F409110

General Info

Members Datasets Scaffolds Average Seq Length
328 157 328 292

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100017150|Ga0070671_1000171504
Length 338
Sequence MSRDPEQVILETIVSYLQNKTDAKTIYPQATTGGGPVVSVPRAKRQGGAEPLDKGVAPSWIEEPVHFEPNRARVGVRTVWISDTHLGTAGCNAELLLDFLKSTDCETLYLVGDIVDGWQLRKGWYWPPRHNDIVRCVLKKAKHGTRVVYVPGNHDEAFRGYVGLNLGGIELVPEAIHVTADKRRLLILHGDEFDGVVLYAKWLAFLGDSAYVLLLKLNRLLNWVRRKRGLPYWSLSSHLKKKVKNAVQFISSFEEVVAHAAHERGAQGVVCGHIHSPEIRQIGAVTYYNDGDWVESCTALVEHPDGRMEIIDWAEHQRTEAEQGRNRRHRRKKETIHA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
154 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 4.88
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001623 3300001979 Bacteria 10352
2 JGI24739J22299_10000129 3300001989 Bacteria 23885
3 JGI24737J22298_10000508 3300001990 Bacteria 13588
4 JGI24737J22298_10003110 3300001990 Bacteria 5884
5 JGI24738J21930_10000498 3300002075 Bacteria 11174
6 JGI24744J21845_10034267 3300002077 Bacteria 963
7 Ga0070676_10004537 3300005328 Bacteria 7315
8 Ga0070690_100008375 3300005330 Bacteria 5953
9 Ga0070690_100019537 3300005330 Bacteria 4114
10 Ga0070677_10037914 3300005333 Bacteria 1883
11 Ga0068869_100003385 3300005334 Bacteria 9734
12 Ga0068869_100267747 3300005334 Bacteria 1370
13 Ga0070666_10000822 3300005335 Bacteria 18838
14 Ga0070666_10018914 3300005335 Bacteria 4439
15 Ga0070666_10225822 3300005335 Bacteria 1322
16 Ga0068868_100000156 3300005338 Bacteria 44526
17 Ga0068868_100001262 3300005338 Bacteria 17407
18 Ga0070660_100018877 3300005339 Bacteria 5047
19 Ga0070660_100333712 3300005339 Bacteria 1247
20 Ga0070687_100018134 3300005343 Bacteria 3249
21 Ga0070687_100230253 3300005343 Bacteria 1140
22 Ga0070669_100000383 3300005353 Bacteria 33931
23 Ga0070671_100011082 3300005355 Bacteria 7239
24 Ga0070671_100017150 3300005355 Bacteria 5860
25 Ga0070671_100043320 3300005355 Bacteria 3740
26 Ga0070671_100046826 3300005355 Bacteria 3596
27 Ga0070671_100048870 3300005355 Bacteria 3519
28 Ga0070671_100051763 3300005355 Bacteria 3415
29 Ga0070671_100190282 3300005355 Bacteria 1739
30 Ga0070674_100023056 3300005356 Bacteria 4022
31 Ga0070674_100251577 3300005356 Bacteria 1388
32 Ga0070673_100000249 3300005364 Bacteria 27281
33 Ga0070673_100021148 3300005364 Bacteria 4709
34 Ga0070673_100024724 3300005364 Bacteria 4408
35 Ga0070673_100089115 3300005364 Bacteria 2518
36 Ga0070659_100000814 3300005366 Bacteria 22773
37 Ga0070659_100023518 3300005366 Bacteria 4716
38 Ga0070667_100001584 3300005367 Bacteria 20376
39 Ga0070667_100007007 3300005367 Bacteria 9371
40 Ga0070667_100097106 3300005367 Bacteria 2541
41 Ga0070667_100164035 3300005367 Bacteria 1959
42 Ga0070667_100183014 3300005367 Bacteria 1854
43 Ga0070709_10071452 3300005434 Bacteria 2240
44 Ga0070709_10182620 3300005434 Bacteria 1474
45 Ga0070714_100022755 3300005435 Bacteria 5142
46 Ga0070714_100109596 3300005435 Bacteria 2443
47 Ga0070713_100008541 3300005436 Bacteria 7266
48 Ga0070713_100454901 3300005436 Bacteria 1203
49 Ga0070662_100017121 3300005457 Bacteria 4878
50 Ga0068867_100000388 3300005459 Bacteria 29345
51 Ga0068853_100012691 3300005539 Bacteria 6859
52 Ga0070672_100003048 3300005543 Bacteria 10795
53 Ga0070672_100230098 3300005543 Bacteria 1557
54 Ga0070693_100338474 3300005547 Bacteria 1026
55 Ga0068855_100143903 3300005563 Bacteria 2715
56 Ga0068855_100152150 3300005563 Bacteria 2630
57 Ga0070664_100124956 3300005564 Bacteria 2255
58 Ga0070664_100438472 3300005564 Bacteria 1198
59 Ga0068857_100000282 3300005577 Bacteria 34844
60 Ga0068857_100045038 3300005577 Bacteria 3913
61 Ga0068857_100068273 3300005577 Bacteria 3164
62 Ga0068854_100001950 3300005578 Bacteria 12596
63 Ga0068854_100065295 3300005578 Bacteria 2646
64 Ga0068856_100045067 3300005614 Bacteria 4341
65 Ga0068856_100134130 3300005614 Bacteria 2481
66 Ga0068856_100168970 3300005614 Bacteria 2199
67 Ga0068852_100107006 3300005616 Bacteria 2536
68 Ga0068859_100002194 3300005617 Bacteria 19831
69 Ga0068864_100021046 3300005618 Bacteria 5461
70 Ga0068864_100063138 3300005618 Bacteria 3210
71 Ga0068861_100030231 3300005719 Bacteria 3968
72 Ga0068863_100018083 3300005841 Bacteria 6750
73 Ga0068863_100066192 3300005841 Bacteria 3418
74 Ga0068858_100001945 3300005842 Bacteria 21060
75 Ga0068858_100101629 3300005842 Bacteria 2681
76 Ga0068858_100260107 3300005842 Bacteria 1649
77 Ga0068860_100025363 3300005843 Bacteria 5720
78 Ga0068860_100032717 3300005843 Bacteria 4996
79 Ga0068862_100024428 3300005844 Bacteria 5071
80 Ga0068862_100096506 3300005844 Bacteria 2580
81 Ga0068862_100099897 3300005844 Bacteria 2537
82 Ga0081455_10320614 3300005937 Bacteria 1104
83 Ga0081539_10035823 3300005985 Bacteria 2977
84 Ga0081539_10054597 3300005985 Bacteria 2229
85 Ga0070717_10076249 3300006028 Bacteria 2806
86 Ga0070712_100019273 3300006175 Bacteria 4447
87 Ga0070712_100089683 3300006175 Bacteria 2250
88 Ga0075366_10047721 3300006195 Bacteria 2538
89 Ga0097621_100217354 3300006237 Bacteria 1664
90 Ga0068871_100333811 3300006358 Bacteria 1337
91 Ga0068865_100004164 3300006881 Bacteria 8703
92 Ga0097620_100002194 3300006931 Bacteria 19831
93 Ga0105240_10003147 3300009093 Bacteria 25971
94 Ga0105245_10000326 3300009098 Bacteria 44899
95 Ga0105245_10240987 3300009098 Bacteria 1753
96 Ga0105245_10914769 3300009098 Bacteria 919
97 Ga0105243_10195022 3300009148 Bacteria 1772
98 Ga0105248_10000159 3300009177 Bacteria 78504
99 Ga0105248_10002422 3300009177 Bacteria 20691
100 Ga0105248_10205614 3300009177 Bacteria 2219
101 Ga0105239_10527380 3300010375 Bacteria 1344
102 Ga0105246_10011884 3300011119 Bacteria 5416
103 Ga0157373_10024145 3300013100 Bacteria 4406
104 Ga0157373_10053929 3300013100 Bacteria 2858
105 Ga0157371_10008372 3300013102 Bacteria 8245
106 Ga0157369_10016207 3300013105 Bacteria 8387
107 Ga0157374_10004895 3300013296 Bacteria 11237
108 Ga0157374_10115260 3300013296 Bacteria 2588
109 Ga0157374_10180935 3300013296 Bacteria 2059
110 Ga0157378_10001240 3300013297 Bacteria 23084
111 Ga0163162_10212204 3300013306 Bacteria 2066
112 Ga0163162_10431674 3300013306 Bacteria 1449
113 Ga0157372_10129669 3300013307 Bacteria 2900
114 Ga0157375_10038697 3300013308 Bacteria 4581
115 Ga0157375_10186067 3300013308 Bacteria 2230
116 Ga0163163_10027336 3300014325 Bacteria 5464
117 Ga0157379_10142572 3300014968 Bacteria 2160
118 Ga0157379_10145163 3300014968 Bacteria 2140
119 Ga0207697_10000727 3300025315 Bacteria 18712
120 Ga0207682_10069874 3300025893 Bacteria 1486
121 Ga0207680_10000361 3300025903 Bacteria 21828
122 Ga0207680_10186401 3300025903 Bacteria 1406
123 Ga0207647_10004783 3300025904 Bacteria 10025
124 Ga0207647_10006605 3300025904 Bacteria 8427
125 Ga0207647_10025061 3300025904 Bacteria 3927
126 Ga0207647_10027695 3300025904 Bacteria 3691
127 Ga0207647_10034571 3300025904 Bacteria 3225
128 Ga0207699_10006551 3300025906 Bacteria 5648
129 Ga0207645_10008056 3300025907 Bacteria 7391
130 Ga0207705_10007104 3300025909 Bacteria 8257
131 Ga0207695_10002317 3300025913 Bacteria 28404
132 Ga0207693_10031706 3300025915 Bacteria 4176
133 Ga0207693_10109937 3300025915 Bacteria 2161
134 Ga0207662_10250070 3300025918 Bacteria 1163
135 Ga0207657_10038464 3300025919 Bacteria 4258
136 Ga0207657_10127722 3300025919 Bacteria 2087
137 Ga0207657_10214205 3300025919 Bacteria 1545
138 Ga0207681_10041863 3300025923 Bacteria 3056
139 Ga0207681_10056667 3300025923 Bacteria 2674
140 Ga0207694_10025973 3300025924 Bacteria 4453
141 Ga0207650_10005054 3300025925 Bacteria 8999
142 Ga0207650_10026983 3300025925 Bacteria 4105
143 Ga0207687_10002526 3300025927 Bacteria 12416
144 Ga0207700_10044637 3300025928 Bacteria 3264
145 Ga0207664_10151902 3300025929 Bacteria 1968
146 Ga0207664_10340420 3300025929 Bacteria 1326
147 Ga0207644_10004695 3300025931 Bacteria 8876
148 Ga0207644_10015905 3300025931 Bacteria 5058
149 Ga0207644_10054018 3300025931 Bacteria 2892
150 Ga0207644_10108302 3300025931 Bacteria 2097
151 Ga0207644_10197507 3300025931 Bacteria 1585
152 Ga0207690_10004102 3300025932 Bacteria 8603
153 Ga0207690_10004279 3300025932 Bacteria 8428
154 Ga0207690_10016678 3300025932 Bacteria 4474
155 Ga0207706_10007443 3300025933 Bacteria 10126
156 Ga0207706_10061770 3300025933 Bacteria 3300
157 Ga0207669_10287479 3300025937 Bacteria 1243
158 Ga0207704_10128803 3300025938 Bacteria 1748
159 Ga0207704_10143647 3300025938 Bacteria 1673
160 Ga0207665_10102468 3300025939 Bacteria 2000
161 Ga0207691_10002930 3300025940 Bacteria 16651
162 Ga0207691_10279903 3300025940 Bacteria 1435
163 Ga0207711_10004452 3300025941 Bacteria 11943
164 Ga0207711_10079336 3300025941 Bacteria 2865
165 Ga0207711_10152659 3300025941 Bacteria 2085
166 Ga0207711_10249584 3300025941 Bacteria 1629
167 Ga0207689_10000092 3300025942 Bacteria 73254
168 Ga0207679_10008397 3300025945 Bacteria 6578
169 Ga0207679_10465449 3300025945 Bacteria 1123
170 Ga0207667_10110752 3300025949 Bacteria 2832
171 Ga0207667_10127244 3300025949 Bacteria 2624
172 Ga0207651_10000176 3300025960 Bacteria 27858
173 Ga0207651_10091400 3300025960 Bacteria 2228
174 Ga0207651_10211708 3300025960 Bacteria 1561
175 Ga0207640_10000505 3300025981 Bacteria 23623
176 Ga0207640_10038916 3300025981 Bacteria 3005
177 Ga0207658_10002613 3300025986 Bacteria 13087
178 Ga0207658_10035948 3300025986 Bacteria 3550
179 Ga0207658_10078459 3300025986 Bacteria 2523
180 Ga0207658_10095893 3300025986 Bacteria 2312
181 Ga0207658_10209428 3300025986 Bacteria 1633
182 Ga0207677_10000733 3300026023 Bacteria 19151
183 Ga0207677_10021791 3300026023 Bacteria 3924
184 Ga0207703_10000515 3300026035 Bacteria 39972
185 Ga0207678_10055375 3300026067 Bacteria 3416
186 Ga0207678_10085607 3300026067 Bacteria 2694
187 Ga0207702_10018363 3300026078 Bacteria 5786
188 Ga0207641_10024607 3300026088 Bacteria 4962
189 Ga0207641_10173969 3300026088 Bacteria 1967
190 Ga0207641_10329192 3300026088 Bacteria 1450
191 Ga0207648_10002626 3300026089 Bacteria 19234
192 Ga0207648_10441605 3300026089 Bacteria 1184
193 Ga0207676_10003843 3300026095 Bacteria 10606
194 Ga0207676_10009455 3300026095 Bacteria 6938
195 Ga0207676_10096146 3300026095 Bacteria 2444
196 Ga0207674_10001784 3300026116 Bacteria 27499
197 Ga0207674_10002652 3300026116 Bacteria 22343
198 Ga0207674_10005762 3300026116 Bacteria 14694
199 Ga0207675_100044055 3300026118 Bacteria 4168
200 Ga0207698_10055183 3300026142 Bacteria 3060
201 Ga0207698_10200788 3300026142 Bacteria 1785
202 Ga0268266_10000433 3300028379 Bacteria 62887
203 Ga0268265_10016077 3300028380 Bacteria 5134
204 Ga0268265_10055469 3300028380 Bacteria 3011
205 Ga0268265_10225409 3300028380 Bacteria 1643
206 Ga0268265_10266171 3300028380 Bacteria 1526
207 Ga0268264_10018896 3300028381 Bacteria 5634
208 Ga0268264_10036595 3300028381 Bacteria 4044
209 Ga0265320_10002356 3300031240 Bacteria 13226
210 Ga0307409_100082523 3300031995 Bacteria 2602
211 Ga0307409_100251455 3300031995 Bacteria 1616
212 Ga0307414_10031432 3300032004 Bacteria 3482
213 Ga0307414_10342378 3300032004 Bacteria 1280
214 Ga0307411_10068716 3300032005 Bacteria 2389
215 Ga0373946_0009724 3300035171 Bacteria 3549
216 Ga0373931_0010464 3300035691 Bacteria 4458
217 Ga0373931_0073968 3300035691 Bacteria 1866
218 Ga0373925_0018551 3300037068 Bacteria 5057
219 Ga0395899_0000104 3300037312 Bacteria 147238
220 Ga0395899_0020612 3300037312 Bacteria 4997
221 Ga0395899_0026553 3300037312 Bacteria 4369
222 Ga0395899_0030305 3300037312 Bacteria 4069
223 Ga0395899_0068830 3300037312 Bacteria 2594
224 Ga0395899_0141393 3300037312 Bacteria 1712
225 Ga0395899_0171874 3300037312 Bacteria 1526
226 Ga0395900_0000161 3300037418 Bacteria 110637
227 Ga0395900_0000764 3300037418 Bacteria 42836
228 Ga0395900_0005286 3300037418 Bacteria 13533
229 Ga0395900_0017257 3300037418 Bacteria 7367
230 Ga0395900_0019594 3300037418 Bacteria 6898
231 Ga0395900_0046081 3300037418 Bacteria 4490
232 Ga0395900_0049480 3300037418 Bacteria 4331
233 Ga0395900_0052927 3300037418 Bacteria 4178
234 Ga0395900_0054938 3300037418 Bacteria 4100
235 Ga0395900_0070192 3300037418 Bacteria 3602
236 Ga0395900_0078370 3300037418 Bacteria 3395
237 Ga0395900_0180963 3300037418 Bacteria 2142
238 Ga0395900_0184889 3300037418 Bacteria 2115
239 Ga0395900_0304302 3300037418 Bacteria 1579
240 Ga0395898_0000169 3300037466 Bacteria 168667
241 Ga0395898_0001777 3300037466 Bacteria 28071
242 Ga0395898_0011151 3300037466 Bacteria 9359
243 Ga0395898_0017908 3300037466 Bacteria 7227
244 Ga0395898_0022079 3300037466 Bacteria 6447
245 Ga0395898_0026296 3300037466 Bacteria 5859
246 Ga0395898_0029050 3300037466 Bacteria 5540
247 Ga0395898_0062587 3300037466 Bacteria 3613
248 Ga0395898_0073359 3300037466 Bacteria 3306
249 Ga0395898_0130014 3300037466 Bacteria 2412
250 Ga0395905_0000120 3300037471 Bacteria 130865
251 Ga0395905_0000259 3300037471 Bacteria 79396
252 Ga0395905_0001971 3300037471 Bacteria 23466
253 Ga0395905_0004670 3300037471 Bacteria 14159
254 Ga0395905_0012165 3300037471 Bacteria 8287
255 Ga0395905_0014575 3300037471 Bacteria 7498
256 Ga0395905_0017835 3300037471 Bacteria 6743
257 Ga0395905_0024318 3300037471 Bacteria 5717
258 Ga0395905_0030059 3300037471 Bacteria 5121
259 Ga0395905_0048175 3300037471 Bacteria 3994
260 Ga0395905_0049591 3300037471 Bacteria 3934
261 Ga0395905_0067597 3300037471 Bacteria 3347
262 Ga0395905_0075842 3300037471 Bacteria 3151
263 Ga0395905_0108913 3300037471 Bacteria 2601
264 Ga0395905_0125699 3300037471 Bacteria 2411
265 Ga0395905_0130616 3300037471 Bacteria 2362
266 Ga0395905_0188384 3300037471 Bacteria 1936
267 Ga0395905_0266890 3300037471 Bacteria 1597
268 Ga0395905_0304458 3300037471 Bacteria 1481
269 Ga0395901_0000871 3300038443 Bacteria 33284
270 Ga0395901_0004433 3300038443 Bacteria 14162
271 Ga0395901_0009498 3300038443 Bacteria 9868
272 Ga0395901_0009752 3300038443 Bacteria 9736
273 Ga0395901_0009934 3300038443 Bacteria 9646
274 Ga0395901_0012290 3300038443 Bacteria 8689
275 Ga0395901_0046947 3300038443 Bacteria 4486
276 Ga0395901_0060051 3300038443 Bacteria 3956
277 Ga0395901_0061133 3300038443 Bacteria 3920
278 Ga0395901_0061717 3300038443 Bacteria 3900
279 Ga0395901_0075337 3300038443 Bacteria 3520
280 Ga0395901_0079058 3300038443 Bacteria 3434
281 Ga0395901_0128053 3300038443 Bacteria 2668
282 Ga0395901_0233372 3300038443 Bacteria 1920
283 Ga0395901_0308147 3300038443 Bacteria 1640
284 Ga0436363_0315585 3300039450 Bacteria 3485
285 Ga0436362_0840102 3300039453 Bacteria 1254
286 Ga0451839_0533358 3300041496 Bacteria 1201
287 Ga0450923_033078 3300042125 Bacteria 1062
288 Ga0439458_0005338 3300042157 Bacteria 2891
289 Ga0495606_0000515 3300046507 Bacteria 62746
290 Ga0495621_0000065 3300046539 Bacteria 20486
291 Ga0495625_0068679 3300046660 Bacteria 2491
292 Ga0495669_0008292 3300046684 Bacteria 4364
293 Ga0495669_0013613 3300046684 Bacteria 3470
294 Ga0495669_0199361 3300046684 Bacteria 956
295 Ga0495670_0002737 3300046691 Bacteria 8708
296 Ga0495670_0054797 3300046691 Bacteria 1999
297 Ga0495677_0018925 3300047445 Bacteria 2497
298 Ga0495673_0041356 3300047469 Bacteria 2075
299 Ga0495686_0007753 3300047472 Bacteria 7997
300 Ga0496104_0122677 3300048907 Bacteria 2495
301 Ga0496105_0038427 3300048908 Bacteria 3943
302 Ga0496107_0301097 3300048910 Bacteria 1193
303 Ga0496108_0003827 3300048911 Bacteria 12062
304 Ga0496109_0002819 3300048912 Bacteria 14559
305 Ga0496109_0068375 3300048912 Bacteria 3256
306 Ga0496110_0140766 3300048913 Bacteria 2181
307 Ga0496111_0007796 3300048914 Bacteria 7049
308 Ga0496111_0048811 3300048914 Bacteria 3051
309 Ga0496112_0011332 3300048915 Bacteria 8137
310 Ga0496112_0059400 3300048915 Bacteria 3767
311 Ga0496112_0063902 3300048915 Bacteria 3631
312 Ga0496112_0223854 3300048915 Bacteria 1837
313 Ga0496113_0017268 3300048916 Bacteria 5004
314 Ga0496114_0000206 3300048917 Bacteria 42865
315 Ga0496115_0016248 3300048918 Bacteria 5663
316 Ga0496117_0036042 3300048920 Bacteria 3706
317 Ga0496118_0031843 3300048921 Bacteria 4361
318 Ga0496122_0001301 3300048925 Bacteria 41201
319 Ga0496123_0002730 3300048926 Bacteria 21167
320 Ga0496124_0045511 3300048927 Bacteria 3761
321 Ga0501080_0156178 3300049742 Bacteria 2107
322 nmdc:mga0k408_113332_c1 3300050493 Bacteria 1603
323 Ga0500566_0156972 3300053094 Bacteria 1190
324 Ga0500608_058303 3300053122 Bacteria 1849
325 Ga0500559_0014141 3300053136 Bacteria 3374
326 Ga0500559_0090975 3300053136 Bacteria 1397
327 Ga0500616_0020319 3300053153 Bacteria 3731
328 Ga0500622_0059297 3300053156 Bacteria 1955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031240 Ga0265320_10002356 Ga0265320_100023568 250
2 3300005330 Ga0070690_100008375 Ga0070690_1000083753 267
3 3300005335 Ga0070666_10000822 Ga0070666_100008222 267
4 3300005338 Ga0068868_100001262 Ga0068868_10000126212 267
5 3300005343 Ga0070687_100018134 Ga0070687_1000181342 267
6 3300005355 Ga0070671_100051763 Ga0070671_1000517633 267
7 3300005356 Ga0070674_100251577 Ga0070674_1002515772 267
8 3300005367 Ga0070667_100001584 Ga0070667_1000015843 267
9 3300005543 Ga0070672_100230098 Ga0070672_1002300982 267
10 3300005842 Ga0068858_100001945 Ga0068858_1000019453 267
11 3300006237 Ga0097621_100217354 Ga0097621_1002173542 267
12 3300009098 Ga0105245_10240987 Ga0105245_102409872 267
13 3300009177 Ga0105248_10002422 Ga0105248_1000242219 267
14 3300014968 Ga0157379_10142572 Ga0157379_101425722 267
15 3300025903 Ga0207680_10000361 Ga0207680_100003619 267
16 3300025904 Ga0207647_10006605 Ga0207647_100066053 267
17 3300025931 Ga0207644_10054018 Ga0207644_100540183 267
18 3300025933 Ga0207706_10061770 Ga0207706_100617704 267
19 3300025937 Ga0207669_10287479 Ga0207669_102874792 267
20 3300025940 Ga0207691_10279903 Ga0207691_102799032 267
21 3300025941 Ga0207711_10004452 Ga0207711_100044529 267
22 3300025960 Ga0207651_10091400 Ga0207651_100914003 267
23 3300025986 Ga0207658_10078459 Ga0207658_100784592 267
24 3300026023 Ga0207677_10000733 Ga0207677_100007332 267
25 3300026035 Ga0207703_10000515 Ga0207703_1000051519 267
26 3300026089 Ga0207648_10441605 Ga0207648_104416052 267
27 3300026142 Ga0207698_10200788 Ga0207698_102007882 267
28 3300048915 Ga0496112_0223854 Ga0496112_0223854_330_1214 267
29 3300053094 Ga0500566_0156972 Ga0500566_0156972_284_1180 268
30 3300053136 Ga0500559_0090975 Ga0500559_0090975_11_838 268
31 3300049742 Ga0501080_0156178 Ga0501080_0156178_1108_1953 270
32 3300025904 Ga0207647_10025061 Ga0207647_100250615 271
33 3300025932 Ga0207690_10004279 Ga0207690_100042793 271
34 3300035691 Ga0373931_0073968 Ga0373931_0073968_526_1362 272
35 3300035691 Ga0373931_0010464 Ga0373931_0010464_3397_4287 273
36 3300046539 Ga0495621_0000065 Ga0495621_0000065_8894_9778 273
37 3300046684 Ga0495669_0008292 Ga0495669_0008292_1517_2401 273
38 3300046691 Ga0495670_0002737 Ga0495670_0002737_478_1362 273
39 3300005355 Ga0070671_100011082 Ga0070671_1000110825 275
40 3300005364 Ga0070673_100021148 Ga0070673_1000211485 275
41 3300005364 Ga0070673_100024724 Ga0070673_1000247245 275
42 3300013308 Ga0157375_10186067 Ga0157375_101860672 275
43 3300025931 Ga0207644_10015905 Ga0207644_100159054 275
44 3300025960 Ga0207651_10211708 Ga0207651_102117082 275
45 3300037466 Ga0395898_0026296 Ga0395898_0026296_3563_4402 275
46 3300037471 Ga0395905_0048175 Ga0395905_0048175_323_1162 275
47 3300038443 Ga0395901_0075337 Ga0395901_0075337_1193_2032 275
48 3300053122 Ga0500608_058303 Ga0500608_058303_27_950 275
49 3300032004 Ga0307414_10031432 Ga0307414_100314322 276
50 3300048907 Ga0496104_0122677 Ga0496104_0122677_353_1255 276
51 3300048915 Ga0496112_0011332 Ga0496112_0011332_6721_7584 276
52 3300050493 nmdc:mga0k408_113332_c1 nmdc:mga0k408_113332_c1_456_1298 276
53 3300005367 Ga0070667_100183014 Ga0070667_1001830142 277
54 3300005844 Ga0068862_100024428 Ga0068862_1000244283 277
55 3300013306 Ga0163162_10431674 Ga0163162_104316741 277
56 3300014325 Ga0163163_10027336 Ga0163163_100273362 277
57 3300025938 Ga0207704_10128803 Ga0207704_101288032 277
58 3300025986 Ga0207658_10035948 Ga0207658_100359483 277
59 3300028380 Ga0268265_10016077 Ga0268265_100160773 277
60 3300037312 Ga0395899_0141393 Ga0395899_0141393_341_1186 277
61 3300037471 Ga0395905_0304458 Ga0395905_0304458_504_1349 277
62 3300038443 Ga0395901_0308147 Ga0395901_0308147_781_1626 277
63 3300048910 Ga0496107_0301097 Ga0496107_0301097_57_914 277
64 3300048918 Ga0496115_0016248 Ga0496115_0016248_431_1294 278
65 3300005334 Ga0068869_100267747 Ga0068869_1002677472 279
66 3300005564 Ga0070664_100124956 Ga0070664_1001249564 279
67 3300005577 Ga0068857_100045038 Ga0068857_1000450383 279
68 3300005617 Ga0068859_100002194 Ga0068859_10000219418 279
69 3300005618 Ga0068864_100021046 Ga0068864_1000210465 279
70 3300005841 Ga0068863_100066192 Ga0068863_1000661923 279
71 3300005842 Ga0068858_100260107 Ga0068858_1002601071 279
72 3300005843 Ga0068860_100032717 Ga0068860_1000327173 279
73 3300005844 Ga0068862_100099897 Ga0068862_1000998972 279
74 3300006931 Ga0097620_100002194 Ga0097620_10000219418 279
75 3300009148 Ga0105243_10195022 Ga0105243_101950222 279
76 3300046691 Ga0495670_0054797 Ga0495670_0054797_224_1111 279
77 3300048908 Ga0496105_0038427 Ga0496105_0038427_81_965 279
78 3300025923 Ga0207681_10056667 Ga0207681_100566672 280
79 3300025945 Ga0207679_10465449 Ga0207679_104654491 280
80 3300026067 Ga0207678_10055375 Ga0207678_100553753 280
81 3300026088 Ga0207641_10329192 Ga0207641_103291922 280
82 3300026095 Ga0207676_10009455 Ga0207676_100094553 280
83 3300026116 Ga0207674_10005762 Ga0207674_1000576217 280
84 3300028380 Ga0268265_10266171 Ga0268265_102661712 280
85 3300028381 Ga0268264_10036595 Ga0268264_100365955 280
86 3300005564 Ga0070664_100438472 Ga0070664_1004384722 282
87 3300006195 Ga0075366_10047721 Ga0075366_100477212 282
88 3300031995 Ga0307409_100251455 Ga0307409_1002514551 282
89 3300042125 Ga0450923_033078 Ga0450923_033078_135_1028 282
90 3300001990 JGI24737J22298_10003110 JGI24737J22298_100031106 283
91 3300005335 Ga0070666_10018914 Ga0070666_100189142 283
92 3300005339 Ga0070660_100333712 Ga0070660_1003337122 283
93 3300005366 Ga0070659_100023518 Ga0070659_1000235184 283
94 3300005367 Ga0070667_100164035 Ga0070667_1001640352 283
95 3300005577 Ga0068857_100068273 Ga0068857_1000682731 283
96 3300005841 Ga0068863_100018083 Ga0068863_1000180832 283
97 3300005937 Ga0081455_10320614 Ga0081455_103206142 283
98 3300009098 Ga0105245_10914769 Ga0105245_109147691 283
99 3300025903 Ga0207680_10186401 Ga0207680_101864012 283
100 3300025904 Ga0207647_10034571 Ga0207647_100345712 283
101 3300025919 Ga0207657_10214205 Ga0207657_102142052 283
102 3300025925 Ga0207650_10026983 Ga0207650_100269834 283
103 3300025932 Ga0207690_10016678 Ga0207690_100166783 283
104 3300025986 Ga0207658_10209428 Ga0207658_102094282 283
105 3300026088 Ga0207641_10173969 Ga0207641_101739692 283
106 3300026116 Ga0207674_10002652 Ga0207674_1000265225 283
107 3300037418 Ga0395900_0017257 Ga0395900_0017257_782_1657 283
108 3300037418 Ga0395900_0019594 Ga0395900_0019594_3838_4716 283
109 3300037418 Ga0395900_0180963 Ga0395900_0180963_202_1077 283
110 3300037466 Ga0395898_0001777 Ga0395898_0001777_233_1111 283
111 3300037466 Ga0395898_0062587 Ga0395898_0062587_2119_3003 283
112 3300037466 Ga0395898_0130014 Ga0395898_0130014_292_1167 283
113 3300037471 Ga0395905_0012165 Ga0395905_0012165_6605_7480 283
114 3300037471 Ga0395905_0014575 Ga0395905_0014575_4987_5862 283
115 3300037471 Ga0395905_0067597 Ga0395905_0067597_2333_3211 283
116 3300037471 Ga0395905_0125699 Ga0395905_0125699_49_924 283
117 3300037471 Ga0395905_0188384 Ga0395905_0188384_1011_1922 283
118 3300038443 Ga0395901_0004433 Ga0395901_0004433_4683_5561 283
119 3300038443 Ga0395901_0009934 Ga0395901_0009934_1293_2168 283
120 3300038443 Ga0395901_0060051 Ga0395901_0060051_1000_1911 283
121 3300038443 Ga0395901_0128053 Ga0395901_0128053_1242_2126 283
122 3300039450 Ga0436363_0315585 Ga0436363_0315585_2526_3419 283
123 3300041496 Ga0451839_0533358 Ga0451839_0533358_101_1018 283
124 3300005355 Ga0070671_100043320 Ga0070671_1000433203 284
125 3300005614 Ga0068856_100045067 Ga0068856_1000450671 284
126 3300013296 Ga0157374_10115260 Ga0157374_101152603 284
127 3300013296 Ga0157374_10180935 Ga0157374_101809352 284
128 3300014968 Ga0157379_10145163 Ga0157379_101451634 284
129 3300025931 Ga0207644_10108302 Ga0207644_101083022 284
130 3300025931 Ga0207644_10197507 Ga0207644_101975072 284
131 3300025941 Ga0207711_10079336 Ga0207711_100793363 284
132 3300026078 Ga0207702_10018363 Ga0207702_100183635 284
133 3300028380 Ga0268265_10055469 Ga0268265_100554692 284
134 3300037418 Ga0395900_0070192 Ga0395900_0070192_314_1201 284
135 3300046684 Ga0495669_0199361 Ga0495669_0199361_22_903 284
136 3300048912 Ga0496109_0002819 Ga0496109_0002819_4492_5358 284
137 3300048913 Ga0496110_0140766 Ga0496110_0140766_265_1131 284
138 3300048914 Ga0496111_0007796 Ga0496111_0007796_5771_6637 284
139 3300048915 Ga0496112_0063902 Ga0496112_0063902_1116_1982 284
140 3300031995 Ga0307409_100082523 Ga0307409_1000825232 285
141 3300032004 Ga0307414_10342378 Ga0307414_103423782 285
142 3300032005 Ga0307411_10068716 Ga0307411_100687162 285
143 3300005367 Ga0070667_100097106 Ga0070667_1000971063 286
144 3300005434 Ga0070709_10071452 Ga0070709_100714522 286
145 3300005435 Ga0070714_100022755 Ga0070714_1000227556 286
146 3300005436 Ga0070713_100008541 Ga0070713_1000085412 286
147 3300005436 Ga0070713_100454901 Ga0070713_1004549012 286
148 3300005578 Ga0068854_100065295 Ga0068854_1000652955 286
149 3300005614 Ga0068856_100168970 Ga0068856_1001689702 286
150 3300006028 Ga0070717_10076249 Ga0070717_100762492 286
151 3300006175 Ga0070712_100019273 Ga0070712_1000192734 286
152 3300006175 Ga0070712_100089683 Ga0070712_1000896832 286
153 3300009093 Ga0105240_10003147 Ga0105240_100031479 286
154 3300013100 Ga0157373_10053929 Ga0157373_100539292 286
155 3300013105 Ga0157369_10016207 Ga0157369_100162075 286
156 3300013296 Ga0157374_10004895 Ga0157374_100048957 286
157 3300025904 Ga0207647_10027695 Ga0207647_100276952 286
158 3300025906 Ga0207699_10006551 Ga0207699_100065517 286
159 3300025913 Ga0207695_10002317 Ga0207695_1000231716 286
160 3300025915 Ga0207693_10031706 Ga0207693_100317064 286
161 3300025915 Ga0207693_10109937 Ga0207693_101099372 286
162 3300025929 Ga0207664_10340420 Ga0207664_103404202 286
163 3300025939 Ga0207665_10102468 Ga0207665_101024682 286
164 3300025981 Ga0207640_10000505 Ga0207640_100005058 286
165 3300025986 Ga0207658_10095893 Ga0207658_100958933 286
166 3300028379 Ga0268266_10000433 Ga0268266_1000043315 286
167 3300037418 Ga0395900_0000764 Ga0395900_0000764_11503_12429 286
168 3300037466 Ga0395898_0011151 Ga0395898_0011151_5440_6339 286
169 3300037466 Ga0395898_0073359 Ga0395898_0073359_1953_2879 286
170 3300037471 Ga0395905_0000259 Ga0395905_0000259_47859_48758 286
171 3300037471 Ga0395905_0004670 Ga0395905_0004670_4204_5130 286
172 3300037471 Ga0395905_0130616 Ga0395905_0130616_1120_2019 286
173 3300038443 Ga0395901_0233372 Ga0395901_0233372_444_1370 286
174 3300039453 Ga0436362_0840102 Ga0436362_0840102_186_1085 286
175 3300048911 Ga0496108_0003827 Ga0496108_0003827_5945_6856 286
176 3300048917 Ga0496114_0000206 Ga0496114_0000206_20888_21787 286
177 3300005434 Ga0070709_10182620 Ga0070709_101826201 287
178 3300005435 Ga0070714_100109596 Ga0070714_1001095962 287
179 3300005563 Ga0068855_100152150 Ga0068855_1001521503 287
180 3300005985 Ga0081539_10054597 Ga0081539_100545972 287
181 3300025928 Ga0207700_10044637 Ga0207700_100446372 287
182 3300025929 Ga0207664_10151902 Ga0207664_101519022 287
183 3300025949 Ga0207667_10110752 Ga0207667_101107522 287
184 3300037418 Ga0395900_0046081 Ga0395900_0046081_1749_2651 287
185 3300037418 Ga0395900_0184889 Ga0395900_0184889_743_1675 287
186 3300037466 Ga0395898_0022079 Ga0395898_0022079_4773_5705 287
187 3300037471 Ga0395905_0030059 Ga0395905_0030059_3583_4515 287
188 3300037471 Ga0395905_0049591 Ga0395905_0049591_2545_3447 287
189 3300038443 Ga0395901_0012290 Ga0395901_0012290_5620_6522 287
190 3300038443 Ga0395901_0061717 Ga0395901_0061717_1910_2842 287
191 3300046507 Ga0495606_0000515 Ga0495606_0000515_27705_28631 287
192 3300053153 Ga0500616_0020319 Ga0500616_0020319_2001_2900 287
193 3300053156 Ga0500622_0059297 Ga0500622_0059297_994_1893 287
194 3300005355 Ga0070671_100046826 Ga0070671_1000468262 288
195 3300005547 Ga0070693_100338474 Ga0070693_1003384741 288
196 3300035171 Ga0373946_0009724 Ga0373946_0009724_38_928 288
197 3300037068 Ga0373925_0018551 Ga0373925_0018551_159_1049 288
198 3300037312 Ga0395899_0020612 Ga0395899_0020612_3182_4087 288
199 3300037312 Ga0395899_0026553 Ga0395899_0026553_2472_3377 288
200 3300037312 Ga0395899_0171874 Ga0395899_0171874_203_1108 288
201 3300037418 Ga0395900_0005286 Ga0395900_0005286_8176_9081 288
202 3300037418 Ga0395900_0049480 Ga0395900_0049480_1353_2258 288
203 3300037418 Ga0395900_0052927 Ga0395900_0052927_2363_3268 288
204 3300037466 Ga0395898_0017908 Ga0395898_0017908_5258_6163 288
205 3300037466 Ga0395898_0029050 Ga0395898_0029050_2937_3842 288
206 3300037471 Ga0395905_0001971 Ga0395905_0001971_11044_11949 288
207 3300037471 Ga0395905_0017835 Ga0395905_0017835_1664_2569 288
208 3300037471 Ga0395905_0108913 Ga0395905_0108913_278_1171 288
209 3300037471 Ga0395905_0266890 Ga0395905_0266890_230_1114 288
210 3300038443 Ga0395901_0009752 Ga0395901_0009752_1073_1978 288
211 3300038443 Ga0395901_0061133 Ga0395901_0061133_1476_2381 288
212 3300042157 Ga0439458_0005338 Ga0439458_0005338_17_922 288
213 3300001979 JGI24740J21852_10001623 JGI24740J21852_100016235 289
214 3300001989 JGI24739J22299_10000129 JGI24739J22299_1000012926 289
215 3300001990 JGI24737J22298_10000508 JGI24737J22298_100005087 289
216 3300002075 JGI24738J21930_10000498 JGI24738J21930_1000049810 289
217 3300002077 JGI24744J21845_10034267 JGI24744J21845_100342671 289
218 3300005328 Ga0070676_10004537 Ga0070676_100045375 289
219 3300005330 Ga0070690_100019537 Ga0070690_1000195376 289
220 3300005333 Ga0070677_10037914 Ga0070677_100379142 289
221 3300005334 Ga0068869_100003385 Ga0068869_1000033857 289
222 3300005335 Ga0070666_10225822 Ga0070666_102258221 289
223 3300005338 Ga0068868_100000156 Ga0068868_10000015617 289
224 3300005339 Ga0070660_100018877 Ga0070660_1000188773 289
225 3300005343 Ga0070687_100230253 Ga0070687_1002302532 289
226 3300005353 Ga0070669_100000383 Ga0070669_10000038320 289
227 3300005355 Ga0070671_100017150 Ga0070671_1000171504 289
228 3300005355 Ga0070671_100048870 Ga0070671_1000488702 289
229 3300005355 Ga0070671_100190282 Ga0070671_1001902822 289
230 3300005356 Ga0070674_100023056 Ga0070674_1000230563 289
231 3300005364 Ga0070673_100000249 Ga0070673_1000002497 289
232 3300005364 Ga0070673_100089115 Ga0070673_1000891153 289
233 3300005366 Ga0070659_100000814 Ga0070659_10000081423 289
234 3300005367 Ga0070667_100007007 Ga0070667_1000070072 289
235 3300005457 Ga0070662_100017121 Ga0070662_1000171216 289
236 3300005459 Ga0068867_100000388 Ga0068867_10000038811 289
237 3300005539 Ga0068853_100012691 Ga0068853_1000126917 289
238 3300005543 Ga0070672_100003048 Ga0070672_1000030483 289
239 3300005563 Ga0068855_100143903 Ga0068855_1001439033 289
240 3300005577 Ga0068857_100000282 Ga0068857_10000028219 289
241 3300005578 Ga0068854_100001950 Ga0068854_10000195010 289
242 3300005614 Ga0068856_100134130 Ga0068856_1001341302 289
243 3300005616 Ga0068852_100107006 Ga0068852_1001070062 289
244 3300005618 Ga0068864_100063138 Ga0068864_1000631383 289
245 3300005719 Ga0068861_100030231 Ga0068861_1000302313 289
246 3300005842 Ga0068858_100101629 Ga0068858_1001016293 289
247 3300005843 Ga0068860_100025363 Ga0068860_1000253633 289
248 3300005844 Ga0068862_100096506 Ga0068862_1000965062 289
249 3300005985 Ga0081539_10035823 Ga0081539_100358232 289
250 3300006358 Ga0068871_100333811 Ga0068871_1003338112 289
251 3300006881 Ga0068865_100004164 Ga0068865_1000041645 289
252 3300009098 Ga0105245_10000326 Ga0105245_100003262 289
253 3300009177 Ga0105248_10000159 Ga0105248_1000015976 289
254 3300009177 Ga0105248_10205614 Ga0105248_102056142 289
255 3300010375 Ga0105239_10527380 Ga0105239_105273802 289
256 3300011119 Ga0105246_10011884 Ga0105246_100118843 289
257 3300013100 Ga0157373_10024145 Ga0157373_100241456 289
258 3300013102 Ga0157371_10008372 Ga0157371_100083723 289
259 3300013297 Ga0157378_10001240 Ga0157378_1000124014 289
260 3300013306 Ga0163162_10212204 Ga0163162_102122042 289
261 3300013307 Ga0157372_10129669 Ga0157372_101296692 289
262 3300013308 Ga0157375_10038697 Ga0157375_100386975 289
263 3300025315 Ga0207697_10000727 Ga0207697_100007273 289
264 3300025893 Ga0207682_10069874 Ga0207682_100698742 289
265 3300025904 Ga0207647_10004783 Ga0207647_100047836 289
266 3300025907 Ga0207645_10008056 Ga0207645_100080565 289
267 3300025909 Ga0207705_10007104 Ga0207705_100071044 289
268 3300025918 Ga0207662_10250070 Ga0207662_102500701 289
269 3300025919 Ga0207657_10038464 Ga0207657_100384644 289
270 3300025919 Ga0207657_10127722 Ga0207657_101277222 289
271 3300025923 Ga0207681_10041863 Ga0207681_100418632 289
272 3300025924 Ga0207694_10025973 Ga0207694_100259732 289
273 3300025925 Ga0207650_10005054 Ga0207650_100050546 289
274 3300025927 Ga0207687_10002526 Ga0207687_1000252614 289
275 3300025931 Ga0207644_10004695 Ga0207644_100046955 289
276 3300025932 Ga0207690_10004102 Ga0207690_100041022 289
277 3300025933 Ga0207706_10007443 Ga0207706_100074439 289
278 3300025938 Ga0207704_10143647 Ga0207704_101436472 289
279 3300025940 Ga0207691_10002930 Ga0207691_100029306 289
280 3300025941 Ga0207711_10152659 Ga0207711_101526592 289
281 3300025941 Ga0207711_10249584 Ga0207711_102495842 289
282 3300025942 Ga0207689_10000092 Ga0207689_1000009256 289
283 3300025945 Ga0207679_10008397 Ga0207679_100083975 289
284 3300025949 Ga0207667_10127244 Ga0207667_101272442 289
285 3300025960 Ga0207651_10000176 Ga0207651_1000017625 289
286 3300025981 Ga0207640_10038916 Ga0207640_100389162 289
287 3300025986 Ga0207658_10002613 Ga0207658_100026137 289
288 3300026023 Ga0207677_10021791 Ga0207677_100217914 289
289 3300026067 Ga0207678_10085607 Ga0207678_100856074 289
290 3300026088 Ga0207641_10024607 Ga0207641_100246075 289
291 3300026089 Ga0207648_10002626 Ga0207648_100026263 289
292 3300026095 Ga0207676_10003843 Ga0207676_100038437 289
293 3300026095 Ga0207676_10096146 Ga0207676_100961462 289
294 3300026116 Ga0207674_10001784 Ga0207674_100017849 289
295 3300026118 Ga0207675_100044055 Ga0207675_1000440553 289
296 3300026142 Ga0207698_10055183 Ga0207698_100551832 289
297 3300028380 Ga0268265_10225409 Ga0268265_102254092 289
298 3300028381 Ga0268264_10018896 Ga0268264_100188963 289
299 3300037312 Ga0395899_0000104 Ga0395899_0000104_100568_101470 289
300 3300037312 Ga0395899_0030305 Ga0395899_0030305_2559_3446 289
301 3300037312 Ga0395899_0068830 Ga0395899_0068830_985_1893 289
302 3300037418 Ga0395900_0000161 Ga0395900_0000161_26672_27574 289
303 3300037418 Ga0395900_0054938 Ga0395900_0054938_1436_2323 289
304 3300037418 Ga0395900_0078370 Ga0395900_0078370_2387_3274 289
305 3300037418 Ga0395900_0304302 Ga0395900_0304302_218_1126 289
306 3300037466 Ga0395898_0000169 Ga0395898_0000169_113504_114406 289
307 3300037471 Ga0395905_0000120 Ga0395905_0000120_26860_27762 289
308 3300037471 Ga0395905_0024318 Ga0395905_0024318_4275_5162 289
309 3300037471 Ga0395905_0075842 Ga0395905_0075842_710_1597 289
310 3300038443 Ga0395901_0000871 Ga0395901_0000871_7921_8823 289
311 3300038443 Ga0395901_0009498 Ga0395901_0009498_912_1799 289
312 3300038443 Ga0395901_0046947 Ga0395901_0046947_3438_4346 289
313 3300038443 Ga0395901_0079058 Ga0395901_0079058_629_1516 289
314 3300046660 Ga0495625_0068679 Ga0495625_0068679_1310_2197 289
315 3300046684 Ga0495669_0013613 Ga0495669_0013613_79_966 289
316 3300047445 Ga0495677_0018925 Ga0495677_0018925_990_1877 289
317 3300047469 Ga0495673_0041356 Ga0495673_0041356_919_1845 289
318 3300047472 Ga0495686_0007753 Ga0495686_0007753_1603_2550 289
319 3300048912 Ga0496109_0068375 Ga0496109_0068375_1264_2157 289
320 3300048914 Ga0496111_0048811 Ga0496111_0048811_752_1705 289
321 3300048915 Ga0496112_0059400 Ga0496112_0059400_1312_2205 289
322 3300048916 Ga0496113_0017268 Ga0496113_0017268_2772_3665 289
323 3300048920 Ga0496117_0036042 Ga0496117_0036042_559_1494 289
324 3300048921 Ga0496118_0031843 Ga0496118_0031843_2810_3745 289
325 3300048925 Ga0496122_0001301 Ga0496122_0001301_28637_29590 289
326 3300048926 Ga0496123_0002730 Ga0496123_0002730_13333_14286 289
327 3300048927 Ga0496124_0045511 Ga0496124_0045511_1288_2241 289
328 3300053136 Ga0500559_0014141 Ga0500559_0014141_130_1077 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

76

277

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dma-assembly4.cif.gz_G dhd15_closed 0.691 147 209
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.683 34 269
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6658 36 269
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.6612 34 269
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.6485 36 269
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6886 36 269 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.683 34 269 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6732 36 269 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6658 36 269 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6612 34 269 3.60.21.10
ID Description Score Start End GO Terms
AF-Q8KMJ9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9896 29 148 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A2V6X366-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9887 31 113 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-T0YTV4-F1-model_v4 Metallophosphoesterase 0.9817 55 151 GO:0008758
GO:0009245
GO:0016020
AF-A0A522WAW2-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase 0.9814 31 154 GO:0005886
GO:0008758
GO:0009245
GO:0046872
AF-A0A534AED3-F1-model_v4 UDP-2,3-diacylglucosamine diphosphatase 0.9789 30 117 GO:0005886
GO:0008758
GO:0009245
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.35 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map