F409110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 157 | 328 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100017150|Ga0070671_1000171504 |
| Length | 338 |
| Sequence | MSRDPEQVILETIVSYLQNKTDAKTIYPQATTGGGPVVSVPRAKRQGGAEPLDKGVAPSWIEEPVHFEPNRARVGVRTVWISDTHLGTAGCNAELLLDFLKSTDCETLYLVGDIVDGWQLRKGWYWPPRHNDIVRCVLKKAKHGTRVVYVPGNHDEAFRGYVGLNLGGIELVPEAIHVTADKRRLLILHGDEFDGVVLYAKWLAFLGDSAYVLLLKLNRLLNWVRRKRGLPYWSLSSHLKKKVKNAVQFISSFEEVVAHAAHERGAQGVVCGHIHSPEIRQIGAVTYYNDGDWVESCTALVEHPDGRMEIIDWAEHQRTEAEQGRNRRHRRKKETIHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 115 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 123 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 124 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 125 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 126 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 141 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 146 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 147 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 148 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 149 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 150 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 151 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 154 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 155 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 156 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.44 |
| Nodule | 0 |
| Rhizoplane | 4.88 |
| Rhizosphere | 90.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001623 | 3300001979 | Bacteria | 10352 |
| 2 | JGI24739J22299_10000129 | 3300001989 | Bacteria | 23885 |
| 3 | JGI24737J22298_10000508 | 3300001990 | Bacteria | 13588 |
| 4 | JGI24737J22298_10003110 | 3300001990 | Bacteria | 5884 |
| 5 | JGI24738J21930_10000498 | 3300002075 | Bacteria | 11174 |
| 6 | JGI24744J21845_10034267 | 3300002077 | Bacteria | 963 |
| 7 | Ga0070676_10004537 | 3300005328 | Bacteria | 7315 |
| 8 | Ga0070690_100008375 | 3300005330 | Bacteria | 5953 |
| 9 | Ga0070690_100019537 | 3300005330 | Bacteria | 4114 |
| 10 | Ga0070677_10037914 | 3300005333 | Bacteria | 1883 |
| 11 | Ga0068869_100003385 | 3300005334 | Bacteria | 9734 |
| 12 | Ga0068869_100267747 | 3300005334 | Bacteria | 1370 |
| 13 | Ga0070666_10000822 | 3300005335 | Bacteria | 18838 |
| 14 | Ga0070666_10018914 | 3300005335 | Bacteria | 4439 |
| 15 | Ga0070666_10225822 | 3300005335 | Bacteria | 1322 |
| 16 | Ga0068868_100000156 | 3300005338 | Bacteria | 44526 |
| 17 | Ga0068868_100001262 | 3300005338 | Bacteria | 17407 |
| 18 | Ga0070660_100018877 | 3300005339 | Bacteria | 5047 |
| 19 | Ga0070660_100333712 | 3300005339 | Bacteria | 1247 |
| 20 | Ga0070687_100018134 | 3300005343 | Bacteria | 3249 |
| 21 | Ga0070687_100230253 | 3300005343 | Bacteria | 1140 |
| 22 | Ga0070669_100000383 | 3300005353 | Bacteria | 33931 |
| 23 | Ga0070671_100011082 | 3300005355 | Bacteria | 7239 |
| 24 | Ga0070671_100017150 | 3300005355 | Bacteria | 5860 |
| 25 | Ga0070671_100043320 | 3300005355 | Bacteria | 3740 |
| 26 | Ga0070671_100046826 | 3300005355 | Bacteria | 3596 |
| 27 | Ga0070671_100048870 | 3300005355 | Bacteria | 3519 |
| 28 | Ga0070671_100051763 | 3300005355 | Bacteria | 3415 |
| 29 | Ga0070671_100190282 | 3300005355 | Bacteria | 1739 |
| 30 | Ga0070674_100023056 | 3300005356 | Bacteria | 4022 |
| 31 | Ga0070674_100251577 | 3300005356 | Bacteria | 1388 |
| 32 | Ga0070673_100000249 | 3300005364 | Bacteria | 27281 |
| 33 | Ga0070673_100021148 | 3300005364 | Bacteria | 4709 |
| 34 | Ga0070673_100024724 | 3300005364 | Bacteria | 4408 |
| 35 | Ga0070673_100089115 | 3300005364 | Bacteria | 2518 |
| 36 | Ga0070659_100000814 | 3300005366 | Bacteria | 22773 |
| 37 | Ga0070659_100023518 | 3300005366 | Bacteria | 4716 |
| 38 | Ga0070667_100001584 | 3300005367 | Bacteria | 20376 |
| 39 | Ga0070667_100007007 | 3300005367 | Bacteria | 9371 |
| 40 | Ga0070667_100097106 | 3300005367 | Bacteria | 2541 |
| 41 | Ga0070667_100164035 | 3300005367 | Bacteria | 1959 |
| 42 | Ga0070667_100183014 | 3300005367 | Bacteria | 1854 |
| 43 | Ga0070709_10071452 | 3300005434 | Bacteria | 2240 |
| 44 | Ga0070709_10182620 | 3300005434 | Bacteria | 1474 |
| 45 | Ga0070714_100022755 | 3300005435 | Bacteria | 5142 |
| 46 | Ga0070714_100109596 | 3300005435 | Bacteria | 2443 |
| 47 | Ga0070713_100008541 | 3300005436 | Bacteria | 7266 |
| 48 | Ga0070713_100454901 | 3300005436 | Bacteria | 1203 |
| 49 | Ga0070662_100017121 | 3300005457 | Bacteria | 4878 |
| 50 | Ga0068867_100000388 | 3300005459 | Bacteria | 29345 |
| 51 | Ga0068853_100012691 | 3300005539 | Bacteria | 6859 |
| 52 | Ga0070672_100003048 | 3300005543 | Bacteria | 10795 |
| 53 | Ga0070672_100230098 | 3300005543 | Bacteria | 1557 |
| 54 | Ga0070693_100338474 | 3300005547 | Bacteria | 1026 |
| 55 | Ga0068855_100143903 | 3300005563 | Bacteria | 2715 |
| 56 | Ga0068855_100152150 | 3300005563 | Bacteria | 2630 |
| 57 | Ga0070664_100124956 | 3300005564 | Bacteria | 2255 |
| 58 | Ga0070664_100438472 | 3300005564 | Bacteria | 1198 |
| 59 | Ga0068857_100000282 | 3300005577 | Bacteria | 34844 |
| 60 | Ga0068857_100045038 | 3300005577 | Bacteria | 3913 |
| 61 | Ga0068857_100068273 | 3300005577 | Bacteria | 3164 |
| 62 | Ga0068854_100001950 | 3300005578 | Bacteria | 12596 |
| 63 | Ga0068854_100065295 | 3300005578 | Bacteria | 2646 |
| 64 | Ga0068856_100045067 | 3300005614 | Bacteria | 4341 |
| 65 | Ga0068856_100134130 | 3300005614 | Bacteria | 2481 |
| 66 | Ga0068856_100168970 | 3300005614 | Bacteria | 2199 |
| 67 | Ga0068852_100107006 | 3300005616 | Bacteria | 2536 |
| 68 | Ga0068859_100002194 | 3300005617 | Bacteria | 19831 |
| 69 | Ga0068864_100021046 | 3300005618 | Bacteria | 5461 |
| 70 | Ga0068864_100063138 | 3300005618 | Bacteria | 3210 |
| 71 | Ga0068861_100030231 | 3300005719 | Bacteria | 3968 |
| 72 | Ga0068863_100018083 | 3300005841 | Bacteria | 6750 |
| 73 | Ga0068863_100066192 | 3300005841 | Bacteria | 3418 |
| 74 | Ga0068858_100001945 | 3300005842 | Bacteria | 21060 |
| 75 | Ga0068858_100101629 | 3300005842 | Bacteria | 2681 |
| 76 | Ga0068858_100260107 | 3300005842 | Bacteria | 1649 |
| 77 | Ga0068860_100025363 | 3300005843 | Bacteria | 5720 |
| 78 | Ga0068860_100032717 | 3300005843 | Bacteria | 4996 |
| 79 | Ga0068862_100024428 | 3300005844 | Bacteria | 5071 |
| 80 | Ga0068862_100096506 | 3300005844 | Bacteria | 2580 |
| 81 | Ga0068862_100099897 | 3300005844 | Bacteria | 2537 |
| 82 | Ga0081455_10320614 | 3300005937 | Bacteria | 1104 |
| 83 | Ga0081539_10035823 | 3300005985 | Bacteria | 2977 |
| 84 | Ga0081539_10054597 | 3300005985 | Bacteria | 2229 |
| 85 | Ga0070717_10076249 | 3300006028 | Bacteria | 2806 |
| 86 | Ga0070712_100019273 | 3300006175 | Bacteria | 4447 |
| 87 | Ga0070712_100089683 | 3300006175 | Bacteria | 2250 |
| 88 | Ga0075366_10047721 | 3300006195 | Bacteria | 2538 |
| 89 | Ga0097621_100217354 | 3300006237 | Bacteria | 1664 |
| 90 | Ga0068871_100333811 | 3300006358 | Bacteria | 1337 |
| 91 | Ga0068865_100004164 | 3300006881 | Bacteria | 8703 |
| 92 | Ga0097620_100002194 | 3300006931 | Bacteria | 19831 |
| 93 | Ga0105240_10003147 | 3300009093 | Bacteria | 25971 |
| 94 | Ga0105245_10000326 | 3300009098 | Bacteria | 44899 |
| 95 | Ga0105245_10240987 | 3300009098 | Bacteria | 1753 |
| 96 | Ga0105245_10914769 | 3300009098 | Bacteria | 919 |
| 97 | Ga0105243_10195022 | 3300009148 | Bacteria | 1772 |
| 98 | Ga0105248_10000159 | 3300009177 | Bacteria | 78504 |
| 99 | Ga0105248_10002422 | 3300009177 | Bacteria | 20691 |
| 100 | Ga0105248_10205614 | 3300009177 | Bacteria | 2219 |
| 101 | Ga0105239_10527380 | 3300010375 | Bacteria | 1344 |
| 102 | Ga0105246_10011884 | 3300011119 | Bacteria | 5416 |
| 103 | Ga0157373_10024145 | 3300013100 | Bacteria | 4406 |
| 104 | Ga0157373_10053929 | 3300013100 | Bacteria | 2858 |
| 105 | Ga0157371_10008372 | 3300013102 | Bacteria | 8245 |
| 106 | Ga0157369_10016207 | 3300013105 | Bacteria | 8387 |
| 107 | Ga0157374_10004895 | 3300013296 | Bacteria | 11237 |
| 108 | Ga0157374_10115260 | 3300013296 | Bacteria | 2588 |
| 109 | Ga0157374_10180935 | 3300013296 | Bacteria | 2059 |
| 110 | Ga0157378_10001240 | 3300013297 | Bacteria | 23084 |
| 111 | Ga0163162_10212204 | 3300013306 | Bacteria | 2066 |
| 112 | Ga0163162_10431674 | 3300013306 | Bacteria | 1449 |
| 113 | Ga0157372_10129669 | 3300013307 | Bacteria | 2900 |
| 114 | Ga0157375_10038697 | 3300013308 | Bacteria | 4581 |
| 115 | Ga0157375_10186067 | 3300013308 | Bacteria | 2230 |
| 116 | Ga0163163_10027336 | 3300014325 | Bacteria | 5464 |
| 117 | Ga0157379_10142572 | 3300014968 | Bacteria | 2160 |
| 118 | Ga0157379_10145163 | 3300014968 | Bacteria | 2140 |
| 119 | Ga0207697_10000727 | 3300025315 | Bacteria | 18712 |
| 120 | Ga0207682_10069874 | 3300025893 | Bacteria | 1486 |
| 121 | Ga0207680_10000361 | 3300025903 | Bacteria | 21828 |
| 122 | Ga0207680_10186401 | 3300025903 | Bacteria | 1406 |
| 123 | Ga0207647_10004783 | 3300025904 | Bacteria | 10025 |
| 124 | Ga0207647_10006605 | 3300025904 | Bacteria | 8427 |
| 125 | Ga0207647_10025061 | 3300025904 | Bacteria | 3927 |
| 126 | Ga0207647_10027695 | 3300025904 | Bacteria | 3691 |
| 127 | Ga0207647_10034571 | 3300025904 | Bacteria | 3225 |
| 128 | Ga0207699_10006551 | 3300025906 | Bacteria | 5648 |
| 129 | Ga0207645_10008056 | 3300025907 | Bacteria | 7391 |
| 130 | Ga0207705_10007104 | 3300025909 | Bacteria | 8257 |
| 131 | Ga0207695_10002317 | 3300025913 | Bacteria | 28404 |
| 132 | Ga0207693_10031706 | 3300025915 | Bacteria | 4176 |
| 133 | Ga0207693_10109937 | 3300025915 | Bacteria | 2161 |
| 134 | Ga0207662_10250070 | 3300025918 | Bacteria | 1163 |
| 135 | Ga0207657_10038464 | 3300025919 | Bacteria | 4258 |
| 136 | Ga0207657_10127722 | 3300025919 | Bacteria | 2087 |
| 137 | Ga0207657_10214205 | 3300025919 | Bacteria | 1545 |
| 138 | Ga0207681_10041863 | 3300025923 | Bacteria | 3056 |
| 139 | Ga0207681_10056667 | 3300025923 | Bacteria | 2674 |
| 140 | Ga0207694_10025973 | 3300025924 | Bacteria | 4453 |
| 141 | Ga0207650_10005054 | 3300025925 | Bacteria | 8999 |
| 142 | Ga0207650_10026983 | 3300025925 | Bacteria | 4105 |
| 143 | Ga0207687_10002526 | 3300025927 | Bacteria | 12416 |
| 144 | Ga0207700_10044637 | 3300025928 | Bacteria | 3264 |
| 145 | Ga0207664_10151902 | 3300025929 | Bacteria | 1968 |
| 146 | Ga0207664_10340420 | 3300025929 | Bacteria | 1326 |
| 147 | Ga0207644_10004695 | 3300025931 | Bacteria | 8876 |
| 148 | Ga0207644_10015905 | 3300025931 | Bacteria | 5058 |
| 149 | Ga0207644_10054018 | 3300025931 | Bacteria | 2892 |
| 150 | Ga0207644_10108302 | 3300025931 | Bacteria | 2097 |
| 151 | Ga0207644_10197507 | 3300025931 | Bacteria | 1585 |
| 152 | Ga0207690_10004102 | 3300025932 | Bacteria | 8603 |
| 153 | Ga0207690_10004279 | 3300025932 | Bacteria | 8428 |
| 154 | Ga0207690_10016678 | 3300025932 | Bacteria | 4474 |
| 155 | Ga0207706_10007443 | 3300025933 | Bacteria | 10126 |
| 156 | Ga0207706_10061770 | 3300025933 | Bacteria | 3300 |
| 157 | Ga0207669_10287479 | 3300025937 | Bacteria | 1243 |
| 158 | Ga0207704_10128803 | 3300025938 | Bacteria | 1748 |
| 159 | Ga0207704_10143647 | 3300025938 | Bacteria | 1673 |
| 160 | Ga0207665_10102468 | 3300025939 | Bacteria | 2000 |
| 161 | Ga0207691_10002930 | 3300025940 | Bacteria | 16651 |
| 162 | Ga0207691_10279903 | 3300025940 | Bacteria | 1435 |
| 163 | Ga0207711_10004452 | 3300025941 | Bacteria | 11943 |
| 164 | Ga0207711_10079336 | 3300025941 | Bacteria | 2865 |
| 165 | Ga0207711_10152659 | 3300025941 | Bacteria | 2085 |
| 166 | Ga0207711_10249584 | 3300025941 | Bacteria | 1629 |
| 167 | Ga0207689_10000092 | 3300025942 | Bacteria | 73254 |
| 168 | Ga0207679_10008397 | 3300025945 | Bacteria | 6578 |
| 169 | Ga0207679_10465449 | 3300025945 | Bacteria | 1123 |
| 170 | Ga0207667_10110752 | 3300025949 | Bacteria | 2832 |
| 171 | Ga0207667_10127244 | 3300025949 | Bacteria | 2624 |
| 172 | Ga0207651_10000176 | 3300025960 | Bacteria | 27858 |
| 173 | Ga0207651_10091400 | 3300025960 | Bacteria | 2228 |
| 174 | Ga0207651_10211708 | 3300025960 | Bacteria | 1561 |
| 175 | Ga0207640_10000505 | 3300025981 | Bacteria | 23623 |
| 176 | Ga0207640_10038916 | 3300025981 | Bacteria | 3005 |
| 177 | Ga0207658_10002613 | 3300025986 | Bacteria | 13087 |
| 178 | Ga0207658_10035948 | 3300025986 | Bacteria | 3550 |
| 179 | Ga0207658_10078459 | 3300025986 | Bacteria | 2523 |
| 180 | Ga0207658_10095893 | 3300025986 | Bacteria | 2312 |
| 181 | Ga0207658_10209428 | 3300025986 | Bacteria | 1633 |
| 182 | Ga0207677_10000733 | 3300026023 | Bacteria | 19151 |
| 183 | Ga0207677_10021791 | 3300026023 | Bacteria | 3924 |
| 184 | Ga0207703_10000515 | 3300026035 | Bacteria | 39972 |
| 185 | Ga0207678_10055375 | 3300026067 | Bacteria | 3416 |
| 186 | Ga0207678_10085607 | 3300026067 | Bacteria | 2694 |
| 187 | Ga0207702_10018363 | 3300026078 | Bacteria | 5786 |
| 188 | Ga0207641_10024607 | 3300026088 | Bacteria | 4962 |
| 189 | Ga0207641_10173969 | 3300026088 | Bacteria | 1967 |
| 190 | Ga0207641_10329192 | 3300026088 | Bacteria | 1450 |
| 191 | Ga0207648_10002626 | 3300026089 | Bacteria | 19234 |
| 192 | Ga0207648_10441605 | 3300026089 | Bacteria | 1184 |
| 193 | Ga0207676_10003843 | 3300026095 | Bacteria | 10606 |
| 194 | Ga0207676_10009455 | 3300026095 | Bacteria | 6938 |
| 195 | Ga0207676_10096146 | 3300026095 | Bacteria | 2444 |
| 196 | Ga0207674_10001784 | 3300026116 | Bacteria | 27499 |
| 197 | Ga0207674_10002652 | 3300026116 | Bacteria | 22343 |
| 198 | Ga0207674_10005762 | 3300026116 | Bacteria | 14694 |
| 199 | Ga0207675_100044055 | 3300026118 | Bacteria | 4168 |
| 200 | Ga0207698_10055183 | 3300026142 | Bacteria | 3060 |
| 201 | Ga0207698_10200788 | 3300026142 | Bacteria | 1785 |
| 202 | Ga0268266_10000433 | 3300028379 | Bacteria | 62887 |
| 203 | Ga0268265_10016077 | 3300028380 | Bacteria | 5134 |
| 204 | Ga0268265_10055469 | 3300028380 | Bacteria | 3011 |
| 205 | Ga0268265_10225409 | 3300028380 | Bacteria | 1643 |
| 206 | Ga0268265_10266171 | 3300028380 | Bacteria | 1526 |
| 207 | Ga0268264_10018896 | 3300028381 | Bacteria | 5634 |
| 208 | Ga0268264_10036595 | 3300028381 | Bacteria | 4044 |
| 209 | Ga0265320_10002356 | 3300031240 | Bacteria | 13226 |
| 210 | Ga0307409_100082523 | 3300031995 | Bacteria | 2602 |
| 211 | Ga0307409_100251455 | 3300031995 | Bacteria | 1616 |
| 212 | Ga0307414_10031432 | 3300032004 | Bacteria | 3482 |
| 213 | Ga0307414_10342378 | 3300032004 | Bacteria | 1280 |
| 214 | Ga0307411_10068716 | 3300032005 | Bacteria | 2389 |
| 215 | Ga0373946_0009724 | 3300035171 | Bacteria | 3549 |
| 216 | Ga0373931_0010464 | 3300035691 | Bacteria | 4458 |
| 217 | Ga0373931_0073968 | 3300035691 | Bacteria | 1866 |
| 218 | Ga0373925_0018551 | 3300037068 | Bacteria | 5057 |
| 219 | Ga0395899_0000104 | 3300037312 | Bacteria | 147238 |
| 220 | Ga0395899_0020612 | 3300037312 | Bacteria | 4997 |
| 221 | Ga0395899_0026553 | 3300037312 | Bacteria | 4369 |
| 222 | Ga0395899_0030305 | 3300037312 | Bacteria | 4069 |
| 223 | Ga0395899_0068830 | 3300037312 | Bacteria | 2594 |
| 224 | Ga0395899_0141393 | 3300037312 | Bacteria | 1712 |
| 225 | Ga0395899_0171874 | 3300037312 | Bacteria | 1526 |
| 226 | Ga0395900_0000161 | 3300037418 | Bacteria | 110637 |
| 227 | Ga0395900_0000764 | 3300037418 | Bacteria | 42836 |
| 228 | Ga0395900_0005286 | 3300037418 | Bacteria | 13533 |
| 229 | Ga0395900_0017257 | 3300037418 | Bacteria | 7367 |
| 230 | Ga0395900_0019594 | 3300037418 | Bacteria | 6898 |
| 231 | Ga0395900_0046081 | 3300037418 | Bacteria | 4490 |
| 232 | Ga0395900_0049480 | 3300037418 | Bacteria | 4331 |
| 233 | Ga0395900_0052927 | 3300037418 | Bacteria | 4178 |
| 234 | Ga0395900_0054938 | 3300037418 | Bacteria | 4100 |
| 235 | Ga0395900_0070192 | 3300037418 | Bacteria | 3602 |
| 236 | Ga0395900_0078370 | 3300037418 | Bacteria | 3395 |
| 237 | Ga0395900_0180963 | 3300037418 | Bacteria | 2142 |
| 238 | Ga0395900_0184889 | 3300037418 | Bacteria | 2115 |
| 239 | Ga0395900_0304302 | 3300037418 | Bacteria | 1579 |
| 240 | Ga0395898_0000169 | 3300037466 | Bacteria | 168667 |
| 241 | Ga0395898_0001777 | 3300037466 | Bacteria | 28071 |
| 242 | Ga0395898_0011151 | 3300037466 | Bacteria | 9359 |
| 243 | Ga0395898_0017908 | 3300037466 | Bacteria | 7227 |
| 244 | Ga0395898_0022079 | 3300037466 | Bacteria | 6447 |
| 245 | Ga0395898_0026296 | 3300037466 | Bacteria | 5859 |
| 246 | Ga0395898_0029050 | 3300037466 | Bacteria | 5540 |
| 247 | Ga0395898_0062587 | 3300037466 | Bacteria | 3613 |
| 248 | Ga0395898_0073359 | 3300037466 | Bacteria | 3306 |
| 249 | Ga0395898_0130014 | 3300037466 | Bacteria | 2412 |
| 250 | Ga0395905_0000120 | 3300037471 | Bacteria | 130865 |
| 251 | Ga0395905_0000259 | 3300037471 | Bacteria | 79396 |
| 252 | Ga0395905_0001971 | 3300037471 | Bacteria | 23466 |
| 253 | Ga0395905_0004670 | 3300037471 | Bacteria | 14159 |
| 254 | Ga0395905_0012165 | 3300037471 | Bacteria | 8287 |
| 255 | Ga0395905_0014575 | 3300037471 | Bacteria | 7498 |
| 256 | Ga0395905_0017835 | 3300037471 | Bacteria | 6743 |
| 257 | Ga0395905_0024318 | 3300037471 | Bacteria | 5717 |
| 258 | Ga0395905_0030059 | 3300037471 | Bacteria | 5121 |
| 259 | Ga0395905_0048175 | 3300037471 | Bacteria | 3994 |
| 260 | Ga0395905_0049591 | 3300037471 | Bacteria | 3934 |
| 261 | Ga0395905_0067597 | 3300037471 | Bacteria | 3347 |
| 262 | Ga0395905_0075842 | 3300037471 | Bacteria | 3151 |
| 263 | Ga0395905_0108913 | 3300037471 | Bacteria | 2601 |
| 264 | Ga0395905_0125699 | 3300037471 | Bacteria | 2411 |
| 265 | Ga0395905_0130616 | 3300037471 | Bacteria | 2362 |
| 266 | Ga0395905_0188384 | 3300037471 | Bacteria | 1936 |
| 267 | Ga0395905_0266890 | 3300037471 | Bacteria | 1597 |
| 268 | Ga0395905_0304458 | 3300037471 | Bacteria | 1481 |
| 269 | Ga0395901_0000871 | 3300038443 | Bacteria | 33284 |
| 270 | Ga0395901_0004433 | 3300038443 | Bacteria | 14162 |
| 271 | Ga0395901_0009498 | 3300038443 | Bacteria | 9868 |
| 272 | Ga0395901_0009752 | 3300038443 | Bacteria | 9736 |
| 273 | Ga0395901_0009934 | 3300038443 | Bacteria | 9646 |
| 274 | Ga0395901_0012290 | 3300038443 | Bacteria | 8689 |
| 275 | Ga0395901_0046947 | 3300038443 | Bacteria | 4486 |
| 276 | Ga0395901_0060051 | 3300038443 | Bacteria | 3956 |
| 277 | Ga0395901_0061133 | 3300038443 | Bacteria | 3920 |
| 278 | Ga0395901_0061717 | 3300038443 | Bacteria | 3900 |
| 279 | Ga0395901_0075337 | 3300038443 | Bacteria | 3520 |
| 280 | Ga0395901_0079058 | 3300038443 | Bacteria | 3434 |
| 281 | Ga0395901_0128053 | 3300038443 | Bacteria | 2668 |
| 282 | Ga0395901_0233372 | 3300038443 | Bacteria | 1920 |
| 283 | Ga0395901_0308147 | 3300038443 | Bacteria | 1640 |
| 284 | Ga0436363_0315585 | 3300039450 | Bacteria | 3485 |
| 285 | Ga0436362_0840102 | 3300039453 | Bacteria | 1254 |
| 286 | Ga0451839_0533358 | 3300041496 | Bacteria | 1201 |
| 287 | Ga0450923_033078 | 3300042125 | Bacteria | 1062 |
| 288 | Ga0439458_0005338 | 3300042157 | Bacteria | 2891 |
| 289 | Ga0495606_0000515 | 3300046507 | Bacteria | 62746 |
| 290 | Ga0495621_0000065 | 3300046539 | Bacteria | 20486 |
| 291 | Ga0495625_0068679 | 3300046660 | Bacteria | 2491 |
| 292 | Ga0495669_0008292 | 3300046684 | Bacteria | 4364 |
| 293 | Ga0495669_0013613 | 3300046684 | Bacteria | 3470 |
| 294 | Ga0495669_0199361 | 3300046684 | Bacteria | 956 |
| 295 | Ga0495670_0002737 | 3300046691 | Bacteria | 8708 |
| 296 | Ga0495670_0054797 | 3300046691 | Bacteria | 1999 |
| 297 | Ga0495677_0018925 | 3300047445 | Bacteria | 2497 |
| 298 | Ga0495673_0041356 | 3300047469 | Bacteria | 2075 |
| 299 | Ga0495686_0007753 | 3300047472 | Bacteria | 7997 |
| 300 | Ga0496104_0122677 | 3300048907 | Bacteria | 2495 |
| 301 | Ga0496105_0038427 | 3300048908 | Bacteria | 3943 |
| 302 | Ga0496107_0301097 | 3300048910 | Bacteria | 1193 |
| 303 | Ga0496108_0003827 | 3300048911 | Bacteria | 12062 |
| 304 | Ga0496109_0002819 | 3300048912 | Bacteria | 14559 |
| 305 | Ga0496109_0068375 | 3300048912 | Bacteria | 3256 |
| 306 | Ga0496110_0140766 | 3300048913 | Bacteria | 2181 |
| 307 | Ga0496111_0007796 | 3300048914 | Bacteria | 7049 |
| 308 | Ga0496111_0048811 | 3300048914 | Bacteria | 3051 |
| 309 | Ga0496112_0011332 | 3300048915 | Bacteria | 8137 |
| 310 | Ga0496112_0059400 | 3300048915 | Bacteria | 3767 |
| 311 | Ga0496112_0063902 | 3300048915 | Bacteria | 3631 |
| 312 | Ga0496112_0223854 | 3300048915 | Bacteria | 1837 |
| 313 | Ga0496113_0017268 | 3300048916 | Bacteria | 5004 |
| 314 | Ga0496114_0000206 | 3300048917 | Bacteria | 42865 |
| 315 | Ga0496115_0016248 | 3300048918 | Bacteria | 5663 |
| 316 | Ga0496117_0036042 | 3300048920 | Bacteria | 3706 |
| 317 | Ga0496118_0031843 | 3300048921 | Bacteria | 4361 |
| 318 | Ga0496122_0001301 | 3300048925 | Bacteria | 41201 |
| 319 | Ga0496123_0002730 | 3300048926 | Bacteria | 21167 |
| 320 | Ga0496124_0045511 | 3300048927 | Bacteria | 3761 |
| 321 | Ga0501080_0156178 | 3300049742 | Bacteria | 2107 |
| 322 | nmdc:mga0k408_113332_c1 | 3300050493 | Bacteria | 1603 |
| 323 | Ga0500566_0156972 | 3300053094 | Bacteria | 1190 |
| 324 | Ga0500608_058303 | 3300053122 | Bacteria | 1849 |
| 325 | Ga0500559_0014141 | 3300053136 | Bacteria | 3374 |
| 326 | Ga0500559_0090975 | 3300053136 | Bacteria | 1397 |
| 327 | Ga0500616_0020319 | 3300053153 | Bacteria | 3731 |
| 328 | Ga0500622_0059297 | 3300053156 | Bacteria | 1955 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031240 | Ga0265320_10002356 | Ga0265320_100023568 | 250 |
| 2 | 3300005330 | Ga0070690_100008375 | Ga0070690_1000083753 | 267 |
| 3 | 3300005335 | Ga0070666_10000822 | Ga0070666_100008222 | 267 |
| 4 | 3300005338 | Ga0068868_100001262 | Ga0068868_10000126212 | 267 |
| 5 | 3300005343 | Ga0070687_100018134 | Ga0070687_1000181342 | 267 |
| 6 | 3300005355 | Ga0070671_100051763 | Ga0070671_1000517633 | 267 |
| 7 | 3300005356 | Ga0070674_100251577 | Ga0070674_1002515772 | 267 |
| 8 | 3300005367 | Ga0070667_100001584 | Ga0070667_1000015843 | 267 |
| 9 | 3300005543 | Ga0070672_100230098 | Ga0070672_1002300982 | 267 |
| 10 | 3300005842 | Ga0068858_100001945 | Ga0068858_1000019453 | 267 |
| 11 | 3300006237 | Ga0097621_100217354 | Ga0097621_1002173542 | 267 |
| 12 | 3300009098 | Ga0105245_10240987 | Ga0105245_102409872 | 267 |
| 13 | 3300009177 | Ga0105248_10002422 | Ga0105248_1000242219 | 267 |
| 14 | 3300014968 | Ga0157379_10142572 | Ga0157379_101425722 | 267 |
| 15 | 3300025903 | Ga0207680_10000361 | Ga0207680_100003619 | 267 |
| 16 | 3300025904 | Ga0207647_10006605 | Ga0207647_100066053 | 267 |
| 17 | 3300025931 | Ga0207644_10054018 | Ga0207644_100540183 | 267 |
| 18 | 3300025933 | Ga0207706_10061770 | Ga0207706_100617704 | 267 |
| 19 | 3300025937 | Ga0207669_10287479 | Ga0207669_102874792 | 267 |
| 20 | 3300025940 | Ga0207691_10279903 | Ga0207691_102799032 | 267 |
| 21 | 3300025941 | Ga0207711_10004452 | Ga0207711_100044529 | 267 |
| 22 | 3300025960 | Ga0207651_10091400 | Ga0207651_100914003 | 267 |
| 23 | 3300025986 | Ga0207658_10078459 | Ga0207658_100784592 | 267 |
| 24 | 3300026023 | Ga0207677_10000733 | Ga0207677_100007332 | 267 |
| 25 | 3300026035 | Ga0207703_10000515 | Ga0207703_1000051519 | 267 |
| 26 | 3300026089 | Ga0207648_10441605 | Ga0207648_104416052 | 267 |
| 27 | 3300026142 | Ga0207698_10200788 | Ga0207698_102007882 | 267 |
| 28 | 3300048915 | Ga0496112_0223854 | Ga0496112_0223854_330_1214 | 267 |
| 29 | 3300053094 | Ga0500566_0156972 | Ga0500566_0156972_284_1180 | 268 |
| 30 | 3300053136 | Ga0500559_0090975 | Ga0500559_0090975_11_838 | 268 |
| 31 | 3300049742 | Ga0501080_0156178 | Ga0501080_0156178_1108_1953 | 270 |
| 32 | 3300025904 | Ga0207647_10025061 | Ga0207647_100250615 | 271 |
| 33 | 3300025932 | Ga0207690_10004279 | Ga0207690_100042793 | 271 |
| 34 | 3300035691 | Ga0373931_0073968 | Ga0373931_0073968_526_1362 | 272 |
| 35 | 3300035691 | Ga0373931_0010464 | Ga0373931_0010464_3397_4287 | 273 |
| 36 | 3300046539 | Ga0495621_0000065 | Ga0495621_0000065_8894_9778 | 273 |
| 37 | 3300046684 | Ga0495669_0008292 | Ga0495669_0008292_1517_2401 | 273 |
| 38 | 3300046691 | Ga0495670_0002737 | Ga0495670_0002737_478_1362 | 273 |
| 39 | 3300005355 | Ga0070671_100011082 | Ga0070671_1000110825 | 275 |
| 40 | 3300005364 | Ga0070673_100021148 | Ga0070673_1000211485 | 275 |
| 41 | 3300005364 | Ga0070673_100024724 | Ga0070673_1000247245 | 275 |
| 42 | 3300013308 | Ga0157375_10186067 | Ga0157375_101860672 | 275 |
| 43 | 3300025931 | Ga0207644_10015905 | Ga0207644_100159054 | 275 |
| 44 | 3300025960 | Ga0207651_10211708 | Ga0207651_102117082 | 275 |
| 45 | 3300037466 | Ga0395898_0026296 | Ga0395898_0026296_3563_4402 | 275 |
| 46 | 3300037471 | Ga0395905_0048175 | Ga0395905_0048175_323_1162 | 275 |
| 47 | 3300038443 | Ga0395901_0075337 | Ga0395901_0075337_1193_2032 | 275 |
| 48 | 3300053122 | Ga0500608_058303 | Ga0500608_058303_27_950 | 275 |
| 49 | 3300032004 | Ga0307414_10031432 | Ga0307414_100314322 | 276 |
| 50 | 3300048907 | Ga0496104_0122677 | Ga0496104_0122677_353_1255 | 276 |
| 51 | 3300048915 | Ga0496112_0011332 | Ga0496112_0011332_6721_7584 | 276 |
| 52 | 3300050493 | nmdc:mga0k408_113332_c1 | nmdc:mga0k408_113332_c1_456_1298 | 276 |
| 53 | 3300005367 | Ga0070667_100183014 | Ga0070667_1001830142 | 277 |
| 54 | 3300005844 | Ga0068862_100024428 | Ga0068862_1000244283 | 277 |
| 55 | 3300013306 | Ga0163162_10431674 | Ga0163162_104316741 | 277 |
| 56 | 3300014325 | Ga0163163_10027336 | Ga0163163_100273362 | 277 |
| 57 | 3300025938 | Ga0207704_10128803 | Ga0207704_101288032 | 277 |
| 58 | 3300025986 | Ga0207658_10035948 | Ga0207658_100359483 | 277 |
| 59 | 3300028380 | Ga0268265_10016077 | Ga0268265_100160773 | 277 |
| 60 | 3300037312 | Ga0395899_0141393 | Ga0395899_0141393_341_1186 | 277 |
| 61 | 3300037471 | Ga0395905_0304458 | Ga0395905_0304458_504_1349 | 277 |
| 62 | 3300038443 | Ga0395901_0308147 | Ga0395901_0308147_781_1626 | 277 |
| 63 | 3300048910 | Ga0496107_0301097 | Ga0496107_0301097_57_914 | 277 |
| 64 | 3300048918 | Ga0496115_0016248 | Ga0496115_0016248_431_1294 | 278 |
| 65 | 3300005334 | Ga0068869_100267747 | Ga0068869_1002677472 | 279 |
| 66 | 3300005564 | Ga0070664_100124956 | Ga0070664_1001249564 | 279 |
| 67 | 3300005577 | Ga0068857_100045038 | Ga0068857_1000450383 | 279 |
| 68 | 3300005617 | Ga0068859_100002194 | Ga0068859_10000219418 | 279 |
| 69 | 3300005618 | Ga0068864_100021046 | Ga0068864_1000210465 | 279 |
| 70 | 3300005841 | Ga0068863_100066192 | Ga0068863_1000661923 | 279 |
| 71 | 3300005842 | Ga0068858_100260107 | Ga0068858_1002601071 | 279 |
| 72 | 3300005843 | Ga0068860_100032717 | Ga0068860_1000327173 | 279 |
| 73 | 3300005844 | Ga0068862_100099897 | Ga0068862_1000998972 | 279 |
| 74 | 3300006931 | Ga0097620_100002194 | Ga0097620_10000219418 | 279 |
| 75 | 3300009148 | Ga0105243_10195022 | Ga0105243_101950222 | 279 |
| 76 | 3300046691 | Ga0495670_0054797 | Ga0495670_0054797_224_1111 | 279 |
| 77 | 3300048908 | Ga0496105_0038427 | Ga0496105_0038427_81_965 | 279 |
| 78 | 3300025923 | Ga0207681_10056667 | Ga0207681_100566672 | 280 |
| 79 | 3300025945 | Ga0207679_10465449 | Ga0207679_104654491 | 280 |
| 80 | 3300026067 | Ga0207678_10055375 | Ga0207678_100553753 | 280 |
| 81 | 3300026088 | Ga0207641_10329192 | Ga0207641_103291922 | 280 |
| 82 | 3300026095 | Ga0207676_10009455 | Ga0207676_100094553 | 280 |
| 83 | 3300026116 | Ga0207674_10005762 | Ga0207674_1000576217 | 280 |
| 84 | 3300028380 | Ga0268265_10266171 | Ga0268265_102661712 | 280 |
| 85 | 3300028381 | Ga0268264_10036595 | Ga0268264_100365955 | 280 |
| 86 | 3300005564 | Ga0070664_100438472 | Ga0070664_1004384722 | 282 |
| 87 | 3300006195 | Ga0075366_10047721 | Ga0075366_100477212 | 282 |
| 88 | 3300031995 | Ga0307409_100251455 | Ga0307409_1002514551 | 282 |
| 89 | 3300042125 | Ga0450923_033078 | Ga0450923_033078_135_1028 | 282 |
| 90 | 3300001990 | JGI24737J22298_10003110 | JGI24737J22298_100031106 | 283 |
| 91 | 3300005335 | Ga0070666_10018914 | Ga0070666_100189142 | 283 |
| 92 | 3300005339 | Ga0070660_100333712 | Ga0070660_1003337122 | 283 |
| 93 | 3300005366 | Ga0070659_100023518 | Ga0070659_1000235184 | 283 |
| 94 | 3300005367 | Ga0070667_100164035 | Ga0070667_1001640352 | 283 |
| 95 | 3300005577 | Ga0068857_100068273 | Ga0068857_1000682731 | 283 |
| 96 | 3300005841 | Ga0068863_100018083 | Ga0068863_1000180832 | 283 |
| 97 | 3300005937 | Ga0081455_10320614 | Ga0081455_103206142 | 283 |
| 98 | 3300009098 | Ga0105245_10914769 | Ga0105245_109147691 | 283 |
| 99 | 3300025903 | Ga0207680_10186401 | Ga0207680_101864012 | 283 |
| 100 | 3300025904 | Ga0207647_10034571 | Ga0207647_100345712 | 283 |
| 101 | 3300025919 | Ga0207657_10214205 | Ga0207657_102142052 | 283 |
| 102 | 3300025925 | Ga0207650_10026983 | Ga0207650_100269834 | 283 |
| 103 | 3300025932 | Ga0207690_10016678 | Ga0207690_100166783 | 283 |
| 104 | 3300025986 | Ga0207658_10209428 | Ga0207658_102094282 | 283 |
| 105 | 3300026088 | Ga0207641_10173969 | Ga0207641_101739692 | 283 |
| 106 | 3300026116 | Ga0207674_10002652 | Ga0207674_1000265225 | 283 |
| 107 | 3300037418 | Ga0395900_0017257 | Ga0395900_0017257_782_1657 | 283 |
| 108 | 3300037418 | Ga0395900_0019594 | Ga0395900_0019594_3838_4716 | 283 |
| 109 | 3300037418 | Ga0395900_0180963 | Ga0395900_0180963_202_1077 | 283 |
| 110 | 3300037466 | Ga0395898_0001777 | Ga0395898_0001777_233_1111 | 283 |
| 111 | 3300037466 | Ga0395898_0062587 | Ga0395898_0062587_2119_3003 | 283 |
| 112 | 3300037466 | Ga0395898_0130014 | Ga0395898_0130014_292_1167 | 283 |
| 113 | 3300037471 | Ga0395905_0012165 | Ga0395905_0012165_6605_7480 | 283 |
| 114 | 3300037471 | Ga0395905_0014575 | Ga0395905_0014575_4987_5862 | 283 |
| 115 | 3300037471 | Ga0395905_0067597 | Ga0395905_0067597_2333_3211 | 283 |
| 116 | 3300037471 | Ga0395905_0125699 | Ga0395905_0125699_49_924 | 283 |
| 117 | 3300037471 | Ga0395905_0188384 | Ga0395905_0188384_1011_1922 | 283 |
| 118 | 3300038443 | Ga0395901_0004433 | Ga0395901_0004433_4683_5561 | 283 |
| 119 | 3300038443 | Ga0395901_0009934 | Ga0395901_0009934_1293_2168 | 283 |
| 120 | 3300038443 | Ga0395901_0060051 | Ga0395901_0060051_1000_1911 | 283 |
| 121 | 3300038443 | Ga0395901_0128053 | Ga0395901_0128053_1242_2126 | 283 |
| 122 | 3300039450 | Ga0436363_0315585 | Ga0436363_0315585_2526_3419 | 283 |
| 123 | 3300041496 | Ga0451839_0533358 | Ga0451839_0533358_101_1018 | 283 |
| 124 | 3300005355 | Ga0070671_100043320 | Ga0070671_1000433203 | 284 |
| 125 | 3300005614 | Ga0068856_100045067 | Ga0068856_1000450671 | 284 |
| 126 | 3300013296 | Ga0157374_10115260 | Ga0157374_101152603 | 284 |
| 127 | 3300013296 | Ga0157374_10180935 | Ga0157374_101809352 | 284 |
| 128 | 3300014968 | Ga0157379_10145163 | Ga0157379_101451634 | 284 |
| 129 | 3300025931 | Ga0207644_10108302 | Ga0207644_101083022 | 284 |
| 130 | 3300025931 | Ga0207644_10197507 | Ga0207644_101975072 | 284 |
| 131 | 3300025941 | Ga0207711_10079336 | Ga0207711_100793363 | 284 |
| 132 | 3300026078 | Ga0207702_10018363 | Ga0207702_100183635 | 284 |
| 133 | 3300028380 | Ga0268265_10055469 | Ga0268265_100554692 | 284 |
| 134 | 3300037418 | Ga0395900_0070192 | Ga0395900_0070192_314_1201 | 284 |
| 135 | 3300046684 | Ga0495669_0199361 | Ga0495669_0199361_22_903 | 284 |
| 136 | 3300048912 | Ga0496109_0002819 | Ga0496109_0002819_4492_5358 | 284 |
| 137 | 3300048913 | Ga0496110_0140766 | Ga0496110_0140766_265_1131 | 284 |
| 138 | 3300048914 | Ga0496111_0007796 | Ga0496111_0007796_5771_6637 | 284 |
| 139 | 3300048915 | Ga0496112_0063902 | Ga0496112_0063902_1116_1982 | 284 |
| 140 | 3300031995 | Ga0307409_100082523 | Ga0307409_1000825232 | 285 |
| 141 | 3300032004 | Ga0307414_10342378 | Ga0307414_103423782 | 285 |
| 142 | 3300032005 | Ga0307411_10068716 | Ga0307411_100687162 | 285 |
| 143 | 3300005367 | Ga0070667_100097106 | Ga0070667_1000971063 | 286 |
| 144 | 3300005434 | Ga0070709_10071452 | Ga0070709_100714522 | 286 |
| 145 | 3300005435 | Ga0070714_100022755 | Ga0070714_1000227556 | 286 |
| 146 | 3300005436 | Ga0070713_100008541 | Ga0070713_1000085412 | 286 |
| 147 | 3300005436 | Ga0070713_100454901 | Ga0070713_1004549012 | 286 |
| 148 | 3300005578 | Ga0068854_100065295 | Ga0068854_1000652955 | 286 |
| 149 | 3300005614 | Ga0068856_100168970 | Ga0068856_1001689702 | 286 |
| 150 | 3300006028 | Ga0070717_10076249 | Ga0070717_100762492 | 286 |
| 151 | 3300006175 | Ga0070712_100019273 | Ga0070712_1000192734 | 286 |
| 152 | 3300006175 | Ga0070712_100089683 | Ga0070712_1000896832 | 286 |
| 153 | 3300009093 | Ga0105240_10003147 | Ga0105240_100031479 | 286 |
| 154 | 3300013100 | Ga0157373_10053929 | Ga0157373_100539292 | 286 |
| 155 | 3300013105 | Ga0157369_10016207 | Ga0157369_100162075 | 286 |
| 156 | 3300013296 | Ga0157374_10004895 | Ga0157374_100048957 | 286 |
| 157 | 3300025904 | Ga0207647_10027695 | Ga0207647_100276952 | 286 |
| 158 | 3300025906 | Ga0207699_10006551 | Ga0207699_100065517 | 286 |
| 159 | 3300025913 | Ga0207695_10002317 | Ga0207695_1000231716 | 286 |
| 160 | 3300025915 | Ga0207693_10031706 | Ga0207693_100317064 | 286 |
| 161 | 3300025915 | Ga0207693_10109937 | Ga0207693_101099372 | 286 |
| 162 | 3300025929 | Ga0207664_10340420 | Ga0207664_103404202 | 286 |
| 163 | 3300025939 | Ga0207665_10102468 | Ga0207665_101024682 | 286 |
| 164 | 3300025981 | Ga0207640_10000505 | Ga0207640_100005058 | 286 |
| 165 | 3300025986 | Ga0207658_10095893 | Ga0207658_100958933 | 286 |
| 166 | 3300028379 | Ga0268266_10000433 | Ga0268266_1000043315 | 286 |
| 167 | 3300037418 | Ga0395900_0000764 | Ga0395900_0000764_11503_12429 | 286 |
| 168 | 3300037466 | Ga0395898_0011151 | Ga0395898_0011151_5440_6339 | 286 |
| 169 | 3300037466 | Ga0395898_0073359 | Ga0395898_0073359_1953_2879 | 286 |
| 170 | 3300037471 | Ga0395905_0000259 | Ga0395905_0000259_47859_48758 | 286 |
| 171 | 3300037471 | Ga0395905_0004670 | Ga0395905_0004670_4204_5130 | 286 |
| 172 | 3300037471 | Ga0395905_0130616 | Ga0395905_0130616_1120_2019 | 286 |
| 173 | 3300038443 | Ga0395901_0233372 | Ga0395901_0233372_444_1370 | 286 |
| 174 | 3300039453 | Ga0436362_0840102 | Ga0436362_0840102_186_1085 | 286 |
| 175 | 3300048911 | Ga0496108_0003827 | Ga0496108_0003827_5945_6856 | 286 |
| 176 | 3300048917 | Ga0496114_0000206 | Ga0496114_0000206_20888_21787 | 286 |
| 177 | 3300005434 | Ga0070709_10182620 | Ga0070709_101826201 | 287 |
| 178 | 3300005435 | Ga0070714_100109596 | Ga0070714_1001095962 | 287 |
| 179 | 3300005563 | Ga0068855_100152150 | Ga0068855_1001521503 | 287 |
| 180 | 3300005985 | Ga0081539_10054597 | Ga0081539_100545972 | 287 |
| 181 | 3300025928 | Ga0207700_10044637 | Ga0207700_100446372 | 287 |
| 182 | 3300025929 | Ga0207664_10151902 | Ga0207664_101519022 | 287 |
| 183 | 3300025949 | Ga0207667_10110752 | Ga0207667_101107522 | 287 |
| 184 | 3300037418 | Ga0395900_0046081 | Ga0395900_0046081_1749_2651 | 287 |
| 185 | 3300037418 | Ga0395900_0184889 | Ga0395900_0184889_743_1675 | 287 |
| 186 | 3300037466 | Ga0395898_0022079 | Ga0395898_0022079_4773_5705 | 287 |
| 187 | 3300037471 | Ga0395905_0030059 | Ga0395905_0030059_3583_4515 | 287 |
| 188 | 3300037471 | Ga0395905_0049591 | Ga0395905_0049591_2545_3447 | 287 |
| 189 | 3300038443 | Ga0395901_0012290 | Ga0395901_0012290_5620_6522 | 287 |
| 190 | 3300038443 | Ga0395901_0061717 | Ga0395901_0061717_1910_2842 | 287 |
| 191 | 3300046507 | Ga0495606_0000515 | Ga0495606_0000515_27705_28631 | 287 |
| 192 | 3300053153 | Ga0500616_0020319 | Ga0500616_0020319_2001_2900 | 287 |
| 193 | 3300053156 | Ga0500622_0059297 | Ga0500622_0059297_994_1893 | 287 |
| 194 | 3300005355 | Ga0070671_100046826 | Ga0070671_1000468262 | 288 |
| 195 | 3300005547 | Ga0070693_100338474 | Ga0070693_1003384741 | 288 |
| 196 | 3300035171 | Ga0373946_0009724 | Ga0373946_0009724_38_928 | 288 |
| 197 | 3300037068 | Ga0373925_0018551 | Ga0373925_0018551_159_1049 | 288 |
| 198 | 3300037312 | Ga0395899_0020612 | Ga0395899_0020612_3182_4087 | 288 |
| 199 | 3300037312 | Ga0395899_0026553 | Ga0395899_0026553_2472_3377 | 288 |
| 200 | 3300037312 | Ga0395899_0171874 | Ga0395899_0171874_203_1108 | 288 |
| 201 | 3300037418 | Ga0395900_0005286 | Ga0395900_0005286_8176_9081 | 288 |
| 202 | 3300037418 | Ga0395900_0049480 | Ga0395900_0049480_1353_2258 | 288 |
| 203 | 3300037418 | Ga0395900_0052927 | Ga0395900_0052927_2363_3268 | 288 |
| 204 | 3300037466 | Ga0395898_0017908 | Ga0395898_0017908_5258_6163 | 288 |
| 205 | 3300037466 | Ga0395898_0029050 | Ga0395898_0029050_2937_3842 | 288 |
| 206 | 3300037471 | Ga0395905_0001971 | Ga0395905_0001971_11044_11949 | 288 |
| 207 | 3300037471 | Ga0395905_0017835 | Ga0395905_0017835_1664_2569 | 288 |
| 208 | 3300037471 | Ga0395905_0108913 | Ga0395905_0108913_278_1171 | 288 |
| 209 | 3300037471 | Ga0395905_0266890 | Ga0395905_0266890_230_1114 | 288 |
| 210 | 3300038443 | Ga0395901_0009752 | Ga0395901_0009752_1073_1978 | 288 |
| 211 | 3300038443 | Ga0395901_0061133 | Ga0395901_0061133_1476_2381 | 288 |
| 212 | 3300042157 | Ga0439458_0005338 | Ga0439458_0005338_17_922 | 288 |
| 213 | 3300001979 | JGI24740J21852_10001623 | JGI24740J21852_100016235 | 289 |
| 214 | 3300001989 | JGI24739J22299_10000129 | JGI24739J22299_1000012926 | 289 |
| 215 | 3300001990 | JGI24737J22298_10000508 | JGI24737J22298_100005087 | 289 |
| 216 | 3300002075 | JGI24738J21930_10000498 | JGI24738J21930_1000049810 | 289 |
| 217 | 3300002077 | JGI24744J21845_10034267 | JGI24744J21845_100342671 | 289 |
| 218 | 3300005328 | Ga0070676_10004537 | Ga0070676_100045375 | 289 |
| 219 | 3300005330 | Ga0070690_100019537 | Ga0070690_1000195376 | 289 |
| 220 | 3300005333 | Ga0070677_10037914 | Ga0070677_100379142 | 289 |
| 221 | 3300005334 | Ga0068869_100003385 | Ga0068869_1000033857 | 289 |
| 222 | 3300005335 | Ga0070666_10225822 | Ga0070666_102258221 | 289 |
| 223 | 3300005338 | Ga0068868_100000156 | Ga0068868_10000015617 | 289 |
| 224 | 3300005339 | Ga0070660_100018877 | Ga0070660_1000188773 | 289 |
| 225 | 3300005343 | Ga0070687_100230253 | Ga0070687_1002302532 | 289 |
| 226 | 3300005353 | Ga0070669_100000383 | Ga0070669_10000038320 | 289 |
| 227 | 3300005355 | Ga0070671_100017150 | Ga0070671_1000171504 | 289 |
| 228 | 3300005355 | Ga0070671_100048870 | Ga0070671_1000488702 | 289 |
| 229 | 3300005355 | Ga0070671_100190282 | Ga0070671_1001902822 | 289 |
| 230 | 3300005356 | Ga0070674_100023056 | Ga0070674_1000230563 | 289 |
| 231 | 3300005364 | Ga0070673_100000249 | Ga0070673_1000002497 | 289 |
| 232 | 3300005364 | Ga0070673_100089115 | Ga0070673_1000891153 | 289 |
| 233 | 3300005366 | Ga0070659_100000814 | Ga0070659_10000081423 | 289 |
| 234 | 3300005367 | Ga0070667_100007007 | Ga0070667_1000070072 | 289 |
| 235 | 3300005457 | Ga0070662_100017121 | Ga0070662_1000171216 | 289 |
| 236 | 3300005459 | Ga0068867_100000388 | Ga0068867_10000038811 | 289 |
| 237 | 3300005539 | Ga0068853_100012691 | Ga0068853_1000126917 | 289 |
| 238 | 3300005543 | Ga0070672_100003048 | Ga0070672_1000030483 | 289 |
| 239 | 3300005563 | Ga0068855_100143903 | Ga0068855_1001439033 | 289 |
| 240 | 3300005577 | Ga0068857_100000282 | Ga0068857_10000028219 | 289 |
| 241 | 3300005578 | Ga0068854_100001950 | Ga0068854_10000195010 | 289 |
| 242 | 3300005614 | Ga0068856_100134130 | Ga0068856_1001341302 | 289 |
| 243 | 3300005616 | Ga0068852_100107006 | Ga0068852_1001070062 | 289 |
| 244 | 3300005618 | Ga0068864_100063138 | Ga0068864_1000631383 | 289 |
| 245 | 3300005719 | Ga0068861_100030231 | Ga0068861_1000302313 | 289 |
| 246 | 3300005842 | Ga0068858_100101629 | Ga0068858_1001016293 | 289 |
| 247 | 3300005843 | Ga0068860_100025363 | Ga0068860_1000253633 | 289 |
| 248 | 3300005844 | Ga0068862_100096506 | Ga0068862_1000965062 | 289 |
| 249 | 3300005985 | Ga0081539_10035823 | Ga0081539_100358232 | 289 |
| 250 | 3300006358 | Ga0068871_100333811 | Ga0068871_1003338112 | 289 |
| 251 | 3300006881 | Ga0068865_100004164 | Ga0068865_1000041645 | 289 |
| 252 | 3300009098 | Ga0105245_10000326 | Ga0105245_100003262 | 289 |
| 253 | 3300009177 | Ga0105248_10000159 | Ga0105248_1000015976 | 289 |
| 254 | 3300009177 | Ga0105248_10205614 | Ga0105248_102056142 | 289 |
| 255 | 3300010375 | Ga0105239_10527380 | Ga0105239_105273802 | 289 |
| 256 | 3300011119 | Ga0105246_10011884 | Ga0105246_100118843 | 289 |
| 257 | 3300013100 | Ga0157373_10024145 | Ga0157373_100241456 | 289 |
| 258 | 3300013102 | Ga0157371_10008372 | Ga0157371_100083723 | 289 |
| 259 | 3300013297 | Ga0157378_10001240 | Ga0157378_1000124014 | 289 |
| 260 | 3300013306 | Ga0163162_10212204 | Ga0163162_102122042 | 289 |
| 261 | 3300013307 | Ga0157372_10129669 | Ga0157372_101296692 | 289 |
| 262 | 3300013308 | Ga0157375_10038697 | Ga0157375_100386975 | 289 |
| 263 | 3300025315 | Ga0207697_10000727 | Ga0207697_100007273 | 289 |
| 264 | 3300025893 | Ga0207682_10069874 | Ga0207682_100698742 | 289 |
| 265 | 3300025904 | Ga0207647_10004783 | Ga0207647_100047836 | 289 |
| 266 | 3300025907 | Ga0207645_10008056 | Ga0207645_100080565 | 289 |
| 267 | 3300025909 | Ga0207705_10007104 | Ga0207705_100071044 | 289 |
| 268 | 3300025918 | Ga0207662_10250070 | Ga0207662_102500701 | 289 |
| 269 | 3300025919 | Ga0207657_10038464 | Ga0207657_100384644 | 289 |
| 270 | 3300025919 | Ga0207657_10127722 | Ga0207657_101277222 | 289 |
| 271 | 3300025923 | Ga0207681_10041863 | Ga0207681_100418632 | 289 |
| 272 | 3300025924 | Ga0207694_10025973 | Ga0207694_100259732 | 289 |
| 273 | 3300025925 | Ga0207650_10005054 | Ga0207650_100050546 | 289 |
| 274 | 3300025927 | Ga0207687_10002526 | Ga0207687_1000252614 | 289 |
| 275 | 3300025931 | Ga0207644_10004695 | Ga0207644_100046955 | 289 |
| 276 | 3300025932 | Ga0207690_10004102 | Ga0207690_100041022 | 289 |
| 277 | 3300025933 | Ga0207706_10007443 | Ga0207706_100074439 | 289 |
| 278 | 3300025938 | Ga0207704_10143647 | Ga0207704_101436472 | 289 |
| 279 | 3300025940 | Ga0207691_10002930 | Ga0207691_100029306 | 289 |
| 280 | 3300025941 | Ga0207711_10152659 | Ga0207711_101526592 | 289 |
| 281 | 3300025941 | Ga0207711_10249584 | Ga0207711_102495842 | 289 |
| 282 | 3300025942 | Ga0207689_10000092 | Ga0207689_1000009256 | 289 |
| 283 | 3300025945 | Ga0207679_10008397 | Ga0207679_100083975 | 289 |
| 284 | 3300025949 | Ga0207667_10127244 | Ga0207667_101272442 | 289 |
| 285 | 3300025960 | Ga0207651_10000176 | Ga0207651_1000017625 | 289 |
| 286 | 3300025981 | Ga0207640_10038916 | Ga0207640_100389162 | 289 |
| 287 | 3300025986 | Ga0207658_10002613 | Ga0207658_100026137 | 289 |
| 288 | 3300026023 | Ga0207677_10021791 | Ga0207677_100217914 | 289 |
| 289 | 3300026067 | Ga0207678_10085607 | Ga0207678_100856074 | 289 |
| 290 | 3300026088 | Ga0207641_10024607 | Ga0207641_100246075 | 289 |
| 291 | 3300026089 | Ga0207648_10002626 | Ga0207648_100026263 | 289 |
| 292 | 3300026095 | Ga0207676_10003843 | Ga0207676_100038437 | 289 |
| 293 | 3300026095 | Ga0207676_10096146 | Ga0207676_100961462 | 289 |
| 294 | 3300026116 | Ga0207674_10001784 | Ga0207674_100017849 | 289 |
| 295 | 3300026118 | Ga0207675_100044055 | Ga0207675_1000440553 | 289 |
| 296 | 3300026142 | Ga0207698_10055183 | Ga0207698_100551832 | 289 |
| 297 | 3300028380 | Ga0268265_10225409 | Ga0268265_102254092 | 289 |
| 298 | 3300028381 | Ga0268264_10018896 | Ga0268264_100188963 | 289 |
| 299 | 3300037312 | Ga0395899_0000104 | Ga0395899_0000104_100568_101470 | 289 |
| 300 | 3300037312 | Ga0395899_0030305 | Ga0395899_0030305_2559_3446 | 289 |
| 301 | 3300037312 | Ga0395899_0068830 | Ga0395899_0068830_985_1893 | 289 |
| 302 | 3300037418 | Ga0395900_0000161 | Ga0395900_0000161_26672_27574 | 289 |
| 303 | 3300037418 | Ga0395900_0054938 | Ga0395900_0054938_1436_2323 | 289 |
| 304 | 3300037418 | Ga0395900_0078370 | Ga0395900_0078370_2387_3274 | 289 |
| 305 | 3300037418 | Ga0395900_0304302 | Ga0395900_0304302_218_1126 | 289 |
| 306 | 3300037466 | Ga0395898_0000169 | Ga0395898_0000169_113504_114406 | 289 |
| 307 | 3300037471 | Ga0395905_0000120 | Ga0395905_0000120_26860_27762 | 289 |
| 308 | 3300037471 | Ga0395905_0024318 | Ga0395905_0024318_4275_5162 | 289 |
| 309 | 3300037471 | Ga0395905_0075842 | Ga0395905_0075842_710_1597 | 289 |
| 310 | 3300038443 | Ga0395901_0000871 | Ga0395901_0000871_7921_8823 | 289 |
| 311 | 3300038443 | Ga0395901_0009498 | Ga0395901_0009498_912_1799 | 289 |
| 312 | 3300038443 | Ga0395901_0046947 | Ga0395901_0046947_3438_4346 | 289 |
| 313 | 3300038443 | Ga0395901_0079058 | Ga0395901_0079058_629_1516 | 289 |
| 314 | 3300046660 | Ga0495625_0068679 | Ga0495625_0068679_1310_2197 | 289 |
| 315 | 3300046684 | Ga0495669_0013613 | Ga0495669_0013613_79_966 | 289 |
| 316 | 3300047445 | Ga0495677_0018925 | Ga0495677_0018925_990_1877 | 289 |
| 317 | 3300047469 | Ga0495673_0041356 | Ga0495673_0041356_919_1845 | 289 |
| 318 | 3300047472 | Ga0495686_0007753 | Ga0495686_0007753_1603_2550 | 289 |
| 319 | 3300048912 | Ga0496109_0068375 | Ga0496109_0068375_1264_2157 | 289 |
| 320 | 3300048914 | Ga0496111_0048811 | Ga0496111_0048811_752_1705 | 289 |
| 321 | 3300048915 | Ga0496112_0059400 | Ga0496112_0059400_1312_2205 | 289 |
| 322 | 3300048916 | Ga0496113_0017268 | Ga0496113_0017268_2772_3665 | 289 |
| 323 | 3300048920 | Ga0496117_0036042 | Ga0496117_0036042_559_1494 | 289 |
| 324 | 3300048921 | Ga0496118_0031843 | Ga0496118_0031843_2810_3745 | 289 |
| 325 | 3300048925 | Ga0496122_0001301 | Ga0496122_0001301_28637_29590 | 289 |
| 326 | 3300048926 | Ga0496123_0002730 | Ga0496123_0002730_13333_14286 | 289 |
| 327 | 3300048927 | Ga0496124_0045511 | Ga0496124_0045511_1288_2241 | 289 |
| 328 | 3300053136 | Ga0500559_0014141 | Ga0500559_0014141_130_1077 | 289 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dma-assembly4.cif.gz_G | dhd15_closed | 0.691 | 147 | 209 |
| 2kkn-assembly1.cif.gz_A | solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 | 0.683 | 34 | 269 |
| 1s3l-assembly1.cif.gz_A | structural and functional characterization of a novel archaeal phosphodiesterase | 0.6658 | 36 | 269 |
| 2kkn-assembly1.cif.gz_A | solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 | 0.6612 | 34 | 269 |
| 1s3l-assembly1.cif.gz_A | structural and functional characterization of a novel archaeal phosphodiesterase | 0.6485 | 36 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6886 | 36 | 269 | 3.60.21.10 |
| 2kknA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.683 | 34 | 269 | 3.60.21.10 |
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6732 | 36 | 269 | 3.60.21.10 |
| 1s3lA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6658 | 36 | 269 | 3.60.21.10 |
| 2kknA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6612 | 34 | 269 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q8KMJ9-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9896 | 29 | 148 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
| AF-A0A2V6X366-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.9887 | 31 | 113 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
| AF-T0YTV4-F1-model_v4 | Metallophosphoesterase | 0.9817 | 55 | 151 |
GO:0008758
GO:0009245 GO:0016020 |
| AF-A0A522WAW2-F1-model_v4 | UDP-2,3-diacylglucosamine diphosphatase | 0.9814 | 31 | 154 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
| AF-A0A534AED3-F1-model_v4 | UDP-2,3-diacylglucosamine diphosphatase | 0.9789 | 30 | 117 |
GO:0005886
GO:0008758 GO:0009245 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar