F409061

General Info

Members Datasets Scaffolds Average Seq Length
328 310 60 309

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10114498|rootH1_101144982
Length 324
Sequence MVEFITSLINGSQLPLLISASVFAAAVLIFLAFAFILVPVFETQRRLEQELVAGGFGGRRSMGAQAQIRRLSSYRPVDAYFKGIERGGTQPDAIEKRLFEAGFYGRFAVIVYNLSRLAIVAIGFLTIFVLASTFLPHGLPYRLPLTIFGSLLFGVALIVIPSIALDVYARGIKETYRRSFPDFMDMMITCADAGMSLEAAVERVSNEFSATHRHLGVQLSILTLQIRAGKALRDALRELADRIGLEEAKTLSVLFRQSEELGTSLVDALRVYSAEMRTQRILRAEEKANSLPVRMVLPLGLCVFPVVMMIVMLPVIIRMKGVFF

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
12 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
13 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
14 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
15 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
16 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
17 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
18 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
19 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
20 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
21 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
22 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
23 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
24 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
25 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
26 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
29 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
30 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
31 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
32 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
33 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
34 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
35 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
36 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
37 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
38 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
39 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
40 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
41 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
44 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
45 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
46 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
47 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
50 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
53 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
54 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
55 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
56 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
57 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
58 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
59 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
60 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
61 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
62 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
63 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
64 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
65 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
66 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
67 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
68 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
69 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
70 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
71 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
72 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
73 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
74 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
75 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
76 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
77 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
78 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
79 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
80 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
81 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
82 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
83 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
84 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
85 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
86 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
87 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
88 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
89 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
90 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
91 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
92 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
93 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
94 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
95 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
96 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
97 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
98 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
99 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
100 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
101 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
102 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
103 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
104 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
105 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
106 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
107 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
108 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
109 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
110 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
111 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
112 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
113 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
114 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
115 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
116 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
117 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
118 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
119 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
120 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
121 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
122 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
123 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
124 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
125 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
126 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
127 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
128 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
129 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
130 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
131 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
132 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
133 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
134 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
135 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
136 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
137 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
138 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
139 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
140 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
141 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
142 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
143 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
144 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
145 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
146 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
147 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
148 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
149 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
150 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
151 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
152 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
153 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
154 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
155 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
156 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
157 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
158 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
159 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
160 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
161 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
162 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
163 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
164 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
165 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
166 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
167 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
168 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
169 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
170 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
171 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
172 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
173 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
174 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
175 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
176 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
177 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
178 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
179 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
180 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
181 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
182 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
183 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
184 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
185 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
186 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
187 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
188 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
189 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
190 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
191 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
192 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
193 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
194 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
195 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
196 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
197 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
198 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
199 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
200 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
201 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
202 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
203 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
204 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
205 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
206 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
207 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
208 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
209 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
210 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
211 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
212 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
213 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
214 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
215 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
216 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
217 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
218 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
219 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
220 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
221 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
222 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
223 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
224 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
225 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
226 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
227 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
228 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
229 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
230 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
231 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
232 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
233 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
234 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
235 3004167301 Mesorhizobium loti 582 Isolate Unclassified
236 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
237 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
238 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
239 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
240 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
241 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
242 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
243 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
244 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
245 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
246 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
247 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
248 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
249 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
250 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
251 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
252 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
253 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
254 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
255 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
256 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
257 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
258 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
259 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
260 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
261 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
262 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
263 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
264 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
265 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
266 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
267 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
268 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
270 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
272 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
293 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
294 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
295 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
296 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
297 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
298 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
299 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
300 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
301 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
302 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
303 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
304 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
305 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
306 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
307 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
308 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
309 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
310 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 18.29
Metatranscriptomes 0
Isolates 81.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 72.56
Rhizoplane 0.61
Rhizosphere 9.76
Stem 0
Stem Tuber 0
Unclassified 9.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001206 3300003214 Bacteria 15601
2 rootH2_10029682 3300003320 Bacteria 8538
3 rootH1_10114498 3300003323 Bacteria 3059
4 Ga0055542_1000549 3300003762 Bacteria 33335
5 Ga0055529_1002287 3300003763 Bacteria 3856
6 Ga0070661_100018406 3300005344 Bacteria 4965
7 Ga0070663_100363965 3300005455 Bacteria 1174
8 Ga0068856_100008187 3300005614 Bacteria 10194
9 Ga0068856_100373858 3300005614 Bacteria 1444
10 Ga0068852_100008769 3300005616 Bacteria 7479
11 Ga0081539_10001502 3300005985 Bacteria 39415
12 Ga0075365_10022306 3300006038 Bacteria 3965
13 Ga0075365_10093152 3300006038 Bacteria 2055
14 Ga0075363_100125730 3300006048 Bacteria 1435
15 Ga0075367_10122365 3300006178 Bacteria 1604
16 Ga0075370_10007949 3300006353 Bacteria 5433
17 Ga0075370_10148306 3300006353 Bacteria 1374
18 Ga0105240_10081400 3300009093 Bacteria 3979
19 Ga0105240_10150021 3300009093 Bacteria 2778
20 Ga0105240_10206019 3300009093 Bacteria 2302
21 Ga0105237_10504763 3300009545 Bacteria 1216
22 Ga0105238_10046357 3300009551 Bacteria 4387
23 Ga0105239_10063202 3300010375 Bacteria 4064
24 Ga0105239_10102836 3300010375 Bacteria 3162
25 Ga0105239_10545444 3300010375 Bacteria 1320
26 Ga0157374_10184304 3300013296 Bacteria 2040
27 Ga0182008_10104715 3300014497 Bacteria 1400
28 Ga0209148_1000256 3300025254 Bacteria 83479
29 Ga0209148_1005479 3300025254 Bacteria 2904
30 Ga0209233_1000047 3300025261 Bacteria 459614
31 Ga0209455_1000314 3300025272 Bacteria 48752
32 Ga0209758_1015577 3300025297 Bacteria 3924
33 Ga0207705_10078328 3300025909 Bacteria 2405
34 Ga0207705_10410718 3300025909 Bacteria 1047
35 Ga0207695_10121080 3300025913 Bacteria 2585
36 Ga0207694_10025628 3300025924 Bacteria 4483
37 Ga0207667_10014104 3300025949 Bacteria 9123
38 Ga0395900_0229221 3300037418 Bacteria 1869
39 Ga0395905_0038424 3300037471 Bacteria 4492
40 Ga0395901_0274416 3300038443 Bacteria 1753
41 Ga0395901_0297656 3300038443 Bacteria 1673
42 Ga0466972_0064570 3300044658 Bacteria 1752
43 Ga0495638_0019001 3300046460 Bacteria 4552
44 Ga0495625_0055088 3300046660 Bacteria 2838
45 Ga0496115_0085894 3300048918 Bacteria 2567
46 Ga0496118_0120973 3300048921 Bacteria 1707
47 Ga0496119_0045778 3300048922 Bacteria 2740
48 Ga0496120_0000297 3300048923 Bacteria 83278
49 Ga0496120_0066140 3300048923 Bacteria 2000
50 Ga0496124_0061273 3300048927 Bacteria 3154
51 nmdc:mga03n38_105159_c1 3300050490 Bacteria 1367
52 nmdc:mga0yw44_157159_c1 3300050492 Bacteria 1486
53 nmdc:mga0yw44_173578_c1 3300050492 Bacteria 1416
54 nmdc:mga0yw44_42876_c1 3300050492 Bacteria 2700
55 nmdc:mga06z11_76560_c1 3300050494 Bacteria 1784
56 nmdc:mga07m45_34033_c1 3300050496 Bacteria 2831
57 nmdc:mga07m45_71970_c1 3300050496 Bacteria 1379
58 Ga0500568_0079618 3300053139 Bacteria 1245
59 Ga0500604_0028134 3300053151 Bacteria 1631
60 Ga0500620_000177 3300053155 Bacteria 13017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0019001 Ga0495638_0019001_473_1432 257
2 iso_pu_bacteria 2871474448 2871480844 266
3 iso_pu_bacteria 643348564 643600291 270
4 3300038443 Ga0395901_0274416 Ga0395901_0274416_622_1557 273
5 3300010375 Ga0105239_10545444 Ga0105239_105454442 279
6 iso_pu_bacteria 2841734538 2841737285 279
7 iso_pu_bacteria 2878788777 2878791553 279
8 3300014497 Ga0182008_10104715 Ga0182008_101047152 280
9 3300025297 Ga0209758_1015577 Ga0209758_10155773 280
10 3300050492 nmdc:mga0yw44_157159_c1 nmdc:mga0yw44_157159_c1_441_1397 280
11 3300005985 Ga0081539_10001502 Ga0081539_1000150224 282
12 3300006038 Ga0075365_10022306 Ga0075365_100223063 282
13 3300006038 Ga0075365_10093152 Ga0075365_100931522 282
14 3300009093 Ga0105240_10150021 Ga0105240_101500212 282
15 3300013296 Ga0157374_10184304 Ga0157374_101843043 282
16 3300050490 nmdc:mga03n38_105159_c1 nmdc:mga03n38_105159_c1_266_1216 282
17 3300050492 nmdc:mga0yw44_42876_c1 nmdc:mga0yw44_42876_c1_139_1089 282
18 3300050494 nmdc:mga06z11_76560_c1 nmdc:mga06z11_76560_c1_687_1637 282
19 3300050496 nmdc:mga07m45_34033_c1 nmdc:mga07m45_34033_c1_1611_2561 282
20 iso_pu_bacteria 2958041894 2958057786 282
21 3300006178 Ga0075367_10122365 Ga0075367_101223652 283
22 iso_pu_bacteria 2924754689 2924759819 283
23 3300044658 Ga0466972_0064570 Ga0466972_0064570_601_1569 284
24 3300046660 Ga0495625_0055088 Ga0495625_0055088_1725_2660 284
25 3300048922 Ga0496119_0045778 Ga0496119_0045778_985_1938 284
26 3300048923 Ga0496120_0000297 Ga0496120_0000297_76039_76992 284
27 3300003320 rootH2_10029682 rootH2_1002968211 285
28 iso_pu_bacteria 2856349417 2856356284 288
29 iso_pu_bacteria 2881155292 2881158476 288
30 iso_pu_bacteria 2881853255 2881855313 288
31 iso_pu_bacteria 2885342637 2885350518 288
32 iso_pu_bacteria 2904659560 2904660461 288
33 iso_pu_bacteria 2961127735 2961129999 288
34 3300003323 rootH1_10114498 rootH1_101144982 290
35 3300005344 Ga0070661_100018406 Ga0070661_1000184066 290
36 3300005614 Ga0068856_100008187 Ga0068856_1000081879 290
37 3300005614 Ga0068856_100373858 Ga0068856_1003738582 290
38 3300005616 Ga0068852_100008769 Ga0068852_1000087699 290
39 3300009093 Ga0105240_10081400 Ga0105240_100814003 290
40 3300010375 Ga0105239_10063202 Ga0105239_100632025 290
41 3300025909 Ga0207705_10078328 Ga0207705_100783283 290
42 3300025913 Ga0207695_10121080 Ga0207695_101210803 290
43 3300025949 Ga0207667_10014104 Ga0207667_100141049 290
44 3300037418 Ga0395900_0229221 Ga0395900_0229221_46_1020 290
45 iso_pu_bacteria 2874168670 2874171166 290
46 iso_pu_bacteria 2924762789 2924763743 290
47 iso_pu_bacteria 2937836603 2937837520 290
48 iso_pu_bacteria 2987666974 2987669915 290
49 iso_pu_bacteria 2996336353 2996339580 290
50 iso_pu_bacteria 8004633249 8004637942 290
51 iso_pu_bacteria 2643221627 2644153401 291
52 iso_pu_bacteria 2977828996 2977829513 291
53 3300003214 JGI25165J46597_1001206 JGI25165J46597_100120610 292
54 3300003762 Ga0055542_1000549 Ga0055542_10005493 292
55 3300003763 Ga0055529_1002287 Ga0055529_10022873 292
56 3300005455 Ga0070663_100363965 Ga0070663_1003639652 292
57 3300006048 Ga0075363_100125730 Ga0075363_1001257302 292
58 3300006353 Ga0075370_10007949 Ga0075370_100079492 292
59 3300006353 Ga0075370_10148306 Ga0075370_101483062 292
60 3300009093 Ga0105240_10206019 Ga0105240_102060192 292
61 3300009545 Ga0105237_10504763 Ga0105237_105047632 292
62 3300009551 Ga0105238_10046357 Ga0105238_100463572 292
63 3300010375 Ga0105239_10102836 Ga0105239_101028362 292
64 3300025254 Ga0209148_1000256 Ga0209148_100025651 292
65 3300025254 Ga0209148_1005479 Ga0209148_10054794 292
66 3300025261 Ga0209233_1000047 Ga0209233_1000047340 292
67 3300025272 Ga0209455_1000314 Ga0209455_100031421 292
68 3300025909 Ga0207705_10410718 Ga0207705_104107181 292
69 3300025924 Ga0207694_10025628 Ga0207694_100256285 292
70 3300037471 Ga0395905_0038424 Ga0395905_0038424_2884_3852 292
71 3300038443 Ga0395901_0297656 Ga0395901_0297656_773_1663 292
72 3300048918 Ga0496115_0085894 Ga0496115_0085894_1008_1931 292
73 3300048921 Ga0496118_0120973 Ga0496118_0120973_50_934 292
74 3300048923 Ga0496120_0066140 Ga0496120_0066140_353_1303 292
75 3300048927 Ga0496124_0061273 Ga0496124_0061273_1423_2370 292
76 3300050492 nmdc:mga0yw44_173578_c1 nmdc:mga0yw44_173578_c1_151_1101 292
77 3300050496 nmdc:mga07m45_71970_c1 nmdc:mga07m45_71970_c1_256_1212 292
78 3300053139 Ga0500568_0079618 Ga0500568_0079618_137_1087 292
79 3300053151 Ga0500604_0028134 Ga0500604_0028134_285_1175 292
80 3300053155 Ga0500620_000177 Ga0500620_000177_8852_9742 292
81 iso_pu_bacteria 2503198000 2503200679 292
82 iso_pu_bacteria 2508501127 2509140802 292
83 iso_pu_bacteria 2509276018 2509368947 292
84 iso_pu_bacteria 2509276022 2509398417 292
85 iso_pu_bacteria 2510065059 2510316243 292
86 iso_pu_bacteria 2512875016 2512928756 292
87 iso_pu_bacteria 2512875024 2512957847 292
88 iso_pu_bacteria 2513237090 2513614355 292
89 iso_pu_bacteria 2513237305 2514417867 292
90 iso_pu_bacteria 2588253730 2588514300 292
91 iso_pu_bacteria 2597489875 2597811415 292
92 iso_pu_bacteria 2599185301 2599940706 292
93 iso_pu_bacteria 2643221550 2643771064 292
94 iso_pu_bacteria 2643221595 2643989751 292
95 iso_pu_bacteria 2687453392 2688597792 292
96 iso_pu_bacteria 2693429783 2694630335 292
97 iso_pu_bacteria 2693429784 2694635659 292
98 iso_pu_bacteria 2721755686 2723578287 292
99 iso_pu_bacteria 2756170246 2756676303 292
100 iso_pu_bacteria 2791355123 2792750087 292
101 iso_pu_bacteria 2844002411 2844004778 292
102 iso_pu_bacteria 2844009547 2844009709 292
103 iso_pu_bacteria 2847670302 2847672661 292
104 iso_pu_bacteria 2856314179 2856315112 292
105 iso_pu_bacteria 2856320880 2856326235 292
106 iso_pu_bacteria 2856328259 2856329897 292
107 iso_pu_bacteria 2856334872 2856337051 292
108 iso_pu_bacteria 2856342000 2856348052 292
109 iso_pu_bacteria 2856356410 2856360312 292
110 iso_pu_bacteria 2856364286 2856365889 292
111 iso_pu_bacteria 2857349434 2857353697 292
112 iso_pu_bacteria 2857367948 2857369043 292
113 iso_pu_bacteria 2869169390 2869175485 292
114 iso_pu_bacteria 2869234852 2869234866 292
115 iso_pu_bacteria 2869242130 2869249577 292
116 iso_pu_bacteria 2869249662 2869252290 292
117 iso_pu_bacteria 2869256925 2869260414 292
118 iso_pu_bacteria 2869264136 2869266761 292
119 iso_pu_bacteria 2869271264 2869277480 292
120 iso_pu_bacteria 2869278585 2869284142 292
121 iso_pu_bacteria 2869285874 2869286776 292
122 iso_pu_bacteria 2871429161 2871434039 292
123 iso_pu_bacteria 2871435913 2871443733 292
124 iso_pu_bacteria 2871444079 2871450202 292
125 iso_pu_bacteria 2871451962 2871452415 292
126 iso_pu_bacteria 2871459585 2871463775 292
127 iso_pu_bacteria 2871466892 2871470343 292
128 iso_pu_bacteria 2871481445 2871487338 292
129 iso_pu_bacteria 2871488783 2871490122 292
130 iso_pu_bacteria 2871495908 2871502034 292
131 iso_pu_bacteria 2874102143 2874102523 292
132 iso_pu_bacteria 2874109183 2874112730 292
133 iso_pu_bacteria 2874116593 2874118444 292
134 iso_pu_bacteria 2874123672 2874124377 292
135 iso_pu_bacteria 2874131515 2874132861 292
136 iso_pu_bacteria 2874139085 2874144765 292
137 iso_pu_bacteria 2874146452 2874147697 292
138 iso_pu_bacteria 2874155637 2874156616 292
139 iso_pu_bacteria 2874162495 2874163880 292
140 iso_pu_bacteria 2876363079 2876369201 292
141 iso_pu_bacteria 2876369609 2876372113 292
142 iso_pu_bacteria 2876386047 2876388709 292
143 iso_pu_bacteria 2876392853 2876393736 292
144 iso_pu_bacteria 2876399893 2876401538 292
145 iso_pu_bacteria 2876406927 2876409409 292
146 iso_pu_bacteria 2876413966 2876414811 292
147 iso_pu_bacteria 2876420981 2876421799 292
148 iso_pu_bacteria 2878035449 2878042030 292
149 iso_pu_bacteria 2878730984 2878733429 292
150 iso_pu_bacteria 2878738818 2878743864 292
151 iso_pu_bacteria 2878745973 2878746749 292
152 iso_pu_bacteria 2878753008 2878753192 292
153 iso_pu_bacteria 2878760144 2878765729 292
154 iso_pu_bacteria 2878767105 2878772403 292
155 iso_pu_bacteria 2878774303 2878777114 292
156 iso_pu_bacteria 2878781027 2878788643 292
157 iso_pu_bacteria 2881161766 2881164132 292
158 iso_pu_bacteria 2881845957 2881852283 292
159 iso_pu_bacteria 2881861095 2881865488 292
160 iso_pu_bacteria 2882632389 2882639132 292
161 iso_pu_bacteria 2882912400 2882918940 292
162 iso_pu_bacteria 2885305155 2885308778 292
163 iso_pu_bacteria 2885312484 2885318637 292
164 iso_pu_bacteria 2885326080 2885333538 292
165 iso_pu_bacteria 2885334103 2885337033 292
166 iso_pu_bacteria 2885350715 2885356446 292
167 iso_pu_bacteria 2888337043 2888342188 292
168 iso_pu_bacteria 2888343758 2888345222 292
169 iso_pu_bacteria 2889010040 2889013830 292
170 iso_pu_bacteria 2889016732 2889021476 292
171 iso_pu_bacteria 2889914905 2889918816 292
172 iso_pu_bacteria 2903448605 2903449409 292
173 iso_pu_bacteria 2903492973 2903498043 292
174 iso_pu_bacteria 2903492973 2903498192 292
175 iso_pu_bacteria 2903513507 2903519961 292
176 iso_pu_bacteria 2903521522 2903526331 292
177 iso_pu_bacteria 2903528002 2903529618 292
178 iso_pu_bacteria 2903540706 2903546675 292
179 iso_pu_bacteria 2906308376 2906309130 292
180 iso_pu_bacteria 2906321335 2906326736 292
181 iso_pu_bacteria 2906328253 2906328695 292
182 iso_pu_bacteria 2906354277 2906360241 292
183 iso_pu_bacteria 2906363423 2906367413 292
184 iso_pu_bacteria 2906370794 2906377987 292
185 iso_pu_bacteria 2906378014 2906380834 292
186 iso_pu_bacteria 2906386501 2906391240 292
187 iso_pu_bacteria 2906393657 2906396596 292
188 iso_pu_bacteria 2906401398 2906403621 292
189 iso_pu_bacteria 2906408224 2906409567 292
190 iso_pu_bacteria 2906414383 2906415109 292
191 iso_pu_bacteria 2922151315 2922151556 292
192 iso_pu_bacteria 2922158528 2922160754 292
193 iso_pu_bacteria 2922172374 2922174637 292
194 iso_pu_bacteria 2922178524 2922184851 292
195 iso_pu_bacteria 2922185730 2922186442 292
196 iso_pu_bacteria 2924710171 2924714608 292
197 iso_pu_bacteria 2924726620 2924726922 292
198 iso_pu_bacteria 2924733363 2924740757 292
199 iso_pu_bacteria 2924741084 2924746170 292
200 iso_pu_bacteria 2924748358 2924754641 292
201 iso_pu_bacteria 2924776078 2924781781 292
202 iso_pu_bacteria 2924784321 2924791213 292
203 iso_pu_bacteria 2937813078 2937814012 292
204 iso_pu_bacteria 2937813078 2937818852 292
205 iso_pu_bacteria 2937848649 2937850846 292
206 iso_pu_bacteria 2937861824 2937865130 292
207 iso_pu_bacteria 2937868953 2937872989 292
208 iso_pu_bacteria 2937877337 2937884891 292
209 iso_pu_bacteria 2937891427 2937892551 292
210 iso_pu_bacteria 2937972304 2937978162 292
211 iso_pu_bacteria 2937980651 2937984025 292
212 iso_pu_bacteria 2937994558 2938000533 292
213 iso_pu_bacteria 2938014810 2938018058 292
214 iso_pu_bacteria 2958034702 2958040531 292
215 iso_pu_bacteria 2958041894 2958055379 292
216 iso_pu_bacteria 2958071322 2958073553 292
217 iso_pu_bacteria 2958084443 2958092200 292
218 iso_pu_bacteria 2958092219 2958097033 292
219 iso_pu_bacteria 2958100919 2958106882 292
220 iso_pu_bacteria 2958108152 2958115176 292
221 iso_pu_bacteria 2958115193 2958121411 292
222 iso_pu_bacteria 2958122699 2958124188 292
223 iso_pu_bacteria 2958130278 2958131179 292
224 iso_pu_bacteria 2958137437 2958142587 292
225 iso_pu_bacteria 2958144490 2958149216 292
226 iso_pu_bacteria 2958158011 2958162354 292
227 iso_pu_bacteria 2958165035 2958170904 292
228 iso_pu_bacteria 2958172287 2958172971 292
229 iso_pu_bacteria 2958179912 2958180578 292
230 iso_pu_bacteria 2961077736 2961078413 292
231 iso_pu_bacteria 2961114664 2961120784 292
232 iso_pu_bacteria 2961136820 2961143839 292
233 iso_pu_bacteria 2961163497 2961169348 292
234 iso_pu_bacteria 2961170736 2961177016 292
235 iso_pu_bacteria 2961183825 2961188739 292
236 iso_pu_bacteria 2963644680 2963650477 292
237 iso_pu_bacteria 2965018300 2965023600 292
238 iso_pu_bacteria 2965025482 2965031086 292
239 iso_pu_bacteria 2965032056 2965032575 292
240 iso_pu_bacteria 2965040258 2965047095 292
241 iso_pu_bacteria 2965047637 2965051384 292
242 iso_pu_bacteria 2965062239 2965069032 292
243 iso_pu_bacteria 2965089291 2965090375 292
244 iso_pu_bacteria 2965102966 2965105508 292
245 iso_pu_bacteria 2965110997 2965112561 292
246 iso_pu_bacteria 2967996073 2968002858 292
247 iso_pu_bacteria 2968003550 2968005255 292
248 iso_pu_bacteria 2968016561 2968021842 292
249 iso_pu_bacteria 2968083720 2968085650 292
250 iso_pu_bacteria 2968091066 2968094557 292
251 iso_pu_bacteria 2968097103 2968101202 292
252 iso_pu_bacteria 2968110612 2968111521 292
253 iso_pu_bacteria 2968117919 2968120382 292
254 iso_pu_bacteria 2968138860 2968145404 292
255 iso_pu_bacteria 2968171901 2968177738 292
256 iso_pu_bacteria 2970469710 2970474432 292
257 iso_pu_bacteria 2970489779 2970491427 292
258 iso_pu_bacteria 2970503327 2970509689 292
259 iso_pu_bacteria 2970510686 2970512380 292
260 iso_pu_bacteria 2970510686 2970513651 292
261 iso_pu_bacteria 2970524798 2970526928 292
262 iso_pu_bacteria 2970532167 2970536158 292
263 iso_pu_bacteria 2970540015 2970543861 292
264 iso_pu_bacteria 2970547951 2970554619 292
265 iso_pu_bacteria 2970554993 2970560584 292
266 iso_pu_bacteria 2970593180 2970598754 292
267 iso_pu_bacteria 2970619444 2970620256 292
268 iso_pu_bacteria 2970627176 2970629318 292
269 iso_pu_bacteria 2977821940 2977822124 292
270 iso_pu_bacteria 2977843712 2977845285 292
271 iso_pu_bacteria 2977851361 2977854762 292
272 iso_pu_bacteria 2977858184 2977858667 292
273 iso_pu_bacteria 2977864932 2977865360 292
274 iso_pu_bacteria 2977872689 2977879311 292
275 iso_pu_bacteria 2977898635 2977904835 292
276 iso_pu_bacteria 2977907340 2977908374 292
277 iso_pu_bacteria 2977915119 2977918202 292
278 iso_pu_bacteria 2977922695 2977923817 292
279 iso_pu_bacteria 2977935797 2977937105 292
280 iso_pu_bacteria 2977942078 2977949860 292
281 iso_pu_bacteria 2977950692 2977954086 292
282 iso_pu_bacteria 2977957713 2977962132 292
283 iso_pu_bacteria 2977971508 2977973012 292
284 iso_pu_bacteria 2977986579 2977987257 292
285 iso_pu_bacteria 2979710463 2979712844 292
286 iso_pu_bacteria 2979742915 2979746548 292
287 iso_pu_bacteria 2979764755 2979766480 292
288 iso_pu_bacteria 2979772303 2979772523 292
289 iso_pu_bacteria 2979779861 2979785814 292
290 iso_pu_bacteria 2979793036 2979793908 292
291 iso_pu_bacteria 2979808191 2979814476 292
292 iso_pu_bacteria 2987636660 2987642890 292
293 iso_pu_bacteria 2987645492 2987647921 292
294 iso_pu_bacteria 2987652177 2987658516 292
295 iso_pu_bacteria 2987659509 2987665673 292
296 iso_pu_bacteria 2987673487 2987674757 292
297 iso_pu_bacteria 2996341866 2996348002 292
298 iso_pu_bacteria 2996348954 2996353842 292
299 iso_pu_bacteria 2996386984 2996388408 292
300 iso_pu_bacteria 3000135777 3000142309 292
301 iso_pu_bacteria 3004167301 3004172055 292
302 iso_pu_bacteria 3004188549 3004194537 292
303 iso_pu_bacteria 3004195979 3004197008 292
304 iso_pu_bacteria 3004203850 3004210683 292
305 iso_pu_bacteria 3004211236 3004213260 292
306 iso_pu_bacteria 3004218560 3004221332 292
307 iso_pu_bacteria 3004232784 3004239691 292
308 iso_pu_bacteria 3004239961 3004248156 292
309 iso_pu_bacteria 3004248173 3004248238 292
310 iso_pu_bacteria 3004268573 3004271574 292
311 iso_pu_bacteria 3004275668 3004280510 292
312 iso_pu_bacteria 3004289098 3004293605 292
313 iso_pu_bacteria 3004334049 3004338306 292
314 iso_pu_bacteria 637000159 637078455 292
315 iso_pu_bacteria 649633066 649872334 292
316 iso_pu_bacteria 8004300914 8004307174 292
317 iso_pu_bacteria 8004312739 8004318838 292
318 iso_pu_bacteria 8004361976 8004364016 292
319 iso_pu_bacteria 8004374579 8004374763 292
320 iso_pu_bacteria 8004387939 8004388059 292
321 iso_pu_bacteria 8004395343 8004400120 292
322 iso_pu_bacteria 8004445564 8004449012 292
323 iso_pu_bacteria 8004640170 8004644614 292
324 iso_pu_bacteria 8004695233 8004702821 292
325 iso_pu_bacteria 8004703790 8004713144 292
326 iso_pu_bacteria 8004714634 8004715387 292
327 iso_pu_bacteria 8004727605 8004729915 292
328 iso_pu_bacteria 8055617313 8055618781 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

183

313

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.8238 145 255
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8159 145 261
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.7974 145 255
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.7794 145 261
4hhx-assembly1.cif.gz_A structure of cytoplasmic domain of tcpe from vibrio cholerae 0.7585 144 247
ID Description Score Start End Superfamily
af_Q5NBD8_1_100_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.852 79 133 1.10.10.1740
af_C6SWM5_1_96_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8427 79 133 1.10.10.1740
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.5634 43 137 1.10.1760.20
af_C6SWM5_1_96_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5115 79 133 1.10.10.1740
af_Q5NBD8_1_100_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4958 79 133 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A529HSQ6-F1-model_v4 Type II secretion system F family protein 0.9643 61 253 GO:0005886
AF-A0A529HSQ6-F1-model_v4 Type II secretion system F family protein 0.9547 61 253 GO:0005886
AF-A0A529KS48-F1-model_v4 Type II secretion system F family protein 0.946 32 292 GO:0005886
AF-A0A4S0V8E1-F1-model_v4 Type II secretion system F family protein 0.9427 127 268 GO:0005886
AF-A0A529KS48-F1-model_v4 Type II secretion system F family protein 0.9425 32 292 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.65 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map