F409128

General Info

Members Datasets Scaffolds Average Seq Length
328 190 328 165

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_11024051|Ga0070710_110240511
Length 183
Sequence MRSSRSSLMRLFLTSIFCLFSMKALACPTLLDRTFESIHEKPQSLCEYSGKVLLVVNTASQCGYTPQYDGLEALYRKYKARGLVVLGFPMNDFGGQEPGSNKEISAFCVNQYAIDFPMFAKTDLKANPLYADLRKATGESPKWNFHKYLVDRSGNKVQSFGTKVEPNDAKLVGAIERLLEEAK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
87 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
88 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
93 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
103 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
104 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
105 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
169 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.39
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10038403 3300003203 Bacteria 1716
2 Ga0065715_10528475 3300005293 Bacteria 757
3 Ga0070683_100168247 3300005329 Bacteria 2080
4 Ga0070683_101044020 3300005329 Bacteria 785
5 Ga0070690_100035298 3300005330 Bacteria 3137
6 Ga0070690_101231726 3300005330 Bacteria 598
7 Ga0070680_100246676 3300005336 Bacteria 1510
8 Ga0070680_101407890 3300005336 Bacteria 604
9 Ga0070689_100219240 3300005340 Bacteria 1560
10 Ga0070659_101120201 3300005366 Bacteria 694
11 Ga0070713_100170059 3300005436 Bacteria 1952
12 Ga0070713_100345846 3300005436 Bacteria 1379
13 Ga0070710_10132106 3300005437 Bacteria 1523
14 Ga0070710_11024051 3300005437 Bacteria 603
15 Ga0070701_10144287 3300005438 Bacteria 1365
16 Ga0070701_10321304 3300005438 Bacteria 958
17 Ga0070711_100880712 3300005439 Bacteria 763
18 Ga0070705_100003129 3300005440 Bacteria 8135
19 Ga0070694_100012481 3300005444 Bacteria 5283
20 Ga0070694_100015442 3300005444 Bacteria 4798
21 Ga0070694_100035582 3300005444 Bacteria 3293
22 Ga0070694_100069267 3300005444 Bacteria 2426
23 Ga0070694_100168716 3300005444 Bacteria 1611
24 Ga0070694_100251621 3300005444 Bacteria 1337
25 Ga0070708_100608513 3300005445 Bacteria 1030
26 Ga0070681_10000379 3300005458 Bacteria 35882
27 Ga0070685_10635675 3300005466 Bacteria 772
28 Ga0070706_100103552 3300005467 Bacteria 2646
29 Ga0070706_100674784 3300005467 Bacteria 959
30 Ga0070679_100108440 3300005530 Bacteria 2763
31 Ga0070684_100054635 3300005535 Bacteria 3480
32 Ga0070684_100928604 3300005535 Bacteria 816
33 Ga0070697_100121454 3300005536 Bacteria 2185
34 Ga0070697_100410375 3300005536 Bacteria 1176
35 Ga0070686_100016927 3300005544 Bacteria 4249
36 Ga0070686_100153283 3300005544 Bacteria 1616
37 Ga0070695_100014459 3300005545 Bacteria 4758
38 Ga0070695_100083879 3300005545 Bacteria 2112
39 Ga0070695_100197380 3300005545 Bacteria 1436
40 Ga0070695_100235475 3300005545 Bacteria 1326
41 Ga0070696_100002413 3300005546 Bacteria 12376
42 Ga0070696_100010244 3300005546 Bacteria 6274
43 Ga0070696_100155401 3300005546 Bacteria 1682
44 Ga0070696_100244830 3300005546 Bacteria 1354
45 Ga0070696_100307667 3300005546 Bacteria 1216
46 Ga0070696_100848093 3300005546 Bacteria 755
47 Ga0070704_100040286 3300005549 Bacteria 3215
48 Ga0070704_100253586 3300005549 Bacteria 1446
49 Ga0070704_100426620 3300005549 Bacteria 1137
50 Ga0070704_100791454 3300005549 Bacteria 847
51 Ga0070704_101251909 3300005549 Bacteria 678
52 Ga0070664_100517490 3300005564 Bacteria 1101
53 Ga0068854_101293955 3300005578 Bacteria 656
54 Ga0070702_100062122 3300005615 Bacteria 2177
55 Ga0070702_100722610 3300005615 Bacteria 762
56 Ga0068864_100061424 3300005618 Bacteria 3255
57 Ga0068864_100340577 3300005618 Bacteria 1413
58 Ga0068860_100528872 3300005843 Bacteria 1179
59 Ga0081539_10001342 3300005985 Bacteria 42880
60 Ga0070717_10479449 3300006028 Bacteria 1123
61 Ga0075432_10121192 3300006058 Bacteria 983
62 Ga0070715_10014457 3300006163 Bacteria 2925
63 Ga0070715_10197809 3300006163 Bacteria 1019
64 Ga0070716_100165967 3300006173 Bacteria 1436
65 Ga0097621_100002299 3300006237 Bacteria 13086
66 Ga0068871_100016322 3300006358 Bacteria 5590
67 Ga0075428_100866944 3300006844 Bacteria 958
68 Ga0075430_100001765 3300006846 Bacteria 17680
69 Ga0075430_100018295 3300006846 Bacteria 5965
70 Ga0075430_100239997 3300006846 Bacteria 1502
71 Ga0075431_100020872 3300006847 Bacteria 6695
72 Ga0075431_100778691 3300006847 Bacteria 931
73 Ga0075433_10009244 3300006852 Bacteria 7878
74 Ga0075433_10168581 3300006852 Bacteria 1949
75 Ga0075433_10419681 3300006852 Bacteria 1180
76 Ga0075434_100001838 3300006871 Bacteria 18324
77 Ga0075434_100006451 3300006871 Bacteria 10751
78 Ga0075434_100716890 3300006871 Bacteria 1017
79 Ga0075429_100517332 3300006880 Bacteria 1046
80 Ga0068865_100762560 3300006881 Bacteria 832
81 Ga0075436_100000122 3300006914 Bacteria 46200
82 Ga0075436_100002199 3300006914 Bacteria 13460
83 Ga0075436_100008716 3300006914 Bacteria 6936
84 Ga0075436_100048398 3300006914 Bacteria 2934
85 Ga0075436_100257270 3300006914 Bacteria 1245
86 Ga0075435_100012027 3300007076 Bacteria 6394
87 Ga0075435_100014553 3300007076 Bacteria 5885
88 Ga0075435_100214059 3300007076 Bacteria 1635
89 Ga0075435_100242365 3300007076 Bacteria 1533
90 Ga0075435_100277334 3300007076 Bacteria 1431
91 Ga0075435_100749289 3300007076 Bacteria 850
92 Ga0105251_10233887 3300009011 Bacteria 828
93 Ga0111539_10022976 3300009094 Bacteria 7657
94 Ga0111539_12220270 3300009094 Bacteria 637
95 Ga0105248_10240579 3300009177 Bacteria 2038
96 Ga0157372_10520988 3300013307 Bacteria 1386
97 Ga0163163_10969088 3300014325 Bacteria 914
98 Ga0157380_10159627 3300014326 Bacteria 1958
99 Ga0157379_10861414 3300014968 Bacteria 858
100 Ga0157376_10013922 3300014969 Bacteria 6015
101 Ga0207682_10075786 3300025893 Bacteria 1433
102 Ga0207692_10044239 3300025898 Bacteria 2221
103 Ga0207685_10052694 3300025905 Bacteria 1577
104 Ga0207685_10143047 3300025905 Bacteria 1074
105 Ga0207699_10581507 3300025906 Bacteria 814
106 Ga0207684_10067779 3300025910 Bacteria 3033
107 Ga0207707_10001563 3300025912 Bacteria 21074
108 Ga0207660_10193428 3300025917 Bacteria 1585
109 Ga0207660_10334596 3300025917 Bacteria 1211
110 Ga0207652_10064598 3300025921 Bacteria 3167
111 Ga0207704_10621164 3300025938 Bacteria 887
112 Ga0207665_10027144 3300025939 Bacteria 3783
113 Ga0207665_11127864 3300025939 Bacteria 625
114 Ga0207711_10193013 3300025941 Bacteria 1856
115 Ga0207689_10033351 3300025942 Bacteria 4279
116 Ga0207661_10323769 3300025944 Bacteria 1386
117 Ga0207661_10508781 3300025944 Bacteria 1101
118 Ga0207679_10408603 3300025945 Bacteria 1196
119 Ga0207703_10047675 3300026035 Bacteria 3456
120 Ga0207708_10209919 3300026075 Bacteria 1556
121 Ga0207702_10138169 3300026078 Bacteria 2201
122 Ga0207702_10432600 3300026078 Bacteria 1274
123 Ga0209969_1001170 3300027360 Bacteria 3603
124 Ga0209969_1021319 3300027360 Bacteria 967
125 Ga0209967_1003318 3300027364 Bacteria 2115
126 Ga0209981_1000901 3300027378 Bacteria 3724
127 Ga0209996_1002861 3300027395 Bacteria 2149
128 Ga0209996_1014489 3300027395 Bacteria 1071
129 Ga0210000_1000567 3300027462 Bacteria 5073
130 Ga0210000_1022092 3300027462 Bacteria 975
131 Ga0209995_1006530 3300027471 Bacteria 1874
132 Ga0209968_1002093 3300027526 Bacteria 3031
133 Ga0209968_1010360 3300027526 Bacteria 1433
134 Ga0209968_1028058 3300027526 Bacteria 934
135 Ga0209999_1002962 3300027543 Bacteria 3014
136 Ga0209999_1056999 3300027543 Bacteria 741
137 Ga0209999_1059669 3300027543 Bacteria 725
138 Ga0209983_1017851 3300027665 Bacteria 1471
139 Ga0209966_1055245 3300027695 Bacteria 850
140 Ga0207428_10055897 3300027907 Bacteria 3136
141 Ga0307408_100039354 3300031548 Bacteria 3342
142 Ga0307408_100397691 3300031548 Bacteria 1182
143 Ga0307405_10490915 3300031731 Bacteria 982
144 Ga0307405_10942481 3300031731 Bacteria 733
145 Ga0307416_100044827 3300032002 Bacteria 3476
146 Ga0307416_100620098 3300032002 Bacteria 1163
147 Ga0307411_10089321 3300032005 Bacteria 2146
148 Ga0373958_0041757 3300034819 Bacteria 940
149 Ga0373929_0006037 3300035085 Bacteria 2188
150 Ga0373932_0073459 3300035112 Bacteria 1066
151 Ga0373953_0015150 3300035117 Bacteria 2787
152 Ga0373953_0034591 3300035117 Bacteria 1981
153 Ga0373954_0000063 3300035118 Bacteria 37576
154 Ga0373954_0056343 3300035118 Bacteria 1850
155 Ga0373956_0037154 3300035119 Bacteria 2152
156 Ga0373956_0343909 3300035119 Bacteria 711
157 Ga0373960_0008626 3300035121 Bacteria 2448
158 Ga0373960_0012805 3300035121 Bacteria 2090
159 Ga0373961_0028050 3300035241 Bacteria 1550
160 Ga0373924_0146910 3300035410 Bacteria 1030
161 Ga0373935_0258911 3300035692 Bacteria 1220
162 Ga0373935_0346275 3300035692 Bacteria 1059
163 Ga0373933_0014962 3300035724 Bacteria 4320
164 Ga0373933_0035588 3300035724 Bacteria 2909
165 Ga0373933_0076242 3300035724 Bacteria 2048
166 Ga0373947_0296581 3300035725 Bacteria 1077
167 Ga0373937_0000230 3300036401 Bacteria 54635
168 Ga0373937_0012638 3300036401 Bacteria 7432
169 Ga0373937_0436437 3300036401 Bacteria 1243
170 Ga0373925_0622046 3300037068 Bacteria 890
171 Ga0451807_1452996 3300041486 Bacteria 1064
172 Ga0451853_3338169 3300041512 Bacteria 832
173 Ga0439433_0101219 3300041999 Bacteria 715
174 Ga0439441_004473 3300042001 Bacteria 2121
175 Ga0439441_008092 3300042001 Bacteria 1710
176 Ga0439443_002169 3300042003 Bacteria 2309
177 Ga0450920_086716 3300042122 Bacteria 644
178 Ga0439434_0000120 3300042435 Bacteria 20620
179 Ga0439435_0000211 3300042436 Bacteria 8212
180 Ga0439435_0008946 3300042436 Bacteria 2335
181 Ga0439444_0000862 3300042437 Bacteria 3678
182 Ga0439460_0000963 3300042461 Bacteria 6611
183 Ga0439460_0122534 3300042461 Bacteria 851
184 Ga0450893_0013008 3300042532 Bacteria 1385
185 Ga0451577_0334049 3300042876 Bacteria 1374
186 Ga0466963_0320272 3300044694 Bacteria 1091
187 Ga0466971_0398289 3300044719 Bacteria 671
188 Ga0466960_0304594 3300044901 Bacteria 899
189 Ga0451576_0001051 3300045051 Bacteria 50831
190 Ga0451576_0225148 3300045051 Bacteria 1958
191 Ga0451576_0424227 3300045051 Bacteria 1396
192 Ga0451576_1038523 3300045051 Bacteria 859
193 Ga0466967_0065504 3300045976 Bacteria 3234
194 Ga0495592_0007433 3300046454 Bacteria 8209
195 Ga0495592_0170820 3300046454 Bacteria 1489
196 Ga0495629_0043915 3300046459 Bacteria 3138
197 Ga0495651_0177675 3300046462 Bacteria 1510
198 Ga0495580_1044562 3300046472 Bacteria 519
199 Ga0495662_0016016 3300046476 Bacteria 3638
200 Ga0495584_0341263 3300046491 Bacteria 761
201 Ga0495608_0141674 3300046511 Bacteria 1534
202 Ga0495608_0199620 3300046511 Bacteria 1261
203 Ga0495608_0354688 3300046511 Bacteria 902
204 Ga0495628_0090824 3300046516 Bacteria 2364
205 Ga0495628_0135679 3300046516 Bacteria 1881
206 Ga0495630_0006978 3300046517 Bacteria 8053
207 Ga0495630_0649476 3300046517 Bacteria 808
208 Ga0495644_0183245 3300046523 Bacteria 805
209 Ga0495642_0017889 3300046528 Bacteria 2770
210 Ga0495640_0038376 3300046533 Bacteria 3369
211 Ga0495586_0004274 3300046535 Bacteria 7636
212 Ga0495587_0337230 3300046536 Bacteria 841
213 Ga0495598_0007606 3300046537 Bacteria 2492
214 Ga0495621_0021582 3300046539 Bacteria 2124
215 Ga0495667_0223996 3300046559 Bacteria 1200
216 Ga0495667_0242047 3300046559 Bacteria 1149
217 Ga0495667_0342515 3300046559 Bacteria 945
218 Ga0495656_0020772 3300046615 Bacteria 2550
219 Ga0495656_0216725 3300046615 Bacteria 956
220 Ga0495634_0005778 3300046642 Bacteria 9450
221 Ga0495634_0311919 3300046642 Bacteria 949
222 Ga0495635_0179023 3300046663 Bacteria 1441
223 Ga0495657_0441226 3300046675 Bacteria 763
224 Ga0495658_0098841 3300046683 Bacteria 1739
225 Ga0495613_0472673 3300046689 Bacteria 847
226 Ga0495600_0231359 3300046809 Bacteria 1180
227 Ga0495581_0164348 3300047315 Bacteria 1298
228 Ga0495604_0144443 3300047317 Bacteria 1697
229 Ga0495604_0173190 3300047317 Bacteria 1516
230 Ga0495674_0414648 3300047319 Bacteria 1086
231 Ga0495680_0090873 3300047322 Bacteria 2289
232 Ga0495680_0182129 3300047322 Bacteria 1516
233 Ga0495684_0203721 3300047471 Bacteria 1458
234 Ga0495684_0784683 3300047471 Bacteria 624
235 Ga0495593_0140800 3300047673 Bacteria 1222
236 Ga0495593_0322910 3300047673 Bacteria 772
237 Ga0501297_070746 3300049520 Bacteria 550
238 Ga0501298_054496 3300049521 Bacteria 835
239 Ga0501299_028339 3300049522 Bacteria 1067
240 Ga0501031_0261378 3300049568 Bacteria 1125
241 Ga0501031_0360884 3300049568 Bacteria 940
242 Ga0501036_0030917 3300049572 Bacteria 4525
243 Ga0501037_0222242 3300049573 Bacteria 1328
244 Ga0501038_0102931 3300049574 Bacteria 2375
245 Ga0501039_0040580 3300049575 Bacteria 3593
246 Ga0501039_0316739 3300049575 Bacteria 1226
247 Ga0501039_0359368 3300049575 Bacteria 1144
248 Ga0501040_0001293 3300049576 Bacteria 15945
249 Ga0501040_0217761 3300049576 Bacteria 1358
250 Ga0501040_0252307 3300049576 Bacteria 1258
251 Ga0501040_0299572 3300049576 Bacteria 1149
252 Ga0501040_1152652 3300049576 Bacteria 562
253 Ga0501041_0015688 3300049577 Bacteria 4500
254 Ga0501041_0121644 3300049577 Bacteria 1622
255 Ga0501042_0139453 3300049578 Bacteria 1748
256 Ga0501043_0128101 3300049579 Bacteria 1990
257 Ga0501043_0172294 3300049579 Bacteria 1688
258 Ga0501046_0101903 3300049580 Bacteria 2201
259 Ga0501046_0163913 3300049580 Bacteria 1670
260 Ga0501048_0012986 3300049582 Bacteria 6186
261 Ga0501048_0055878 3300049582 Bacteria 2802
262 Ga0501067_0038981 3300049583 Bacteria 2638
263 Ga0501071_0152125 3300049587 Bacteria 1726
264 Ga0501071_0287283 3300049587 Bacteria 1245
265 Ga0501072_0034270 3300049588 Bacteria 3978
266 Ga0501072_0038853 3300049588 Bacteria 3736
267 Ga0501072_0104339 3300049588 Bacteria 2254
268 Ga0501074_0234778 3300049590 Bacteria 1305
269 Ga0501075_0007604 3300049591 Bacteria 7519
270 Ga0501075_0217431 3300049591 Bacteria 1457
271 Ga0501075_0646249 3300049591 Bacteria 806
272 Ga0501076_0004972 3300049592 Bacteria 9519
273 Ga0501076_0239306 3300049592 Bacteria 1485
274 Ga0501077_0099627 3300049593 Bacteria 1842
275 Ga0501077_0584170 3300049593 Bacteria 717
276 Ga0501260_013095 3300049689 Bacteria 853
277 Ga0501225_0088715 3300049705 Bacteria 894
278 Ga0501079_0009415 3300049741 Bacteria 7402
279 Ga0501079_0049669 3300049741 Bacteria 3238
280 Ga0501079_0062988 3300049741 Bacteria 2861
281 Ga0501080_0071490 3300049742 Bacteria 3227
282 Ga0501081_0000340 3300049743 Bacteria 25096
283 Ga0501081_0126808 3300049743 Bacteria 1821
284 Ga0501081_0574178 3300049743 Bacteria 843
285 Ga0501283_016208 3300049779 Bacteria 1154
286 Ga0501035_0140025 3300049822 Bacteria 2104
287 Ga0501045_0003239 3300049824 Bacteria 11116
288 Ga0501045_0057429 3300049824 Bacteria 2848
289 Ga0501045_0369869 3300049824 Bacteria 1067
290 nmdc:mga05p37_460163_c1 3300050507 Bacteria 1470
291 nmdc:mga09592_99135_c1 3300050508 Bacteria 2494
292 nmdc:mga0qj67_7099_c1 3300050509 Bacteria 8263
293 nmdc:mga0qj67_8275_c1 3300050509 Bacteria 7712
294 nmdc:mga06r32_510336_c1 3300050510 Bacteria 1179
295 nmdc:mga06r32_75741_c1 3300050510 Bacteria 3266
296 nmdc:mga08y16_44780_c1 3300050511 Bacteria 4638
297 nmdc:mga0n895_1111_c1 3300050512 Bacteria 19635
298 nmdc:mga0n895_249670_c1 3300050512 Bacteria 1801
299 nmdc:mga0n895_6569_c1 3300050512 Bacteria 9898
300 nmdc:mga0n895_723194_c1 3300050512 Bacteria 990
301 nmdc:mga0n895_859411_c1 3300050512 Bacteria 895
302 nmdc:mga0n895_970242_c1 3300050512 Bacteria 832
303 nmdc:mga0rr50_126125_c1 3300050513 Bacteria 2044
304 nmdc:mga0rr50_1347468_c1 3300050513 Bacteria 605
305 nmdc:mga0rr50_1689878_c1 3300050513 Bacteria 534
306 nmdc:mga0rr50_277028_c1 3300050513 Bacteria 1399
307 nmdc:mga0rr50_496_c1 3300050513 Bacteria 20979
308 nmdc:mga0rr50_586483_c1 3300050513 Bacteria 950
309 nmdc:mga0rr50_850679_c1 3300050513 Bacteria 778
310 nmdc:mga08x19_1694_c1 3300050514 Bacteria 13559
311 nmdc:mga08x19_21400_c1 3300050514 Bacteria 3991
312 nmdc:mga08x19_37330_c1 3300050514 Bacteria 3083
313 nmdc:mga08x19_39813_c1 3300050514 Bacteria 2989
314 nmdc:mga0a205_294_c1 3300050515 Bacteria 36893
315 nmdc:mga0a205_349980_c1 3300050515 Bacteria 1345
316 nmdc:mga0a205_70061_c1 3300050515 Bacteria 3385
317 Ga0495595_0315063 3300053084 Bacteria 788
318 Ga0501084_0049592 3300054114 Bacteria 3514
319 Ga0501084_0180709 3300054114 Bacteria 1781
320 Ga0501084_0293753 3300054114 Bacteria 1372
321 Ga0590071_010604 3300059421 Bacteria 2156
322 Ga0590077_004642 3300059426 Bacteria 2814
323 Ga0590077_022256 3300059426 Bacteria 1352
324 Ga0501082_0027068 3300060353 Bacteria 4941
325 Ga0501082_0683324 3300060353 Bacteria 898
326 Ga0530510_0000492 3300061734 Bacteria 25177
327 Ga0530510_0064640 3300061734 Bacteria 2650
328 Ga0530510_0287995 3300061734 Bacteria 1228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10233887 Ga0105251_102338871 147
2 3300014325 Ga0163163_10969088 Ga0163163_109690882 147
3 3300042436 Ga0439435_0008946 Ga0439435_0008946_436_879 147
4 3300042437 Ga0439444_0000862 Ga0439444_0000862_3193_3636 147
5 3300042461 Ga0439460_0000963 Ga0439460_0000963_4726_5169 147
6 3300042532 Ga0450893_0013008 Ga0450893_0013008_347_790 147
7 3300049576 Ga0501040_0217761 Ga0501040_0217761_198_641 147
8 3300049592 Ga0501076_0239306 Ga0501076_0239306_302_745 147
9 3300042876 Ga0451577_0334049 Ga0451577_0334049_10_456 148
10 3300045051 Ga0451576_0424227 Ga0451576_0424227_710_1156 148
11 3300046472 Ga0495580_1044562 Ga0495580_1044562_34_501 148
12 3300049520 Ga0501297_070746 Ga0501297_070746_31_477 148
13 3300006914 Ga0075436_100000122 Ga0075436_10000012222 149
14 3300050513 nmdc:mga0rr50_1689878_c1 nmdc:mga0rr50_1689878_c1_67_516 149
15 3300050513 nmdc:mga0rr50_1347468_c1 nmdc:mga0rr50_1347468_c1_129_581 150
16 3300034819 Ga0373958_0041757 Ga0373958_0041757_34_495 153
17 3300005439 Ga0070711_100880712 Ga0070711_1008807121 156
18 3300005336 Ga0070680_101407890 Ga0070680_1014078901 157
19 3300005440 Ga0070705_100003129 Ga0070705_1000031299 157
20 3300005444 Ga0070694_100035582 Ga0070694_1000355822 157
21 3300005549 Ga0070704_100040286 Ga0070704_1000402864 157
22 3300006844 Ga0075428_100866944 Ga0075428_1008669442 157
23 3300027360 Ga0209969_1001170 Ga0209969_10011703 157
24 3300027364 Ga0209967_1003318 Ga0209967_10033183 157
25 3300027378 Ga0209981_1000901 Ga0209981_10009014 157
26 3300027395 Ga0209996_1002861 Ga0209996_10028613 157
27 3300027462 Ga0210000_1000567 Ga0210000_10005675 157
28 3300027462 Ga0210000_1022092 Ga0210000_10220922 157
29 3300027471 Ga0209995_1006530 Ga0209995_10065302 157
30 3300027526 Ga0209968_1002093 Ga0209968_10020933 157
31 3300027526 Ga0209968_1028058 Ga0209968_10280582 157
32 3300027543 Ga0209999_1002962 Ga0209999_10029623 157
33 3300027665 Ga0209983_1017851 Ga0209983_10178512 157
34 3300027695 Ga0209966_1055245 Ga0209966_10552452 157
35 3300031548 Ga0307408_100397691 Ga0307408_1003976912 157
36 3300031731 Ga0307405_10490915 Ga0307405_104909152 157
37 3300032002 Ga0307416_100044827 Ga0307416_1000448272 157
38 3300042001 Ga0439441_004473 Ga0439441_004473_1380_1853 157
39 3300042003 Ga0439443_002169 Ga0439443_002169_1009_1482 157
40 3300042461 Ga0439460_0122534 Ga0439460_0122534_365_838 157
41 3300049521 Ga0501298_054496 Ga0501298_054496_342_815 157
42 3300049588 Ga0501072_0104339 Ga0501072_0104339_1608_2081 157
43 3300050507 nmdc:mga05p37_460163_c1 nmdc:mga05p37_460163_c1_248_721 157
44 3300005437 Ga0070710_10132106 Ga0070710_101321062 158
45 3300005438 Ga0070701_10144287 Ga0070701_101442872 158
46 3300005444 Ga0070694_100012481 Ga0070694_1000124815 158
47 3300005444 Ga0070694_100168716 Ga0070694_1001687162 158
48 3300005545 Ga0070695_100083879 Ga0070695_1000838792 158
49 3300005549 Ga0070704_100791454 Ga0070704_1007914542 158
50 3300005618 Ga0068864_100340577 Ga0068864_1003405773 158
51 3300006880 Ga0075429_100517332 Ga0075429_1005173322 158
52 3300007076 Ga0075435_100014553 Ga0075435_1000145537 158
53 3300007076 Ga0075435_100242365 Ga0075435_1002423652 158
54 3300025893 Ga0207682_10075786 Ga0207682_100757862 158
55 3300025898 Ga0207692_10044239 Ga0207692_100442392 158
56 3300025917 Ga0207660_10193428 Ga0207660_101934282 158
57 3300031731 Ga0307405_10942481 Ga0307405_109424812 158
58 3300032005 Ga0307411_10089321 Ga0307411_100893212 158
59 3300035117 Ga0373953_0034591 Ga0373953_0034591_572_1093 158
60 3300035118 Ga0373954_0056343 Ga0373954_0056343_441_917 158
61 3300035119 Ga0373956_0037154 Ga0373956_0037154_147_623 158
62 3300035692 Ga0373935_0258911 Ga0373935_0258911_630_1106 158
63 3300035724 Ga0373933_0014962 Ga0373933_0014962_137_613 158
64 3300035725 Ga0373947_0296581 Ga0373947_0296581_525_1046 158
65 3300036401 Ga0373937_0012638 Ga0373937_0012638_5184_5705 158
66 3300037068 Ga0373925_0622046 Ga0373925_0622046_195_716 158
67 3300041486 Ga0451807_1452996 Ga0451807_1452996_574_1050 158
68 3300041999 Ga0439433_0101219 Ga0439433_0101219_29_517 158
69 3300042001 Ga0439441_008092 Ga0439441_008092_1176_1652 158
70 3300042122 Ga0450920_086716 Ga0450920_086716_21_497 158
71 3300042435 Ga0439434_0000120 Ga0439434_0000120_13702_14190 158
72 3300042436 Ga0439435_0000211 Ga0439435_0000211_3635_4123 158
73 3300045051 Ga0451576_0225148 Ga0451576_0225148_146_622 158
74 3300046454 Ga0495592_0007433 Ga0495592_0007433_6227_6751 158
75 3300046511 Ga0495608_0354688 Ga0495608_0354688_259_783 158
76 3300046516 Ga0495628_0090824 Ga0495628_0090824_856_1380 158
77 3300046517 Ga0495630_0649476 Ga0495630_0649476_168_644 158
78 3300046535 Ga0495586_0004274 Ga0495586_0004274_6993_7517 158
79 3300046559 Ga0495667_0223996 Ga0495667_0223996_535_1059 158
80 3300046559 Ga0495667_0242047 Ga0495667_0242047_340_861 158
81 3300046642 Ga0495634_0005778 Ga0495634_0005778_39_563 158
82 3300046642 Ga0495634_0311919 Ga0495634_0311919_168_644 158
83 3300046689 Ga0495613_0472673 Ga0495613_0472673_134_658 158
84 3300047319 Ga0495674_0414648 Ga0495674_0414648_71_592 158
85 3300047322 Ga0495680_0090873 Ga0495680_0090873_1646_2170 158
86 3300047322 Ga0495680_0182129 Ga0495680_0182129_415_936 158
87 3300047471 Ga0495684_0784683 Ga0495684_0784683_40_516 158
88 3300047673 Ga0495593_0322910 Ga0495593_0322910_219_740 158
89 3300049568 Ga0501031_0261378 Ga0501031_0261378_80_556 158
90 3300049572 Ga0501036_0030917 Ga0501036_0030917_813_1289 158
91 3300049573 Ga0501037_0222242 Ga0501037_0222242_617_1108 158
92 3300049574 Ga0501038_0102931 Ga0501038_0102931_1056_1532 158
93 3300049575 Ga0501039_0040580 Ga0501039_0040580_421_897 158
94 3300049575 Ga0501039_0316739 Ga0501039_0316739_268_744 158
95 3300049576 Ga0501040_0001293 Ga0501040_0001293_12796_13272 158
96 3300049576 Ga0501040_0252307 Ga0501040_0252307_769_1245 158
97 3300049576 Ga0501040_0299572 Ga0501040_0299572_212_688 158
98 3300049576 Ga0501040_1152652 Ga0501040_1152652_60_536 158
99 3300049577 Ga0501041_0015688 Ga0501041_0015688_3118_3594 158
100 3300049577 Ga0501041_0121644 Ga0501041_0121644_140_631 158
101 3300049578 Ga0501042_0139453 Ga0501042_0139453_660_1136 158
102 3300049579 Ga0501043_0128101 Ga0501043_0128101_400_921 158
103 3300049579 Ga0501043_0172294 Ga0501043_0172294_787_1263 158
104 3300049580 Ga0501046_0101903 Ga0501046_0101903_424_900 158
105 3300049580 Ga0501046_0163913 Ga0501046_0163913_305_781 158
106 3300049582 Ga0501048_0012986 Ga0501048_0012986_4592_5068 158
107 3300049582 Ga0501048_0055878 Ga0501048_0055878_568_1044 158
108 3300049587 Ga0501071_0152125 Ga0501071_0152125_1201_1677 158
109 3300049587 Ga0501071_0287283 Ga0501071_0287283_43_519 158
110 3300049588 Ga0501072_0034270 Ga0501072_0034270_2593_3069 158
111 3300049588 Ga0501072_0038853 Ga0501072_0038853_1661_2137 158
112 3300049590 Ga0501074_0234778 Ga0501074_0234778_293_769 158
113 3300049591 Ga0501075_0007604 Ga0501075_0007604_4538_5014 158
114 3300049591 Ga0501075_0217431 Ga0501075_0217431_248_739 158
115 3300049591 Ga0501075_0646249 Ga0501075_0646249_69_545 158
116 3300049592 Ga0501076_0004972 Ga0501076_0004972_8873_9349 158
117 3300049593 Ga0501077_0099627 Ga0501077_0099627_705_1181 158
118 3300049593 Ga0501077_0584170 Ga0501077_0584170_143_619 158
119 3300049689 Ga0501260_013095 Ga0501260_013095_87_605 158
120 3300049741 Ga0501079_0009415 Ga0501079_0009415_5401_5877 158
121 3300049741 Ga0501079_0049669 Ga0501079_0049669_2337_2813 158
122 3300049741 Ga0501079_0062988 Ga0501079_0062988_2220_2711 158
123 3300049742 Ga0501080_0071490 Ga0501080_0071490_2318_2794 158
124 3300049743 Ga0501081_0000340 Ga0501081_0000340_1776_2252 158
125 3300049743 Ga0501081_0126808 Ga0501081_0126808_169_660 158
126 3300049743 Ga0501081_0574178 Ga0501081_0574178_101_619 158
127 3300049779 Ga0501283_016208 Ga0501283_016208_311_787 158
128 3300049822 Ga0501035_0140025 Ga0501035_0140025_818_1294 158
129 3300049824 Ga0501045_0003239 Ga0501045_0003239_6150_6626 158
130 3300050508 nmdc:mga09592_99135_c1 nmdc:mga09592_99135_c1_470_946 158
131 3300050512 nmdc:mga0n895_723194_c1 nmdc:mga0n895_723194_c1_488_964 158
132 3300050513 nmdc:mga0rr50_850679_c1 nmdc:mga0rr50_850679_c1_128_604 158
133 3300054114 Ga0501084_0049592 Ga0501084_0049592_1484_1960 158
134 3300054114 Ga0501084_0180709 Ga0501084_0180709_256_747 158
135 3300054114 Ga0501084_0293753 Ga0501084_0293753_20_496 158
136 3300060353 Ga0501082_0027068 Ga0501082_0027068_2713_3189 158
137 3300060353 Ga0501082_0683324 Ga0501082_0683324_297_773 158
138 3300061734 Ga0530510_0000492 Ga0530510_0000492_18719_19195 158
139 3300061734 Ga0530510_0064640 Ga0530510_0064640_1470_1946 158
140 3300061734 Ga0530510_0287995 Ga0530510_0287995_260_736 158
141 3300005329 Ga0070683_100168247 Ga0070683_1001682473 159
142 3300005330 Ga0070690_100035298 Ga0070690_1000352983 159
143 3300005330 Ga0070690_101231726 Ga0070690_1012317261 159
144 3300005340 Ga0070689_100219240 Ga0070689_1002192402 159
145 3300005366 Ga0070659_101120201 Ga0070659_1011202011 159
146 3300005436 Ga0070713_100170059 Ga0070713_1001700592 159
147 3300005438 Ga0070701_10321304 Ga0070701_103213041 159
148 3300005444 Ga0070694_100069267 Ga0070694_1000692672 159
149 3300005444 Ga0070694_100251621 Ga0070694_1002516212 159
150 3300005467 Ga0070706_100674784 Ga0070706_1006747841 159
151 3300005535 Ga0070684_100054635 Ga0070684_1000546352 159
152 3300005536 Ga0070697_100410375 Ga0070697_1004103752 159
153 3300005544 Ga0070686_100016927 Ga0070686_1000169275 159
154 3300005544 Ga0070686_100153283 Ga0070686_1001532832 159
155 3300005545 Ga0070695_100197380 Ga0070695_1001973801 159
156 3300005545 Ga0070695_100235475 Ga0070695_1002354752 159
157 3300005546 Ga0070696_100002413 Ga0070696_10000241310 159
158 3300005546 Ga0070696_100244830 Ga0070696_1002448303 159
159 3300005564 Ga0070664_100517490 Ga0070664_1005174902 159
160 3300005615 Ga0070702_100062122 Ga0070702_1000621222 159
161 3300005615 Ga0070702_100722610 Ga0070702_1007226101 159
162 3300005618 Ga0068864_100061424 Ga0068864_1000614244 159
163 3300005843 Ga0068860_100528872 Ga0068860_1005288721 159
164 3300006058 Ga0075432_10121192 Ga0075432_101211923 159
165 3300006163 Ga0070715_10014457 Ga0070715_100144574 159
166 3300006163 Ga0070715_10197809 Ga0070715_101978091 159
167 3300006237 Ga0097621_100002299 Ga0097621_1000022995 159
168 3300006358 Ga0068871_100016322 Ga0068871_1000163226 159
169 3300006846 Ga0075430_100001765 Ga0075430_10000176512 159
170 3300006846 Ga0075430_100018295 Ga0075430_1000182954 159
171 3300006846 Ga0075430_100239997 Ga0075430_1002399973 159
172 3300006847 Ga0075431_100020872 Ga0075431_1000208722 159
173 3300006847 Ga0075431_100778691 Ga0075431_1007786911 159
174 3300006852 Ga0075433_10009244 Ga0075433_100092443 159
175 3300006852 Ga0075433_10419681 Ga0075433_104196812 159
176 3300006871 Ga0075434_100001838 Ga0075434_10000183814 159
177 3300006871 Ga0075434_100006451 Ga0075434_1000064516 159
178 3300006881 Ga0068865_100762560 Ga0068865_1007625602 159
179 3300006914 Ga0075436_100002199 Ga0075436_10000219910 159
180 3300007076 Ga0075435_100012027 Ga0075435_1000120274 159
181 3300007076 Ga0075435_100277334 Ga0075435_1002773342 159
182 3300009094 Ga0111539_10022976 Ga0111539_100229764 159
183 3300009094 Ga0111539_12220270 Ga0111539_122202702 159
184 3300009177 Ga0105248_10240579 Ga0105248_102405792 159
185 3300013307 Ga0157372_10520988 Ga0157372_105209882 159
186 3300014326 Ga0157380_10159627 Ga0157380_101596272 159
187 3300014968 Ga0157379_10861414 Ga0157379_108614142 159
188 3300014969 Ga0157376_10013922 Ga0157376_100139223 159
189 3300025905 Ga0207685_10052694 Ga0207685_100526942 159
190 3300025905 Ga0207685_10143047 Ga0207685_101430472 159
191 3300025938 Ga0207704_10621164 Ga0207704_106211642 159
192 3300025939 Ga0207665_11127864 Ga0207665_111278641 159
193 3300025941 Ga0207711_10193013 Ga0207711_101930132 159
194 3300025942 Ga0207689_10033351 Ga0207689_100333514 159
195 3300025944 Ga0207661_10323769 Ga0207661_103237694 159
196 3300025945 Ga0207679_10408603 Ga0207679_104086032 159
197 3300026035 Ga0207703_10047675 Ga0207703_100476752 159
198 3300026075 Ga0207708_10209919 Ga0207708_102099192 159
199 3300026078 Ga0207702_10138169 Ga0207702_101381694 159
200 3300026078 Ga0207702_10432600 Ga0207702_104326001 159
201 3300027360 Ga0209969_1021319 Ga0209969_10213191 159
202 3300027395 Ga0209996_1014489 Ga0209996_10144892 159
203 3300027543 Ga0209999_1056999 Ga0209999_10569992 159
204 3300027907 Ga0207428_10055897 Ga0207428_100558972 159
205 3300035692 Ga0373935_0346275 Ga0373935_0346275_262_789 159
206 3300035724 Ga0373933_0076242 Ga0373933_0076242_611_1135 159
207 3300036401 Ga0373937_0436437 Ga0373937_0436437_196_720 159
208 3300041512 Ga0451853_3338169 Ga0451853_3338169_157_684 159
209 3300045051 Ga0451576_0001051 Ga0451576_0001051_34088_34567 159
210 3300046454 Ga0495592_0170820 Ga0495592_0170820_127_621 159
211 3300046459 Ga0495629_0043915 Ga0495629_0043915_1508_2002 159
212 3300046476 Ga0495662_0016016 Ga0495662_0016016_2389_2883 159
213 3300046516 Ga0495628_0135679 Ga0495628_0135679_880_1374 159
214 3300046517 Ga0495630_0006978 Ga0495630_0006978_3126_3620 159
215 3300046523 Ga0495644_0183245 Ga0495644_0183245_63_542 159
216 3300046533 Ga0495640_0038376 Ga0495640_0038376_513_1040 159
217 3300046537 Ga0495598_0007606 Ga0495598_0007606_739_1266 159
218 3300046539 Ga0495621_0021582 Ga0495621_0021582_802_1281 159
219 3300046615 Ga0495656_0020772 Ga0495656_0020772_1105_1632 159
220 3300046615 Ga0495656_0216725 Ga0495656_0216725_315_794 159
221 3300046663 Ga0495635_0179023 Ga0495635_0179023_144_638 159
222 3300046683 Ga0495658_0098841 Ga0495658_0098841_818_1312 159
223 3300047315 Ga0495581_0164348 Ga0495581_0164348_210_704 159
224 3300047673 Ga0495593_0140800 Ga0495593_0140800_111_605 159
225 3300049568 Ga0501031_0360884 Ga0501031_0360884_120_599 159
226 3300049705 Ga0501225_0088715 Ga0501225_0088715_187_714 159
227 3300049824 Ga0501045_0057429 Ga0501045_0057429_1187_1666 159
228 3300049824 Ga0501045_0369869 Ga0501045_0369869_19_498 159
229 3300050509 nmdc:mga0qj67_7099_c1 nmdc:mga0qj67_7099_c1_5028_5570 159
230 3300050509 nmdc:mga0qj67_8275_c1 nmdc:mga0qj67_8275_c1_1160_1639 159
231 3300050510 nmdc:mga06r32_510336_c1 nmdc:mga06r32_510336_c1_591_1070 159
232 3300050510 nmdc:mga06r32_75741_c1 nmdc:mga06r32_75741_c1_219_761 159
233 3300050511 nmdc:mga08y16_44780_c1 nmdc:mga08y16_44780_c1_2736_3215 159
234 3300050512 nmdc:mga0n895_1111_c1 nmdc:mga0n895_1111_c1_14044_14523 159
235 3300050512 nmdc:mga0n895_6569_c1 nmdc:mga0n895_6569_c1_2122_2601 159
236 3300050513 nmdc:mga0rr50_126125_c1 nmdc:mga0rr50_126125_c1_452_943 159
237 3300050513 nmdc:mga0rr50_277028_c1 nmdc:mga0rr50_277028_c1_790_1269 159
238 3300050513 nmdc:mga0rr50_496_c1 nmdc:mga0rr50_496_c1_13203_13682 159
239 3300050514 nmdc:mga08x19_1694_c1 nmdc:mga08x19_1694_c1_7316_7795 159
240 3300050515 nmdc:mga0a205_294_c1 nmdc:mga0a205_294_c1_25673_26152 159
241 3300050515 nmdc:mga0a205_349980_c1 nmdc:mga0a205_349980_c1_575_1054 159
242 3300050515 nmdc:mga0a205_70061_c1 nmdc:mga0a205_70061_c1_2028_2552 159
243 3300053084 Ga0495595_0315063 Ga0495595_0315063_44_538 159
244 3300059421 Ga0590071_010604 Ga0590071_010604_1352_1876 159
245 3300059426 Ga0590077_004642 Ga0590077_004642_2052_2576 159
246 3300005329 Ga0070683_101044020 Ga0070683_1010440201 160
247 3300005336 Ga0070680_100246676 Ga0070680_1002466762 160
248 3300005436 Ga0070713_100345846 Ga0070713_1003458463 160
249 3300005437 Ga0070710_11024051 Ga0070710_110240511 160
250 3300005458 Ga0070681_10000379 Ga0070681_100003796 160
251 3300005466 Ga0070685_10635675 Ga0070685_106356751 160
252 3300005530 Ga0070679_100108440 Ga0070679_1001084404 160
253 3300005535 Ga0070684_100928604 Ga0070684_1009286041 160
254 3300005546 Ga0070696_100155401 Ga0070696_1001554013 160
255 3300005546 Ga0070696_100307667 Ga0070696_1003076672 160
256 3300005549 Ga0070704_100253586 Ga0070704_1002535862 160
257 3300005549 Ga0070704_101251909 Ga0070704_1012519091 160
258 3300005578 Ga0068854_101293955 Ga0068854_1012939552 160
259 3300006173 Ga0070716_100165967 Ga0070716_1001659672 160
260 3300006852 Ga0075433_10168581 Ga0075433_101685812 160
261 3300006871 Ga0075434_100716890 Ga0075434_1007168902 160
262 3300006914 Ga0075436_100008716 Ga0075436_1000087163 160
263 3300006914 Ga0075436_100257270 Ga0075436_1002572703 160
264 3300007076 Ga0075435_100214059 Ga0075435_1002140592 160
265 3300025906 Ga0207699_10581507 Ga0207699_105815072 160
266 3300025912 Ga0207707_10001563 Ga0207707_100015637 160
267 3300025917 Ga0207660_10334596 Ga0207660_103345962 160
268 3300025921 Ga0207652_10064598 Ga0207652_100645982 160
269 3300025939 Ga0207665_10027144 Ga0207665_100271445 160
270 3300025944 Ga0207661_10508781 Ga0207661_105087812 160
271 3300031548 Ga0307408_100039354 Ga0307408_1000393543 160
272 3300032002 Ga0307416_100620098 Ga0307416_1006200982 160
273 3300035085 Ga0373929_0006037 Ga0373929_0006037_27_509 160
274 3300035117 Ga0373953_0015150 Ga0373953_0015150_713_1243 160
275 3300035118 Ga0373954_0000063 Ga0373954_0000063_34491_35021 160
276 3300035119 Ga0373956_0343909 Ga0373956_0343909_88_615 160
277 3300035121 Ga0373960_0012805 Ga0373960_0012805_312_794 160
278 3300035241 Ga0373961_0028050 Ga0373961_0028050_785_1267 160
279 3300035410 Ga0373924_0146910 Ga0373924_0146910_326_856 160
280 3300035724 Ga0373933_0035588 Ga0373933_0035588_479_1009 160
281 3300036401 Ga0373937_0000230 Ga0373937_0000230_12586_13116 160
282 3300044694 Ga0466963_0320272 Ga0466963_0320272_307_804 160
283 3300044719 Ga0466971_0398289 Ga0466971_0398289_157_654 160
284 3300044901 Ga0466960_0304594 Ga0466960_0304594_131_613 160
285 3300045051 Ga0451576_1038523 Ga0451576_1038523_212_742 160
286 3300045976 Ga0466967_0065504 Ga0466967_0065504_370_867 160
287 3300046462 Ga0495651_0177675 Ga0495651_0177675_484_1011 160
288 3300046491 Ga0495584_0341263 Ga0495584_0341263_14_544 160
289 3300046511 Ga0495608_0141674 Ga0495608_0141674_396_926 160
290 3300046511 Ga0495608_0199620 Ga0495608_0199620_546_1073 160
291 3300046528 Ga0495642_0017889 Ga0495642_0017889_1911_2438 160
292 3300046536 Ga0495587_0337230 Ga0495587_0337230_62_589 160
293 3300046559 Ga0495667_0342515 Ga0495667_0342515_134_664 160
294 3300046675 Ga0495657_0441226 Ga0495657_0441226_110_640 160
295 3300046809 Ga0495600_0231359 Ga0495600_0231359_214_741 160
296 3300047317 Ga0495604_0144443 Ga0495604_0144443_17_544 160
297 3300047317 Ga0495604_0173190 Ga0495604_0173190_862_1389 160
298 3300047471 Ga0495684_0203721 Ga0495684_0203721_917_1444 160
299 3300049522 Ga0501299_028339 Ga0501299_028339_147_677 160
300 3300049575 Ga0501039_0359368 Ga0501039_0359368_334_816 160
301 3300049583 Ga0501067_0038981 Ga0501067_0038981_385_867 160
302 3300050512 nmdc:mga0n895_249670_c1 nmdc:mga0n895_249670_c1_1136_1618 160
303 3300050512 nmdc:mga0n895_859411_c1 nmdc:mga0n895_859411_c1_230_712 160
304 3300050514 nmdc:mga08x19_37330_c1 nmdc:mga08x19_37330_c1_131_661 160
305 3300050514 nmdc:mga08x19_39813_c1 nmdc:mga08x19_39813_c1_858_1340 160
306 3300059426 Ga0590077_022256 Ga0590077_022256_346_876 160
307 3300005293 Ga0065715_10528475 Ga0065715_105284752 161
308 3300005444 Ga0070694_100015442 Ga0070694_1000154426 161
309 3300005445 Ga0070708_100608513 Ga0070708_1006085132 161
310 3300005467 Ga0070706_100103552 Ga0070706_1001035523 161
311 3300005536 Ga0070697_100121454 Ga0070697_1001214543 161
312 3300005545 Ga0070695_100014459 Ga0070695_1000144594 161
313 3300005546 Ga0070696_100010244 Ga0070696_1000102447 161
314 3300005546 Ga0070696_100848093 Ga0070696_1008480931 161
315 3300005549 Ga0070704_100426620 Ga0070704_1004266202 161
316 3300006028 Ga0070717_10479449 Ga0070717_104794492 161
317 3300006914 Ga0075436_100048398 Ga0075436_1000483982 161
318 3300007076 Ga0075435_100749289 Ga0075435_1007492892 161
319 3300025910 Ga0207684_10067779 Ga0207684_100677793 161
320 3300027526 Ga0209968_1010360 Ga0209968_10103602 161
321 3300027543 Ga0209999_1059669 Ga0209999_10596691 161
322 3300035112 Ga0373932_0073459 Ga0373932_0073459_273_812 161
323 3300035121 Ga0373960_0008626 Ga0373960_0008626_1419_1955 161
324 3300050512 nmdc:mga0n895_970242_c1 nmdc:mga0n895_970242_c1_107_640 161
325 3300050513 nmdc:mga0rr50_586483_c1 nmdc:mga0rr50_586483_c1_345_878 161
326 3300050514 nmdc:mga08x19_21400_c1 nmdc:mga08x19_21400_c1_882_1415 161
327 3300003203 JGI25406J46586_10038403 JGI25406J46586_100384032 162
328 3300005985 Ga0081539_10001342 Ga0081539_100013422 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

30

134

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.8877 5 159
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.8784 5 158
2p31-assembly2.cif.gz_B crystal structure of human glutathione peroxidase 7 0.8676 5 156
2p5q-assembly2.cif.gz_D crystal structure of the poplar glutathione peroxidase 5 in the reduced form 0.8616 5 158
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.8614 6 156
ID Description Score Start End Superfamily
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8731 5 156 3.40.30.10
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8716 7 157 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8676 5 156 3.40.30.10
af_A8WFK6_20_197_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8614 5 162 3.40.30.10
5h5rA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8561 3 156 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0A0DV32-F1-model_v4 Glutathione peroxidase 0.9213 1 158 GO:0004601
GO:0034599
AF-A0A537DQ35-F1-model_v4 Glutathione peroxidase 0.9193 2 158 GO:0004601
GO:0034599
AF-A0A557QSU6-F1-model_v4 Glutathione peroxidase 0.9185 1 162 GO:0004601
GO:0034599
AF-A0A5H2YQ35-F1-model_v4 Glutathione peroxidase 0.9184 1 159 GO:0004601
GO:0034599
AF-B1XXW7-F1-model_v4 Glutathione peroxidase 0.9182 2 159 GO:0004601
GO:0034599

Feature Viewer

pLDDT pTM Quality
88.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map