F409145

General Info

Members Datasets Scaffolds Average Seq Length
328 166 656 369

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100026785|Ga0070672_1000267852
Length 403
Sequence MACPQRSNQAATGDLANAAPGTTLAPNDESLVPAMPPDPAQRFADVNAVAAGYLRDLAYAQTSQPKMFGYKRAAAAVLALEEPLTSLITPGRQLARIPGVGPASQRVIFEVLDSGTSPTADAAVNLSGRAADIARRRALRSHFLSRAEVMRILRDPRFDGPTRSDYRGDLQMHSEWSDGRPSLDEIADACLARGYAHAAVTDHSHGLKIAGGMSPAEAAAQREAIARLNERYEGRFRMISGVEANIGADGQLDLSAEEAAGFELVLAAPHSKLRKAEDQTARMLAAVATPRVRVLAHPRGRITGSRAGVVADWDAVFGAAVQHGVAVEIDGDPSRQDLDFSLAARALAAGCLFALDSDAHTTSQLVYAETALAHARLAGIPPDRIVNCWPTPRLLEWLRGRAA

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.57
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 18.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100026785 3300005543 Bacteria 4296
2 Ga0065707_10125740 3300005295 Unclassified 2018
3 Ga0070676_10015325 3300005328 Bacteria 4228
4 Ga0070690_100030103 3300005330 Bacteria 3371
5 Ga0070690_100098058 3300005330 Unclassified 1939
6 Ga0070690_100109270 3300005330 Bacteria 1843
7 Ga0070670_100000749 3300005331 Bacteria 25181
8 Ga0070670_100293964 3300005331 Bacteria 1420
9 Ga0070677_10039487 3300005333 Unclassified 1852
10 Ga0068869_100010881 3300005334 Bacteria 5951
11 Ga0068869_100065222 3300005334 Unclassified 2680
12 Ga0070666_10032835 3300005335 Bacteria 3431
13 Ga0070666_10062976 3300005335 Bacteria 2513
14 Ga0068868_100004873 3300005338 Bacteria 9421
15 Ga0068868_100007113 3300005338 Bacteria 7956
16 Ga0070689_100028733 3300005340 Bacteria 4206
17 Ga0070689_100031903 3300005340 Bacteria 4005
18 Ga0070689_100038616 3300005340 Bacteria 3654
19 Ga0070689_100041818 3300005340 Bacteria 3518
20 Ga0070689_100089372 3300005340 Unclassified 2426
21 Ga0070689_100322044 3300005340 Bacteria 1291
22 Ga0070661_100034806 3300005344 Unclassified 3655
23 Ga0070692_10015026 3300005345 Bacteria 3652
24 Ga0070668_100063837 3300005347 Unclassified 2855
25 Ga0070669_100026708 3300005353 Bacteria 4154
26 Ga0070669_100029396 3300005353 Bacteria 3960
27 Ga0070669_100044486 3300005353 Bacteria 3235
28 Ga0070669_100060035 3300005353 Bacteria 2792
29 Ga0070675_100001612 3300005354 Bacteria 16628
30 Ga0070675_100003478 3300005354 Bacteria 11945
31 Ga0070675_100005427 3300005354 Bacteria 9749
32 Ga0070675_100046062 3300005354 Bacteria 3570
33 Ga0070675_100110009 3300005354 Unclassified 2330
34 Ga0070675_100307849 3300005354 Unclassified 1397
35 Ga0070671_100027502 3300005355 Bacteria 4682
36 Ga0070671_100037838 3300005355 Bacteria 4003
37 Ga0070674_100004755 3300005356 Bacteria 7782
38 Ga0070674_100025694 3300005356 Bacteria 3836
39 Ga0070674_100087752 3300005356 Bacteria 2237
40 Ga0070673_100009185 3300005364 Bacteria 6626
41 Ga0070673_100023160 3300005364 Bacteria 4534
42 Ga0070673_100065932 3300005364 Unclassified 2891
43 Ga0070673_100076887 3300005364 Bacteria 2697
44 Ga0070673_100114441 3300005364 Bacteria 2242
45 Ga0070688_100013257 3300005365 Bacteria 4643
46 Ga0070688_100034544 3300005365 Bacteria 3064
47 Ga0070688_100074576 3300005365 Bacteria 2179
48 Ga0070688_100192693 3300005365 Bacteria 1421
49 Ga0070688_100261607 3300005365 Bacteria 1236
50 Ga0070659_100416198 3300005366 Bacteria 1136
51 Ga0070667_100037498 3300005367 Bacteria 4063
52 Ga0070701_10051679 3300005438 Unclassified 2133
53 Ga0070701_10081558 3300005438 Unclassified 1752
54 Ga0070700_100000849 3300005441 Bacteria 15084
55 Ga0070700_100007730 3300005441 Bacteria 5822
56 Ga0070663_100029889 3300005455 Bacteria 3728
57 Ga0070681_10018281 3300005458 Bacteria 7006
58 Ga0068867_100002764 3300005459 Bacteria 12357
59 Ga0068867_100006052 3300005459 Bacteria 8574
60 Ga0068867_100175053 3300005459 Bacteria 1702
61 Ga0070685_10030383 3300005466 Bacteria 3010
62 Ga0070685_10039212 3300005466 Unclassified 2690
63 Ga0070685_10057798 3300005466 Bacteria 2258
64 Ga0070679_100061425 3300005530 Unclassified 3745
65 Ga0070684_100275040 3300005535 Bacteria 1542
66 Ga0068853_100407671 3300005539 Bacteria 1273
67 Ga0070672_100002771 3300005543 Bacteria 11232
68 Ga0070686_100058602 3300005544 Bacteria 2478
69 Ga0070686_100116507 3300005544 Unclassified 1828
70 Ga0070686_100122709 3300005544 Bacteria 1786
71 Ga0070686_100224792 3300005544 Unclassified 1358
72 Ga0070665_100012834 3300005548 Bacteria 8435
73 Ga0070665_100023367 3300005548 Bacteria 6223
74 Ga0070664_100012244 3300005564 Bacteria 6971
75 Ga0070664_100022639 3300005564 Bacteria 5182
76 Ga0068857_100091823 3300005577 Bacteria 2718
77 Ga0068859_100007262 3300005617 Bacteria 11239
78 Ga0068859_100016123 3300005617 Bacteria 7505
79 Ga0068859_100301021 3300005617 Bacteria 1697
80 Ga0068864_100042817 3300005618 Bacteria 3875
81 Ga0068864_100047477 3300005618 Unclassified 3688
82 Ga0068864_100154187 3300005618 Bacteria 2084
83 Ga0068866_10029839 3300005718 Bacteria 2612
84 Ga0068861_100037677 3300005719 Bacteria 3595
85 Ga0068851_10019852 3300005834 Bacteria 3248
86 Ga0068870_10031937 3300005840 Unclassified 2671
87 Ga0068870_10038614 3300005840 Bacteria 2466
88 Ga0068870_10134824 3300005840 Bacteria 1438
89 Ga0068863_100206150 3300005841 Bacteria 1892
90 Ga0068858_100006116 3300005842 Bacteria 11742
91 Ga0068858_100006997 3300005842 Bacteria 10958
92 Ga0068858_100018192 3300005842 Bacteria 6580
93 Ga0068858_100167925 3300005842 Bacteria 2068
94 Ga0068860_100018916 3300005843 Bacteria 6693
95 Ga0068860_100027410 3300005843 Bacteria 5488
96 Ga0068860_100204795 3300005843 Bacteria 1913
97 Ga0097621_100029352 3300006237 Bacteria 4342
98 Ga0097621_100036328 3300006237 Bacteria 3942
99 Ga0097621_100081289 3300006237 Unclassified 2696
100 Ga0097621_100213301 3300006237 Bacteria 1680
101 Ga0097621_100223359 3300006237 Bacteria 1642
102 Ga0068871_100008906 3300006358 Bacteria 7240
103 Ga0068871_100040434 3300006358 Bacteria 3735
104 Ga0075428_100019246 3300006844 Bacteria 7552
105 Ga0075428_100020772 3300006844 Bacteria 7270
106 Ga0075428_100035708 3300006844 Bacteria 5478
107 Ga0075428_100047642 3300006844 Unclassified 4707
108 Ga0075428_100076285 3300006844 Bacteria 3660
109 Ga0075428_100382696 3300006844 Bacteria 1508
110 Ga0075430_100100251 3300006846 Unclassified 2419
111 Ga0075430_100125661 3300006846 Bacteria 2138
112 Ga0075431_100012940 3300006847 Bacteria 8423
113 Ga0075431_100126466 3300006847 Bacteria 2637
114 Ga0075433_10014543 3300006852 Bacteria 6434
115 Ga0075433_10029676 3300006852 Bacteria 4662
116 Ga0075434_100012375 3300006871 Bacteria 8085
117 Ga0075434_100039461 3300006871 Unclassified 4678
118 Ga0075429_100013737 3300006880 Bacteria 7021
119 Ga0075429_100032901 3300006880 Bacteria 4506
120 Ga0068865_100006963 3300006881 Bacteria 6933
121 Ga0068865_100079048 3300006881 Unclassified 2355
122 Ga0097620_100007262 3300006931 Bacteria 11239
123 Ga0097620_100016120 3300006931 Bacteria 7505
124 Ga0097620_100301005 3300006931 Bacteria 1697
125 Ga0075435_100009561 3300007076 Bacteria 7031
126 Ga0111539_10000232 3300009094 Bacteria 66446
127 Ga0111539_10002378 3300009094 Bacteria 24984
128 Ga0111539_10004059 3300009094 Bacteria 19229
129 Ga0111539_10004849 3300009094 Bacteria 17531
130 Ga0111539_10008114 3300009094 Bacteria 13378
131 Ga0111539_10010023 3300009094 Bacteria 11942
132 Ga0111539_10017648 3300009094 Bacteria 8833
133 Ga0111539_10020569 3300009094 Bacteria 8128
134 Ga0111539_10030972 3300009094 Bacteria 6500
135 Ga0111539_10051337 3300009094 Unclassified 4913
136 Ga0111539_10166663 3300009094 Bacteria 2575
137 Ga0105247_10065207 3300009101 Bacteria 2265
138 Ga0114129_10016095 3300009147 Bacteria 10638
139 Ga0105243_10006123 3300009148 Bacteria 9303
140 Ga0105242_10003397 3300009176 Bacteria 12387
141 Ga0105242_10042641 3300009176 Bacteria 3666
142 Ga0105242_10123969 3300009176 Bacteria 2221
143 Ga0105242_10230005 3300009176 Unclassified 1661
144 Ga0105248_10006922 3300009177 Bacteria 12426
145 Ga0105248_10017278 3300009177 Bacteria 7948
146 Ga0105248_10030246 3300009177 Bacteria 6046
147 Ga0105248_10037360 3300009177 Bacteria 5433
148 Ga0105248_10057986 3300009177 Unclassified 4347
149 Ga0105248_10568278 3300009177 Bacteria 1279
150 Ga0105238_10001003 3300009551 Bacteria 28821
151 Ga0105249_10473813 3300009553 Bacteria 1294
152 Ga0157371_10119781 3300013102 Unclassified 1871
153 Ga0157374_10008656 3300013296 Bacteria 8709
154 Ga0157378_10048434 3300013297 Bacteria 3779
155 Ga0157375_10465858 3300013308 Bacteria 1429
156 Ga0163163_10000009 3300014325 Bacteria 268331
157 Ga0163163_10578577 3300014325 Bacteria 1186
158 Ga0157380_10001029 3300014326 Bacteria 17789
159 Ga0157380_10012226 3300014326 Bacteria 6218
160 Ga0157380_10013600 3300014326 Bacteria 5939
161 Ga0157380_10047324 3300014326 Bacteria 3382
162 Ga0157380_10097196 3300014326 Unclassified 2443
163 Ga0157380_10134950 3300014326 Bacteria 2111
164 Ga0157380_10237913 3300014326 Unclassified 1640
165 Ga0157377_10014179 3300014745 Bacteria 4051
166 Ga0157379_10001547 3300014968 Bacteria 18911
167 Ga0157379_10003617 3300014968 Bacteria 13116
168 Ga0157379_10014359 3300014968 Bacteria 6950
169 Ga0157379_10058348 3300014968 Bacteria 3450
170 Ga0157376_10008085 3300014969 Bacteria 7559
171 Ga0157376_10070275 3300014969 Bacteria 2971
172 Ga0157376_10223873 3300014969 Bacteria 1744
173 Ga0182007_10011015 3300015262 Bacteria 3541
174 Ga0207682_10001437 3300025893 Bacteria 10992
175 Ga0207682_10028777 3300025893 Bacteria 2219
176 Ga0207710_10090501 3300025900 Bacteria 1431
177 Ga0207710_10115574 3300025900 Unclassified 1277
178 Ga0207680_10015490 3300025903 Bacteria 3980
179 Ga0207645_10003443 3300025907 Bacteria 12023
180 Ga0207645_10021848 3300025907 Unclassified 4168
181 Ga0207643_10002289 3300025908 Bacteria 10423
182 Ga0207643_10130566 3300025908 Bacteria 1495
183 Ga0207695_10243196 3300025913 Bacteria 1700
184 Ga0207662_10143139 3300025918 Unclassified 1516
185 Ga0207649_10041272 3300025920 Unclassified 2809
186 Ga0207652_10052210 3300025921 Bacteria 3507
187 Ga0207681_10019032 3300025923 Bacteria 4334
188 Ga0207681_10038784 3300025923 Unclassified 3159
189 Ga0207681_10073835 3300025923 Unclassified 2387
190 Ga0207694_10018714 3300025924 Bacteria 5235
191 Ga0207659_10011686 3300025926 Bacteria 5555
192 Ga0207659_10074496 3300025926 Bacteria 2488
193 Ga0207659_10160471 3300025926 Bacteria 1764
194 Ga0207644_10029743 3300025931 Bacteria 3792
195 Ga0207644_10069027 3300025931 Bacteria 2580
196 Ga0207706_10001124 3300025933 Bacteria 27217
197 Ga0207706_10115158 3300025933 Bacteria 2364
198 Ga0207706_10165726 3300025933 Bacteria 1942
199 Ga0207706_10247286 3300025933 Bacteria 1558
200 Ga0207686_10005914 3300025934 Bacteria 6569
201 Ga0207670_10064204 3300025936 Bacteria 2516
202 Ga0207670_10107523 3300025936 Bacteria 2003
203 Ga0207691_10023789 3300025940 Bacteria 5766
204 Ga0207691_10036919 3300025940 Bacteria 4527
205 Ga0207691_10052599 3300025940 Bacteria 3720
206 Ga0207711_10021977 3300025941 Bacteria 5330
207 Ga0207711_10038465 3300025941 Bacteria 4069
208 Ga0207711_10210805 3300025941 Unclassified 1774
209 Ga0207689_10001919 3300025942 Bacteria 19656
210 Ga0207679_10019970 3300025945 Bacteria 4513
211 Ga0207679_10085105 3300025945 Unclassified 2428
212 Ga0207679_10118355 3300025945 Unclassified 2104
213 Ga0207651_10004054 3300025960 Bacteria 7297
214 Ga0207651_10074089 3300025960 Unclassified 2423
215 Ga0207651_10088522 3300025960 Bacteria 2257
216 Ga0207712_10065984 3300025961 Unclassified 2586
217 Ga0207712_10069682 3300025961 Unclassified 2524
218 Ga0207668_10122700 3300025972 Unclassified 1970
219 Ga0207677_10068234 3300026023 Bacteria 2495
220 Ga0207703_10004012 3300026035 Bacteria 12188
221 Ga0207703_10171155 3300026035 Unclassified 1910
222 Ga0207678_10040158 3300026067 Bacteria 4059
223 Ga0207708_10002235 3300026075 Bacteria 14269
224 Ga0207708_10010149 3300026075 Bacteria 6992
225 Ga0207708_10061071 3300026075 Unclassified 2877
226 Ga0207641_10012884 3300026088 Bacteria 6859
227 Ga0207641_10150271 3300026088 Bacteria 2109
228 Ga0207641_10166033 3300026088 Unclassified 2011
229 Ga0207641_10204047 3300026088 Bacteria 1825
230 Ga0207648_10015442 3300026089 Bacteria 7023
231 Ga0207648_10017416 3300026089 Bacteria 6539
232 Ga0207648_10042802 3300026089 Bacteria 3976
233 Ga0207648_10288836 3300026089 Unclassified 1468
234 Ga0207648_10327497 3300026089 Unclassified 1377
235 Ga0207676_10146919 3300026095 Bacteria 2026
236 Ga0207675_100006069 3300026118 Bacteria 11496
237 Ga0207675_100125504 3300026118 Unclassified 2431
238 Ga0207683_10005941 3300026121 Bacteria 10464
239 Ga0207428_10001131 3300027907 Bacteria 28947
240 Ga0207428_10002849 3300027907 Bacteria 17164
241 Ga0207428_10008973 3300027907 Bacteria 9007
242 Ga0268266_10005055 3300028379 Bacteria 12449
243 Ga0268265_10119370 3300028380 Unclassified 2169
244 Ga0268264_10021186 3300028381 Bacteria 5310
245 Ga0307409_100208875 3300031995 Unclassified 1753
246 Ga0307416_100067577 3300032002 Bacteria 2949
247 Ga0307411_10095306 3300032005 Bacteria 2089
248 Ga0307415_100028990 3300032126 Bacteria 3531
249 Ga0439440_0030015 3300042993 Bacteria 1278
250 Ga0451576_0250337 3300045051 Bacteria 1851
251 Ga0495638_0137599 3300046460 Bacteria 1429
252 Ga0495594_0013974 3300046499 Bacteria 4203
253 Ga0495598_0023535 3300046537 Bacteria 1660
254 Ga0495658_0030124 3300046683 Bacteria 2944
255 Ga0495674_0239409 3300047319 Unclassified 1496
256 Ga0495672_0047463 3300047320 Unclassified 2554
257 Ga0496100_0141969 3300048903 Bacteria 1703
258 Ga0496101_0002362 3300048904 Bacteria 11578
259 Ga0496102_0043416 3300048905 Bacteria 4077
260 Ga0496102_0204149 3300048905 Bacteria 1863
261 Ga0496102_0235671 3300048905 Bacteria 1726
262 Ga0496104_0090943 3300048907 Bacteria 2917
263 Ga0496104_0284518 3300048907 Bacteria 1566
264 Ga0496105_0171021 3300048908 Bacteria 1781
265 Ga0496106_0133780 3300048909 Bacteria 1946
266 Ga0496112_0022883 3300048915 Bacteria 5962
267 Ga0496112_0041779 3300048915 Unclassified 4487
268 Ga0496112_0065082 3300048915 Bacteria 3598
269 Ga0496114_0000775 3300048917 Bacteria 23864
270 Ga0496115_0055019 3300048918 Bacteria 3196
271 Ga0496115_0193593 3300048918 Bacteria 1680
272 Ga0501031_0013578 3300049568 Bacteria 5307
273 Ga0501033_0014068 3300049570 Bacteria 6085
274 Ga0501036_0049692 3300049572 Bacteria 3551
275 Ga0501036_0396745 3300049572 Bacteria 1151
276 Ga0501037_0031310 3300049573 Bacteria 3927
277 Ga0501039_0209817 3300049575 Bacteria 1532
278 Ga0501039_0226305 3300049575 Bacteria 1470
279 Ga0501040_0074636 3300049576 Bacteria 2344
280 Ga0501041_0072406 3300049577 Bacteria 2117
281 Ga0501042_0009272 3300049578 Bacteria 6550
282 Ga0501043_0034964 3300049579 Bacteria 3952
283 Ga0501046_0012219 3300049580 Bacteria 7316
284 Ga0501047_0103919 3300049581 Bacteria 2721
285 Ga0501048_0064324 3300049582 Bacteria 2594
286 Ga0501067_0014218 3300049583 Bacteria 4408
287 Ga0501068_0139843 3300049584 Bacteria 1517
288 Ga0501071_0044586 3300049587 Bacteria 3181
289 Ga0501071_0057740 3300049587 Bacteria 2805
290 Ga0501073_0032030 3300049589 Bacteria 3750
291 Ga0501074_0064382 3300049590 Bacteria 2639
292 Ga0501075_0018159 3300049591 Bacteria 5087
293 Ga0501075_0149212 3300049591 Bacteria 1782
294 Ga0501076_0020786 3300049592 Bacteria 5027
295 Ga0501076_0107096 3300049592 Unclassified 2257
296 Ga0501079_0020347 3300049741 Bacteria 5071
297 Ga0501079_0036706 3300049741 Bacteria 3775
298 Ga0501083_0177975 3300049744 Bacteria 1389
299 Ga0501044_0167369 3300049823 Bacteria 2171
300 Ga0501045_0044295 3300049824 Bacteria 3241
301 nmdc:mga09592_240211_c1 3300050508 Bacteria 1570
302 nmdc:mga09592_76363_c1 3300050508 Unclassified 2849
303 nmdc:mga0qj67_153875_c1 3300050509 Bacteria 1866
304 nmdc:mga0qj67_313228_c1 3300050509 Unclassified 1271
305 nmdc:mga06r32_69941_c1 3300050510 Bacteria 3393
306 nmdc:mga08y16_14822_c1 3300050511 Bacteria 8197
307 nmdc:mga08y16_180011_c1 3300050511 Bacteria 2195
308 nmdc:mga08y16_200419_c1 3300050511 Unclassified 2068
309 nmdc:mga08y16_352621_c1 3300050511 Bacteria 1511
310 nmdc:mga08y16_425_c1 3300050511 Bacteria 38895
311 nmdc:mga08y16_4299_c1 3300050511 Bacteria 14875
312 nmdc:mga08y16_43023_c1 3300050511 Bacteria 4731
313 nmdc:mga08y16_46401_c1 3300050511 Bacteria 4549
314 nmdc:mga08y16_69912_c1 3300050511 Bacteria 3660
315 nmdc:mga0n895_30581_c1 3300050512 Bacteria 5148
316 nmdc:mga0n895_6868_c1 3300050512 Bacteria 9720
317 nmdc:mga0rr50_226974_c1 3300050513 Bacteria 1544
318 nmdc:mga0rr50_403738_c1 3300050513 Unclassified 1154
319 nmdc:mga0a205_163978_c1 3300050515 Unclassified 2118
320 nmdc:mga0a205_1735_c1 3300050515 Bacteria 18847
321 Ga0495601_0014052 3300053077 Bacteria 4823
322 Ga0495612_0058149 3300053078 Bacteria 1598
323 Ga0495595_0091876 3300053084 Unclassified 1457
324 Ga0495619_0009260 3300053085 Bacteria 6221
325 Ga0500641_0001989 3300053096 Bacteria 7252
326 Ga0501084_0056319 3300054114 Bacteria 3289
327 Ga0501084_0068837 3300054114 Bacteria 2963
328 Ga0501082_0116968 3300060353 Bacteria 2309
329 Ga0070672_100026785
330 Ga0065707_10125740
331 Ga0070676_10015325
332 Ga0070690_100030103
333 Ga0070690_100098058
334 Ga0070690_100109270
335 Ga0070670_100000749
336 Ga0070670_100293964
337 Ga0070677_10039487
338 Ga0068869_100010881
339 Ga0068869_100065222
340 Ga0070666_10032835
341 Ga0070666_10062976
342 Ga0068868_100004873
343 Ga0068868_100007113
344 Ga0070689_100028733
345 Ga0070689_100031903
346 Ga0070689_100038616
347 Ga0070689_100041818
348 Ga0070689_100089372
349 Ga0070689_100322044
350 Ga0070661_100034806
351 Ga0070692_10015026
352 Ga0070668_100063837
353 Ga0070669_100026708
354 Ga0070669_100029396
355 Ga0070669_100044486
356 Ga0070669_100060035
357 Ga0070675_100001612
358 Ga0070675_100003478
359 Ga0070675_100005427
360 Ga0070675_100046062
361 Ga0070675_100110009
362 Ga0070675_100307849
363 Ga0070671_100027502
364 Ga0070671_100037838
365 Ga0070674_100004755
366 Ga0070674_100025694
367 Ga0070674_100087752
368 Ga0070673_100009185
369 Ga0070673_100023160
370 Ga0070673_100065932
371 Ga0070673_100076887
372 Ga0070673_100114441
373 Ga0070688_100013257
374 Ga0070688_100034544
375 Ga0070688_100074576
376 Ga0070688_100192693
377 Ga0070688_100261607
378 Ga0070659_100416198
379 Ga0070667_100037498
380 Ga0070701_10051679
381 Ga0070701_10081558
382 Ga0070700_100000849
383 Ga0070700_100007730
384 Ga0070663_100029889
385 Ga0070681_10018281
386 Ga0068867_100002764
387 Ga0068867_100006052
388 Ga0068867_100175053
389 Ga0070685_10030383
390 Ga0070685_10039212
391 Ga0070685_10057798
392 Ga0070679_100061425
393 Ga0070684_100275040
394 Ga0068853_100407671
395 Ga0070672_100002771
396 Ga0070686_100058602
397 Ga0070686_100116507
398 Ga0070686_100122709
399 Ga0070686_100224792
400 Ga0070665_100012834
401 Ga0070665_100023367
402 Ga0070664_100012244
403 Ga0070664_100022639
404 Ga0068857_100091823
405 Ga0068859_100007262
406 Ga0068859_100016123
407 Ga0068859_100301021
408 Ga0068864_100042817
409 Ga0068864_100047477
410 Ga0068864_100154187
411 Ga0068866_10029839
412 Ga0068861_100037677
413 Ga0068851_10019852
414 Ga0068870_10031937
415 Ga0068870_10038614
416 Ga0068870_10134824
417 Ga0068863_100206150
418 Ga0068858_100006116
419 Ga0068858_100006997
420 Ga0068858_100018192
421 Ga0068858_100167925
422 Ga0068860_100018916
423 Ga0068860_100027410
424 Ga0068860_100204795
425 Ga0097621_100029352
426 Ga0097621_100036328
427 Ga0097621_100081289
428 Ga0097621_100213301
429 Ga0097621_100223359
430 Ga0068871_100008906
431 Ga0068871_100040434
432 Ga0075428_100019246
433 Ga0075428_100020772
434 Ga0075428_100035708
435 Ga0075428_100047642
436 Ga0075428_100076285
437 Ga0075428_100382696
438 Ga0075430_100100251
439 Ga0075430_100125661
440 Ga0075431_100012940
441 Ga0075431_100126466
442 Ga0075433_10014543
443 Ga0075433_10029676
444 Ga0075434_100012375
445 Ga0075434_100039461
446 Ga0075429_100013737
447 Ga0075429_100032901
448 Ga0068865_100006963
449 Ga0068865_100079048
450 Ga0097620_100007262
451 Ga0097620_100016120
452 Ga0097620_100301005
453 Ga0075435_100009561
454 Ga0111539_10000232
455 Ga0111539_10002378
456 Ga0111539_10004059
457 Ga0111539_10004849
458 Ga0111539_10008114
459 Ga0111539_10010023
460 Ga0111539_10017648
461 Ga0111539_10020569
462 Ga0111539_10030972
463 Ga0111539_10051337
464 Ga0111539_10166663
465 Ga0105247_10065207
466 Ga0114129_10016095
467 Ga0105243_10006123
468 Ga0105242_10003397
469 Ga0105242_10042641
470 Ga0105242_10123969
471 Ga0105242_10230005
472 Ga0105248_10006922
473 Ga0105248_10017278
474 Ga0105248_10030246
475 Ga0105248_10037360
476 Ga0105248_10057986
477 Ga0105248_10568278
478 Ga0105238_10001003
479 Ga0105249_10473813
480 Ga0157371_10119781
481 Ga0157374_10008656
482 Ga0157378_10048434
483 Ga0157375_10465858
484 Ga0163163_10000009
485 Ga0163163_10578577
486 Ga0157380_10001029
487 Ga0157380_10012226
488 Ga0157380_10013600
489 Ga0157380_10047324
490 Ga0157380_10097196
491 Ga0157380_10134950
492 Ga0157380_10237913
493 Ga0157377_10014179
494 Ga0157379_10001547
495 Ga0157379_10003617
496 Ga0157379_10014359
497 Ga0157379_10058348
498 Ga0157376_10008085
499 Ga0157376_10070275
500 Ga0157376_10223873
501 Ga0182007_10011015
502 Ga0207682_10001437
503 Ga0207682_10028777
504 Ga0207710_10090501
505 Ga0207710_10115574
506 Ga0207680_10015490
507 Ga0207645_10003443
508 Ga0207645_10021848
509 Ga0207643_10002289
510 Ga0207643_10130566
511 Ga0207695_10243196
512 Ga0207662_10143139
513 Ga0207649_10041272
514 Ga0207652_10052210
515 Ga0207681_10019032
516 Ga0207681_10038784
517 Ga0207681_10073835
518 Ga0207694_10018714
519 Ga0207659_10011686
520 Ga0207659_10074496
521 Ga0207659_10160471
522 Ga0207644_10029743
523 Ga0207644_10069027
524 Ga0207706_10001124
525 Ga0207706_10115158
526 Ga0207706_10165726
527 Ga0207706_10247286
528 Ga0207686_10005914
529 Ga0207670_10064204
530 Ga0207670_10107523
531 Ga0207691_10023789
532 Ga0207691_10036919
533 Ga0207691_10052599
534 Ga0207711_10021977
535 Ga0207711_10038465
536 Ga0207711_10210805
537 Ga0207689_10001919
538 Ga0207679_10019970
539 Ga0207679_10085105
540 Ga0207679_10118355
541 Ga0207651_10004054
542 Ga0207651_10074089
543 Ga0207651_10088522
544 Ga0207712_10065984
545 Ga0207712_10069682
546 Ga0207668_10122700
547 Ga0207677_10068234
548 Ga0207703_10004012
549 Ga0207703_10171155
550 Ga0207678_10040158
551 Ga0207708_10002235
552 Ga0207708_10010149
553 Ga0207708_10061071
554 Ga0207641_10012884
555 Ga0207641_10150271
556 Ga0207641_10166033
557 Ga0207641_10204047
558 Ga0207648_10015442
559 Ga0207648_10017416
560 Ga0207648_10042802
561 Ga0207648_10288836
562 Ga0207648_10327497
563 Ga0207676_10146919
564 Ga0207675_100006069
565 Ga0207675_100125504
566 Ga0207683_10005941
567 Ga0207428_10001131
568 Ga0207428_10002849
569 Ga0207428_10008973
570 Ga0268266_10005055
571 Ga0268265_10119370
572 Ga0268264_10021186
573 Ga0307409_100208875
574 Ga0307416_100067577
575 Ga0307411_10095306
576 Ga0307415_100028990
577 Ga0439440_0030015
578 Ga0451576_0250337
579 Ga0495638_0137599
580 Ga0495594_0013974
581 Ga0495598_0023535
582 Ga0495658_0030124
583 Ga0495674_0239409
584 Ga0495672_0047463
585 Ga0496100_0141969
586 Ga0496101_0002362
587 Ga0496102_0043416
588 Ga0496102_0204149
589 Ga0496102_0235671
590 Ga0496104_0090943
591 Ga0496104_0284518
592 Ga0496105_0171021
593 Ga0496106_0133780
594 Ga0496112_0022883
595 Ga0496112_0041779
596 Ga0496112_0065082
597 Ga0496114_0000775
598 Ga0496115_0055019
599 Ga0496115_0193593
600 Ga0501031_0013578
601 Ga0501033_0014068
602 Ga0501036_0049692
603 Ga0501036_0396745
604 Ga0501037_0031310
605 Ga0501039_0209817
606 Ga0501039_0226305
607 Ga0501040_0074636
608 Ga0501041_0072406
609 Ga0501042_0009272
610 Ga0501043_0034964
611 Ga0501046_0012219
612 Ga0501047_0103919
613 Ga0501048_0064324
614 Ga0501067_0014218
615 Ga0501068_0139843
616 Ga0501071_0044586
617 Ga0501071_0057740
618 Ga0501073_0032030
619 Ga0501074_0064382
620 Ga0501075_0018159
621 Ga0501075_0149212
622 Ga0501076_0020786
623 Ga0501076_0107096
624 Ga0501079_0020347
625 Ga0501079_0036706
626 Ga0501083_0177975
627 Ga0501044_0167369
628 Ga0501045_0044295
629 nmdc:mga09592_240211_c1
630 nmdc:mga09592_76363_c1
631 nmdc:mga0qj67_153875_c1
632 nmdc:mga0qj67_313228_c1
633 nmdc:mga06r32_69941_c1
634 nmdc:mga08y16_14822_c1
635 nmdc:mga08y16_180011_c1
636 nmdc:mga08y16_200419_c1
637 nmdc:mga08y16_352621_c1
638 nmdc:mga08y16_425_c1
639 nmdc:mga08y16_4299_c1
640 nmdc:mga08y16_43023_c1
641 nmdc:mga08y16_46401_c1
642 nmdc:mga08y16_69912_c1
643 nmdc:mga0n895_30581_c1
644 nmdc:mga0n895_6868_c1
645 nmdc:mga0rr50_226974_c1
646 nmdc:mga0rr50_403738_c1
647 nmdc:mga0a205_163978_c1
648 nmdc:mga0a205_1735_c1
649 Ga0495601_0014052
650 Ga0495612_0058149
651 Ga0495595_0091876
652 Ga0495619_0009260
653 Ga0500641_0001989
654 Ga0501084_0056319
655 Ga0501084_0068837
656 Ga0501082_0116968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3au6-assembly1.cif.gz_A dna polymerase x from thermus thermophilus hb8 ternary complex with primer/template dna and ddgtp 0.8818 110 355
2w9m-assembly2.cif.gz_B structure of family x dna polymerase from deinococcus radiodurans 0.864 113 364
2w9m-assembly1.cif.gz_A structure of family x dna polymerase from deinococcus radiodurans 0.8639 113 364
1m65-assembly1.cif.gz_A ycdx protein 0.8315 135 362
1pb0-assembly1.cif.gz_A ycdx protein in autoinhibited state 0.8202 133 362
ID Description Score Start End Superfamily
af_P96221_92_335_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9498 130 355 3.20.20.140
3au6A05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9372 125 355 3.20.20.140
af_Q2FZD4_322_570_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9355 126 359 3.20.20.140
2w9mA05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9053 128 364 3.20.20.140
3au6A05 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8888 125 355 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A317HNK0-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9732 87 355 GO:0005829
GO:0008270
GO:0042578
AF-A0A435EA64-F1-model_v4 deleted 0.9674 134 332
AF-V7FBI7-F1-model_v4 Histidinol phosphatase 0.9646 183 355 GO:0005829
GO:0008270
GO:0042578
GO:0071978
AF-A0A2M8KD67-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.964 125 356 GO:0005829
GO:0008270
GO:0042578
AF-A0A660XEW2-F1-model_v4 deleted 0.9634 128 357

Map