10278088
444 Ga0207695_10000264
445 Ga0207695_10018819
446 Ga0207671_10014437
447 Ga0207660_10041220
448 Ga0207649_10320792
449 Ga0207652_10002681
450 Ga0207646_10142450
451 Ga0207694_10000543
452 Ga0207659_10096947
453 Ga0207709_10109481
454 Ga0207709_10341079
455 Ga0207670_10326412
456 Ga0207661_10002231
457 Ga0207661_10121222
458 Ga0207661_10298920
459 Ga0207667_10000179
460 Ga0207651_10192740
461 Ga0207712_10029937
462 Ga0207640_10733959
463 Ga0207658_10316095
464 Ga0207677_10021308
465 Ga0207639_10190808
466 Ga0207639_10194560
467 Ga0207708_10302591
468 Ga0207702_10040361
469 Ga0207648_11747531
470 Ga0207676_10645907
471 Ga0207676_12082377
472 Ga0207674_10000936
473 Ga0207674_10022543
474 Ga0207698_10023636
475 Ga0207428_10064152
476 Ga0268266_10027839
477 Ga0268265_11011909
478 Ga0268264_10105024
479 Ga0268264_10397260
480 Ga0268264_10895044
481 Ga0265313_10003265
482 Ga0373936_0119343
483 Ga0373945_0437681
484 Ga0373956_0205194
485 Ga0373943_0030797
486 Ga0316574_0014805
487 Ga0373931_0018250
488 Ga0373935_0583087
489 Ga0373935_0925744
490 Ga0373947_0003153
491 Ga0373947_0791644
492 Ga0373937_0095004
493 Ga0373925_0005661
494 Ga0395900_0012258
495 Ga0395905_0062480
496 Ga0436364_1379023
497 Ga0439438_144770
498 Ga0451789_1278149
499 Ga0451577_0978436
500 Ga0466960_0014199
501 Ga0451576_0053669
502 Ga0451576_0171434
503 Ga0451576_1557444
504 Ga0495629_0000930
505 Ga0495629_0093422
506 Ga0495653_0621516
507 Ga0495580_0157153
508 Ga0495582_0050847
509 Ga0495639_0029935
510 Ga0495662_0124500
511 Ga0495594_0030029
512 Ga0495594_0050530
513 Ga0495630_0130573
514 Ga0495666_0242365
515 Ga0495652_0066344
516 Ga0495652_0067900
517 Ga0495665_0153952
518 Ga0495640_0070231
519 Ga0495587_0169899
520 Ga0495645_0038633
521 Ga0495622_0134588
522 Ga0495667_0138989
523 Ga0495634_0208636
524 Ga0495635_0000997
525 Ga0495599_0048975
526 Ga0495647_0005822
527 Ga0495658_0000349
528 Ga0495613_0025346
529 Ga0495581_0000650
530 Ga0495676_0201625
531 Ga0495680_0022308
532 Ga0495684_0256551
533 Ga0495684_0957735
534 Ga0495593_0127886
535 Ga0496102_0358220
536 Ga0496104_0444773
537 Ga0496113_1279255
538 Ga0496114_0501815
539 Ga0496114_1372231
540 Ga0501031_0005623
541 Ga0501031_0039578
542 Ga0501031_0055255
543 Ga0501032_0039968
544 Ga0501032_0122380
545 Ga0501033_0001615
546 Ga0501033_0005444
547 Ga0501034_0015834
548 Ga0501034_0052973
549 Ga0501034_0149405
550 Ga0501034_1367870
551 Ga0501036_0003677
552 Ga0501036_0006972
553 Ga0501036_0325263
554 Ga0501036_1010091
555 Ga0501037_0004038
556 Ga0501037_0025308
557 Ga0501037_0039749
558 Ga0501037_0174332
559 Ga0501038_0001251
560 Ga0501038_0025641
561 Ga0501038_0073362
562 Ga0501038_0897405
563 Ga0501039_0176896
564 Ga0501039_0544940
565 Ga0501041_0070970
566 Ga0501042_0056335
567 Ga0501042_0063820
568 Ga0501042_0182254
569 Ga0501043_0059183
570 Ga0501043_0237994
571 Ga0501046_0002703
572 Ga0501046_0035407
573 Ga0501046_0075139
574 Ga0501047_0008664
575 Ga0501047_0067176
576 Ga0501047_0111577
577 Ga0501047_0325883
578 Ga0501047_0347758
579 Ga0501048_0004727
580 Ga0501048_0006747
581 Ga0501048_0035971
582 Ga0501048_0042680
583 Ga0501067_0006278
584 Ga0501067_0009502
585 Ga0501067_0030311
586 Ga0501068_0007496
587 Ga0501068_0085821
588 Ga0501068_0394685
589 Ga0501069_0011863
590 Ga0501070_0000230
591 Ga0501070_0006085
592 Ga0501071_0002354
593 Ga0501071_0012598
594 Ga0501071_0077845
595 Ga0501071_0840216
596 Ga0501071_0857817
597 Ga0501072_0086405
598 Ga0501072_0120432
599 Ga0501072_0365544
600 Ga0501073_0000941
601 Ga0501073_0010376
602 Ga0501073_0021180
603 Ga0501074_0001638
604 Ga0501074_0023377
605 Ga0501074_0193567
606 Ga0501074_1105773
607 Ga0501075_0037515
608 Ga0501076_0045581
609 Ga0501076_0213512
610 Ga0501076_0573868
611 Ga0501076_0650725
612 Ga0501079_0005253
613 Ga0501079_0047024
614 Ga0501079_0096998
615 Ga0501079_0114776
616 Ga0501080_0015890
617 Ga0501080_0192780
618 Ga0501080_0223716
619 Ga0501080_0446675
620 Ga0501081_0037324
621 Ga0501083_0001573
622 Ga0501083_0051716
623 Ga0501035_0004014
624 Ga0501035_0014455
625 Ga0501035_0015978
626 Ga0501035_0222602
627 Ga0501044_0035205
628 Ga0501044_0468321
629 Ga0501045_0035059
630 Ga0501045_0080792
631 nmdc:mga06z11_57406_c1
632 nmdc:mga05p37_191496_c1
633 nmdc:mga09592_108880_c1
634 nmdc:mga0qj67_616898_c1
635 nmdc:mga06r32_1104100_c1
636 nmdc:mga06r32_1532093_c1
637 nmdc:mga06r32_83293_c1
638 nmdc:mga08y16_269556_c1
639 nmdc:mga0n895_215109_c1
640 nmdc:mga0n895_445021_c1
641 nmdc:mga0rr50_41162_c1
642 nmdc:mga08x19_32653_c1
643 nmdc:mga08x19_92643_c1
644 nmdc:mga0a205_125091_c1
645 Ga0495619_0008505
646 Ga0495619_0182978
647 Ga0500566_0051512
648 Ga0501084_0005770
649 Ga0501084_0044367
650 Ga0501084_0246196
651 Ga0501084_0354752
652 Ga0501082_0004676
653 Ga0501082_0027957
654 Ga0501082_0095709
655 Ga0530510_0044802
656 Ga0530510_0156581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

12

149

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.987 1 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9816 2 144
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.979 2 145
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9779 2 142
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9746 1 141
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9793 2 145 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9749 2 142 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9746 1 141 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9706 1 145 3.40.1400.10
6mu0A00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9585 2 145 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A5Q2RI81-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9991 2 144 GO:0004751
GO:0009052
GO:0019316
AF-A0A6J6WX17-F1-model_v4 Unannotated protein 0.9988 1 146 GO:0005975
GO:0016853
AF-A0A6J7GNZ8-F1-model_v4 Unannotated protein 0.9988 2 148 GO:0004751
GO:0009052
GO:0019316
AF-A0A7W1SDQ1-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9985 1 145 GO:0004751
GO:0009052
GO:0019316
AF-B1N6P2-F1-model_v4 Putative ribose-5-phosphate isomerase B 0.9981 2 148 GO:0004751
GO:0009052
GO:0019316

Map