F408978

General Info

Members Datasets Scaffolds Average Seq Length
327 221 324 217

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0235486|Ga0501046_0235486_206_991
Length 261
Sequence MRPLQLARAGGRLSVLCLGAHSDDIEIGAGATLLTLVARGVRLQVRWCVLSGGEERAHEARASAGDFLSAAADARVEVMAFRDGFFPQQGEAIKSWFEALKADTSPDLVLTHHRDDAHQDHREVSRLTWNTFRDHCILEYEIPKWDGDMGRPNLYVPLPAKVLERKIELLMAHFGTQRSRHWFDEETFRGLARLRGMECRAPERYAEAYVARKLILASLKSDQSGATARAARAGSRWHTPSRRAGRRARQCRAVSAGRRTG

Samples

Sample ID Description Type Environment
1 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
2 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
3 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
216 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
219 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 2.75
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 0
Rhizoplane 6.73
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10319104 3300003322 Unclassified 2812
2 rootH1_10350470 3300003323 Unclassified 2330
3 JGI25160J50197_1013809 3300003354 Bacteria 2734
4 Ga0058862_11986807 3300004803 Bacteria 1061
5 Ga0070683_100551460 3300005329 Bacteria 1102
6 Ga0070680_100043404 3300005336 Unclassified 3653
7 Ga0070682_100044200 3300005337 Bacteria 2757
8 Ga0070689_100502983 3300005340 Bacteria 1038
9 Ga0070691_10008620 3300005341 Bacteria 4667
10 Ga0070687_100079265 3300005343 Bacteria 1787
11 Ga0070692_10020022 3300005345 Bacteria 3238
12 Ga0070668_100717130 3300005347 Bacteria 883
13 Ga0070669_100616378 3300005353 Bacteria 910
14 Ga0070688_100026962 3300005365 Bacteria 3419
15 Ga0070703_10000441 3300005406 Bacteria 16907
16 Ga0070709_10003967 3300005434 Bacteria 7978
17 Ga0070709_10008077 3300005434 Bacteria 5775
18 Ga0070714_100006706 3300005435 Bacteria 8915
19 Ga0070714_100017469 3300005435 Bacteria 5812
20 Ga0070714_100544758 3300005435 Bacteria 1110
21 Ga0070713_100224596 3300005436 Bacteria 1705
22 Ga0070710_10018359 3300005437 Bacteria 3598
23 Ga0070701_10003386 3300005438 Bacteria 6299
24 Ga0070711_100007151 3300005439 Bacteria 6775
25 Ga0070711_100031006 3300005439 Bacteria 3545
26 Ga0070711_100073299 3300005439 Bacteria 2419
27 Ga0070711_100084254 3300005439 Bacteria 2274
28 Ga0070705_100000032 3300005440 Bacteria 70341
29 Ga0070700_100022918 3300005441 Bacteria 3649
30 Ga0070694_100003514 3300005444 Bacteria 9367
31 Ga0070663_100037544 3300005455 Bacteria 3373
32 Ga0070663_100065625 3300005455 Bacteria 2628
33 Ga0070663_100084417 3300005455 Bacteria 2341
34 Ga0070662_100342555 3300005457 Bacteria 1223
35 Ga0070681_10007840 3300005458 Bacteria 10441
36 Ga0070681_10042392 3300005458 Unclassified 4561
37 Ga0070681_10097646 3300005458 Bacteria 2885
38 Ga0070706_100360798 3300005467 Bacteria 1354
39 Ga0070699_100001445 3300005518 Bacteria 21813
40 Ga0070679_100052471 3300005530 Unclassified 4061
41 Ga0070679_100103843 3300005530 Bacteria 2828
42 Ga0070679_100192144 3300005530 Bacteria 2010
43 Ga0070697_100012876 3300005536 Bacteria 6553
44 Ga0068853_100119557 3300005539 Unclassified 2348
45 Ga0068853_100383992 3300005539 Bacteria 1312
46 Ga0070695_100000937 3300005545 Bacteria 15780
47 Ga0070696_100000826 3300005546 Bacteria 19955
48 Ga0070696_100128855 3300005546 Unclassified 1839
49 Ga0070693_100241032 3300005547 Bacteria 1194
50 Ga0070704_100005197 3300005549 Bacteria 7571
51 Ga0070704_100639036 3300005549 Bacteria 939
52 Ga0068855_100290384 3300005563 Unclassified 1813
53 Ga0068855_100436776 3300005563 Bacteria 1430
54 Ga0070664_100242520 3300005564 Bacteria 1618
55 Ga0068857_100037185 3300005577 Bacteria 4313
56 Ga0068857_100049212 3300005577 Bacteria 3740
57 Ga0068857_100152480 3300005577 Bacteria 2094
58 Ga0068856_100078225 3300005614 Bacteria 3279
59 Ga0070702_100088623 3300005615 Bacteria 1871
60 Ga0068852_100446115 3300005616 Bacteria 1280
61 Ga0068859_100001900 3300005617 Bacteria 21287
62 Ga0068859_100398558 3300005617 Unclassified 1472
63 Ga0068864_100011945 3300005618 Bacteria 7169
64 Ga0068861_100011697 3300005719 Bacteria 6106
65 Ga0068861_100047199 3300005719 Bacteria 3250
66 Ga0068870_10023832 3300005840 Bacteria 3023
67 Ga0068870_10045561 3300005840 Bacteria 2297
68 Ga0068863_100153734 3300005841 Bacteria 2202
69 Ga0068858_100079819 3300005842 Unclassified 3040
70 Ga0068858_100619390 3300005842 Bacteria 1051
71 Ga0068860_100000870 3300005843 Bacteria 33607
72 Ga0068862_100001615 3300005844 Bacteria 20525
73 Ga0068862_100024353 3300005844 Bacteria 5078
74 Ga0081455_10127184 3300005937 Bacteria 1997
75 Ga0081455_10214622 3300005937 Bacteria 1431
76 Ga0081539_10075057 3300005985 Bacteria 1798
77 Ga0070717_10039956 3300006028 Bacteria 3819
78 Ga0070717_10462564 3300006028 Bacteria 1144
79 Ga0075365_10014341 3300006038 Bacteria 4765
80 Ga0075365_10028268 3300006038 Bacteria 3576
81 Ga0075368_10007864 3300006042 Bacteria 3780
82 Ga0075364_10004068 3300006051 Bacteria 8392
83 Ga0075432_10016126 3300006058 Bacteria 2552
84 Ga0070715_10014347 3300006163 Unclassified 2933
85 Ga0070716_100008982 3300006173 Bacteria 4972
86 Ga0070716_100013157 3300006173 Unclassified 4212
87 Ga0070712_100018061 3300006175 Bacteria 4574
88 Ga0070712_100028581 3300006175 Unclassified 3731
89 Ga0070712_100198070 3300006175 Bacteria 1576
90 Ga0075362_10010621 3300006177 Bacteria 3602
91 Ga0075367_10014751 3300006178 Bacteria 4232
92 Ga0075367_10018028 3300006178 Bacteria 3888
93 Ga0075369_10025269 3300006186 Bacteria 2468
94 Ga0075433_10005169 3300006852 Bacteria 10228
95 Ga0075434_100001060 3300006871 Bacteria 22455
96 Ga0075434_100059001 3300006871 Bacteria 3814
97 Ga0068865_100165848 3300006881 Bacteria 1689
98 Ga0097620_100001900 3300006931 Bacteria 21287
99 Ga0097620_100398507 3300006931 Unclassified 1472
100 Ga0075435_100178806 3300007076 Bacteria 1793
101 Ga0099794_10165882 3300007265 Unclassified 1125
102 Ga0114129_10099832 3300009147 Bacteria 4017
103 Ga0114129_10108325 3300009147 Unclassified 3836
104 Ga0114129_10310564 3300009147 Bacteria 2099
105 Ga0114129_10490184 3300009147 Bacteria 1607
106 Ga0105243_10099580 3300009148 Bacteria 2409
107 Ga0105241_10005107 3300009174 Bacteria 9682
108 Ga0105248_10216222 3300009177 Bacteria 2158
109 Ga0105248_10649667 3300009177 Bacteria 1190
110 Ga0105237_10019228 3300009545 Bacteria 7058
111 Ga0105237_10125868 3300009545 Bacteria 2557
112 Ga0105237_10431468 3300009545 Bacteria 1323
113 Ga0105238_10071756 3300009551 Bacteria 3460
114 Ga0105238_10817267 3300009551 Unclassified 948
115 Ga0105249_10001320 3300009553 Bacteria 21711
116 Ga0105249_10073420 3300009553 Bacteria 3165
117 Ga0105239_10125529 3300010375 Bacteria 2852
118 Ga0105246_10565152 3300011119 Bacteria 977
119 Ga0157370_10182133 3300013104 Unclassified 1952
120 Ga0157378_10150847 3300013297 Bacteria 2166
121 Ga0157378_11135858 3300013297 Bacteria 819
122 Ga0163162_10754469 3300013306 Unclassified 1092
123 Ga0157372_10785526 3300013307 Bacteria 1106
124 Ga0163163_10121111 3300014325 Bacteria 2650
125 Ga0157380_10063889 3300014326 Bacteria 2953
126 Ga0157380_10204216 3300014326 Bacteria 1755
127 Ga0157379_10211813 3300014968 Bacteria 1754
128 Ga0197907_10534692 3300020069 Bacteria 2376
129 Ga0206356_10421548 3300020070 Bacteria 1619
130 Ga0206356_11190142 3300020070 Bacteria 1256
131 Ga0206355_1227927 3300020076 Bacteria 1698
132 Ga0206352_10935876 3300020078 Bacteria 1393
133 Ga0206354_10308217 3300020081 Bacteria 1673
134 Ga0213871_10031431 3300021441 Bacteria 1387
135 Ga0224712_10060805 3300022467 Bacteria 1504
136 Ga0209455_1004205 3300025272 Bacteria 4802
137 Ga0209130_1000503 3300025284 Bacteria 39757
138 Ga0209025_1000206 3300025294 Bacteria 141415
139 Ga0209758_1001695 3300025297 Bacteria 24790
140 Ga0209758_1045767 3300025297 Bacteria 1585
141 Ga0207426_1000358 3300025302 Bacteria 83113
142 Ga0207653_10001223 3300025885 Bacteria 8400
143 Ga0207692_10007438 3300025898 Unclassified 4489
144 Ga0207692_10411181 3300025898 Bacteria 845
145 Ga0207647_10057381 3300025904 Unclassified 2387
146 Ga0207699_10021822 3300025906 Bacteria 3459
147 Ga0207643_10041102 3300025908 Bacteria 2605
148 Ga0207643_10074556 3300025908 Bacteria 1957
149 Ga0207684_10065115 3300025910 Bacteria 3095
150 Ga0207707_10013935 3300025912 Bacteria 7011
151 Ga0207707_10060583 3300025912 Bacteria 3292
152 Ga0207707_10179941 3300025912 Bacteria 1846
153 Ga0207671_10285951 3300025914 Bacteria 1301
154 Ga0207693_10002566 3300025915 Bacteria 15791
155 Ga0207693_10099275 3300025915 Bacteria 2283
156 Ga0207663_10002298 3300025916 Bacteria 9156
157 Ga0207663_10017163 3300025916 Bacteria 4027
158 Ga0207660_10011616 3300025917 Bacteria 5741
159 Ga0207660_10131273 3300025917 Unclassified 1907
160 Ga0207652_10054300 3300025921 Bacteria 3444
161 Ga0207652_10076068 3300025921 Bacteria 2926
162 Ga0207652_10379949 3300025921 Bacteria 1275
163 Ga0207694_10141809 3300025924 Bacteria 1933
164 Ga0207694_10381589 3300025924 Unclassified 1170
165 Ga0207700_10119534 3300025928 Bacteria 2134
166 Ga0207700_10379377 3300025928 Bacteria 1236
167 Ga0207664_10022055 3300025929 Unclassified 4747
168 Ga0207664_10205585 3300025929 Bacteria 1701
169 Ga0207690_10501262 3300025932 Bacteria 982
170 Ga0207706_10496384 3300025933 Bacteria 1054
171 Ga0207709_10076670 3300025935 Bacteria 2140
172 Ga0207670_10661955 3300025936 Bacteria 862
173 Ga0207704_10143320 3300025938 Bacteria 1675
174 Ga0207665_10012300 3300025939 Bacteria 5621
175 Ga0207711_10268566 3300025941 Bacteria 1569
176 Ga0207661_10579874 3300025944 Bacteria 1029
177 Ga0207679_10096350 3300025945 Bacteria 2302
178 Ga0207667_10387471 3300025949 Bacteria 1424
179 Ga0207712_10065544 3300025961 Bacteria 2593
180 Ga0207712_10277950 3300025961 Bacteria 1365
181 Ga0207703_10110905 3300026035 Bacteria 2341
182 Ga0207703_10441417 3300026035 Bacteria 1214
183 Ga0207703_11011515 3300026035 Bacteria 797
184 Ga0207639_10061457 3300026041 Bacteria 2902
185 Ga0207678_10044843 3300026067 Bacteria 3824
186 Ga0207678_10074956 3300026067 Bacteria 2899
187 Ga0207678_10108668 3300026067 Bacteria 2366
188 Ga0207708_10001022 3300026075 Bacteria 20938
189 Ga0207648_10627967 3300026089 Unclassified 992
190 Ga0207676_10008478 3300026095 Bacteria 7308
191 Ga0207674_10003569 3300026116 Bacteria 18971
192 Ga0207674_10023358 3300026116 Bacteria 6626
193 Ga0207674_10213434 3300026116 Bacteria 1879
194 Ga0207675_100246331 3300026118 Bacteria 1728
195 Ga0207683_10732471 3300026121 Bacteria 917
196 Ga0207698_10601540 3300026142 Bacteria 1084
197 Ga0207698_10665815 3300026142 Bacteria 1033
198 Ga0209813_10003732 3300027866 Bacteria 3589
199 Ga0207428_10333802 3300027907 Bacteria 1118
200 Ga0268266_10615315 3300028379 Unclassified 1044
201 Ga0268265_10002040 3300028380 Bacteria 15844
202 Ga0268264_10001009 3300028381 Bacteria 28574
203 Ga0307508_10000021 3300031616 Bacteria 183823
204 Ga0307508_10029829 3300031616 Bacteria 4929
205 Ga0307410_10553837 3300031852 Bacteria 953
206 Ga0307406_10066123 3300031901 Bacteria 2352
207 Ga0307412_10141311 3300031911 Bacteria 1764
208 Ga0307414_10051494 3300032004 Bacteria 2859
209 Ga0307411_10086932 3300032005 Bacteria 2170
210 Ga0373948_0069473 3300034817 Bacteria 787
211 Ga0373958_0050985 3300034819 Bacteria 874
212 Ga0373959_0061032 3300034820 Bacteria 834
213 Ga0373940_0038734 3300035088 Bacteria 1302
214 Ga0373951_0015990 3300035091 Bacteria 1692
215 Ga0373942_0159134 3300035207 Bacteria 729
216 Ga0373962_0090663 3300035242 Bacteria 941
217 Ga0373931_0011590 3300035691 Unclassified 4259
218 Ga0373927_0010448 3300035695 Bacteria 6189
219 Ga0395900_0202234 3300037418 Bacteria 2009
220 Ga0395900_0531297 3300037418 Bacteria 1123
221 Ga0436365_0816258 3300039437 Bacteria 994
222 Ga0495610_0007539 3300046512 Bacteria 7211
223 Ga0495620_0237433 3300046515 Bacteria 696
224 Ga0496100_0147164 3300048903 Bacteria 1676
225 Ga0496101_0085674 3300048904 Unclassified 2335
226 Ga0496102_0005628 3300048905 Bacteria 10635
227 Ga0496102_0006640 3300048905 Bacteria 9886
228 Ga0496102_0356995 3300048905 Unclassified 1376
229 Ga0496103_0008644 3300048906 Bacteria 6049
230 Ga0496104_0186137 3300048907 Bacteria 1987
231 Ga0496105_0391116 3300048908 Bacteria 1105
232 Ga0496106_0001865 3300048909 Bacteria 15770
233 Ga0496106_0006496 3300048909 Bacteria 8660
234 Ga0496107_0000470 3300048910 Bacteria 22130
235 Ga0496107_0035311 3300048910 Bacteria 3584
236 Ga0496107_0135523 3300048910 Bacteria 1819
237 Ga0496108_0064999 3300048911 Bacteria 3074
238 Ga0496108_0103285 3300048911 Bacteria 2432
239 Ga0496109_0054856 3300048912 Bacteria 3635
240 Ga0496110_0028134 3300048913 Bacteria 4825
241 Ga0496111_0535628 3300048914 Bacteria 860
242 Ga0496113_0358298 3300048916 Unclassified 1170
243 Ga0496115_0010382 3300048918 Bacteria 6958
244 Ga0496115_0022385 3300048918 Bacteria 4896
245 Ga0496115_0120518 3300048918 Bacteria 2159
246 Ga0496121_0126793 3300048924 Bacteria 1917
247 Ga0496126_0032926 3300048929 Bacteria 4878
248 Ga0496126_0294834 3300048929 Unclassified 1340
249 Ga0501032_0186093 3300049569 Bacteria 1358
250 Ga0501034_0000013 3300049571 Bacteria 297898
251 Ga0501034_0495576 3300049571 Bacteria 1136
252 Ga0501036_0148530 3300049572 Bacteria 1977
253 Ga0501036_0170911 3300049572 Bacteria 1831
254 Ga0501037_0010600 3300049573 Bacteria 6771
255 Ga0501037_0451797 3300049573 Bacteria 876
256 Ga0501038_0003054 3300049574 Bacteria 15606
257 Ga0501038_0054605 3300049574 Bacteria 3436
258 Ga0501039_0000710 3300049575 Bacteria 23980
259 Ga0501039_0059892 3300049575 Bacteria 2948
260 Ga0501040_0450504 3300049576 Bacteria 926
261 Ga0501040_0521910 3300049576 Bacteria 856
262 Ga0501041_0093112 3300049577 Bacteria 1861
263 Ga0501043_0076198 3300049579 Bacteria 2635
264 Ga0501043_0106741 3300049579 Bacteria 2199
265 Ga0501046_0059563 3300049580 Bacteria 2991
266 Ga0501046_0223075 3300049580 Bacteria 1395
267 Ga0501046_0235486 3300049580 Bacteria 1352
268 Ga0501046_0250443 3300049580 Bacteria 1304
269 Ga0501047_0000721 3300049581 Bacteria 34396
270 Ga0501047_0593957 3300049581 Bacteria 929
271 Ga0501048_0310430 3300049582 Bacteria 1123
272 Ga0501067_0055006 3300049583 Bacteria 2205
273 Ga0501072_0238658 3300049588 Unclassified 1448
274 Ga0501072_0427261 3300049588 Bacteria 1050
275 Ga0501073_0032065 3300049589 Bacteria 3748
276 Ga0501075_0053514 3300049591 Bacteria 3036
277 Ga0501075_0122423 3300049591 Bacteria 1980
278 Ga0501077_0136196 3300049593 Bacteria 1558
279 Ga0501079_0117118 3300049741 Unclassified 2071
280 Ga0501080_0000003 3300049742 Bacteria 214890
281 Ga0501080_0202756 3300049742 Bacteria 1821
282 Ga0501081_0041698 3300049743 Bacteria 3144
283 Ga0501035_0000058 3300049822 Bacteria 135089
284 Ga0501044_0000023 3300049823 Bacteria 196555
285 Ga0501045_0071325 3300049824 Bacteria 2557
286 Ga0501045_0645993 3300049824 Bacteria 782
287 nmdc:mga03683_21623_c1 3300050489 Unclassified 2483
288 nmdc:mga03n38_240872_c1 3300050490 Bacteria 952
289 nmdc:mga03n38_57861_c1 3300050490 Bacteria 1754
290 nmdc:mga00v17_27593_c1 3300050491 Bacteria 3317
291 nmdc:mga0yw44_161891_c1 3300050492 Bacteria 1465
292 nmdc:mga0yw44_17575_c1 3300050492 Bacteria 3896
293 nmdc:mga0yw44_428949_c1 3300050492 Bacteria 895
294 nmdc:mga06z11_17370_c1 3300050494 Bacteria 3264
295 nmdc:mga06z11_9145_c1 3300050494 Bacteria 4162
296 nmdc:mga05p37_138419_c1 3300050507 Unclassified 2983
297 nmdc:mga05p37_89636_c1 3300050507 Bacteria 3790
298 nmdc:mga09592_384602_c1 3300050508 Bacteria 1213
299 nmdc:mga06r32_594154_c1 3300050510 Bacteria 1078
300 nmdc:mga06r32_9797_c1 3300050510 Bacteria 8647
301 nmdc:mga08y16_82810_c1 3300050511 Unclassified 3345
302 nmdc:mga0n895_3395_c1 3300050512 Bacteria 12823
303 nmdc:mga0n895_646_c1 3300050512 Bacteria 24309
304 nmdc:mga0n895_647800_c1 3300050512 Bacteria 1055
305 nmdc:mga0rr50_179816_c1 3300050513 Bacteria 1728
306 nmdc:mga0a205_150179_c1 3300050515 Bacteria 2230
307 nmdc:mga0a205_172838_c1 3300050515 Bacteria 2056
308 nmdc:mga0a205_183888_c1 3300050515 Bacteria 1984
309 nmdc:mga0a205_6734_c1 3300050515 Bacteria 10390
310 nmdc:mga0sz30_24378_c1 3300050516 Bacteria 2468
311 Ga0500572_000346 3300053111 Bacteria 16615
312 Ga0500559_0004222 3300053136 Bacteria 6873
313 Ga0500637_0276353 3300053178 Bacteria 927
314 Ga0500576_056313 3300053725 Bacteria 1731
315 Ga0500645_072128 3300053730 Unclassified 991
316 Ga0500596_002159 3300053735 Bacteria 3904
317 Ga0587085_003908 3300059506 Bacteria 1658
318 Ga0501082_0055163 3300060353 Bacteria 3424
319 Ga0501082_0071525 3300060353 Bacteria 2987
320 Ga0501082_0155291 3300060353 Bacteria 1988
321 Ga0501082_0410151 3300060353 Bacteria 1183
322 Ga0530510_0148813 3300061734 Bacteria 1728
323 Ga0530510_0175839 3300061734 Unclassified 1586
324 Ga0530510_0359047 3300061734 Bacteria 1095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0117118 Ga0501079_0117118_483_1127 207
2 3300026067 Ga0207678_10044843 Ga0207678_100448433 213
3 iso_pu_bacteria 2844533157 2844536317 213
4 iso_pu_bacteria 2847930680 2847933757 213
5 iso_pu_bacteria 2881364244 2881368354 213
6 3300050515 nmdc:mga0a205_150179_c1 nmdc:mga0a205_150179_c1_137_781 214
7 3300014326 Ga0157380_10204216 Ga0157380_102042162 215
8 3300026089 Ga0207648_10627967 Ga0207648_106279672 215
9 3300026121 Ga0207683_10732471 Ga0207683_107324712 216
10 3300048910 Ga0496107_0135523 Ga0496107_0135523_460_1113 216
11 3300049580 Ga0501046_0223075 Ga0501046_0223075_486_1136 216
12 3300049593 Ga0501077_0136196 Ga0501077_0136196_509_1159 216
13 3300049824 Ga0501045_0645993 Ga0501045_0645993_33_683 216
14 3300003322 rootL2_10319104 rootL2_103191042 217
15 3300003323 rootH1_10350470 rootH1_103504704 217
16 3300003354 JGI25160J50197_1013809 JGI25160J50197_10138093 217
17 3300004803 Ga0058862_11986807 Ga0058862_119868072 217
18 3300005329 Ga0070683_100551460 Ga0070683_1005514602 217
19 3300005336 Ga0070680_100043404 Ga0070680_1000434041 217
20 3300005337 Ga0070682_100044200 Ga0070682_1000442003 217
21 3300005340 Ga0070689_100502983 Ga0070689_1005029832 217
22 3300005341 Ga0070691_10008620 Ga0070691_100086206 217
23 3300005343 Ga0070687_100079265 Ga0070687_1000792651 217
24 3300005345 Ga0070692_10020022 Ga0070692_100200224 217
25 3300005347 Ga0070668_100717130 Ga0070668_1007171301 217
26 3300005353 Ga0070669_100616378 Ga0070669_1006163781 217
27 3300005365 Ga0070688_100026962 Ga0070688_1000269623 217
28 3300005406 Ga0070703_10000441 Ga0070703_100004417 217
29 3300005434 Ga0070709_10003967 Ga0070709_100039673 217
30 3300005434 Ga0070709_10008077 Ga0070709_100080778 217
31 3300005435 Ga0070714_100006706 Ga0070714_1000067065 217
32 3300005435 Ga0070714_100017469 Ga0070714_1000174694 217
33 3300005435 Ga0070714_100544758 Ga0070714_1005447582 217
34 3300005436 Ga0070713_100224596 Ga0070713_1002245962 217
35 3300005437 Ga0070710_10018359 Ga0070710_100183593 217
36 3300005438 Ga0070701_10003386 Ga0070701_100033866 217
37 3300005439 Ga0070711_100007151 Ga0070711_1000071516 217
38 3300005439 Ga0070711_100031006 Ga0070711_1000310065 217
39 3300005439 Ga0070711_100073299 Ga0070711_1000732993 217
40 3300005439 Ga0070711_100084254 Ga0070711_1000842542 217
41 3300005440 Ga0070705_100000032 Ga0070705_10000003216 217
42 3300005441 Ga0070700_100022918 Ga0070700_1000229183 217
43 3300005444 Ga0070694_100003514 Ga0070694_1000035149 217
44 3300005455 Ga0070663_100037544 Ga0070663_1000375443 217
45 3300005455 Ga0070663_100065625 Ga0070663_1000656252 217
46 3300005455 Ga0070663_100084417 Ga0070663_1000844172 217
47 3300005457 Ga0070662_100342555 Ga0070662_1003425551 217
48 3300005458 Ga0070681_10007840 Ga0070681_100078405 217
49 3300005458 Ga0070681_10042392 Ga0070681_100423924 217
50 3300005458 Ga0070681_10097646 Ga0070681_100976463 217
51 3300005467 Ga0070706_100360798 Ga0070706_1003607982 217
52 3300005518 Ga0070699_100001445 Ga0070699_10000144517 217
53 3300005530 Ga0070679_100052471 Ga0070679_1000524713 217
54 3300005530 Ga0070679_100103843 Ga0070679_1001038432 217
55 3300005530 Ga0070679_100192144 Ga0070679_1001921441 217
56 3300005536 Ga0070697_100012876 Ga0070697_1000128762 217
57 3300005539 Ga0068853_100119557 Ga0068853_1001195571 217
58 3300005539 Ga0068853_100383992 Ga0068853_1003839922 217
59 3300005545 Ga0070695_100000937 Ga0070695_1000009377 217
60 3300005546 Ga0070696_100000826 Ga0070696_10000082612 217
61 3300005546 Ga0070696_100128855 Ga0070696_1001288552 217
62 3300005547 Ga0070693_100241032 Ga0070693_1002410322 217
63 3300005549 Ga0070704_100005197 Ga0070704_1000051973 217
64 3300005549 Ga0070704_100639036 Ga0070704_1006390361 217
65 3300005563 Ga0068855_100290384 Ga0068855_1002903841 217
66 3300005563 Ga0068855_100436776 Ga0068855_1004367762 217
67 3300005564 Ga0070664_100242520 Ga0070664_1002425202 217
68 3300005577 Ga0068857_100037185 Ga0068857_1000371853 217
69 3300005577 Ga0068857_100049212 Ga0068857_1000492123 217
70 3300005577 Ga0068857_100152480 Ga0068857_1001524802 217
71 3300005614 Ga0068856_100078225 Ga0068856_1000782252 217
72 3300005615 Ga0070702_100088623 Ga0070702_1000886232 217
73 3300005616 Ga0068852_100446115 Ga0068852_1004461151 217
74 3300005617 Ga0068859_100001900 Ga0068859_10000190016 217
75 3300005617 Ga0068859_100398558 Ga0068859_1003985582 217
76 3300005618 Ga0068864_100011945 Ga0068864_1000119457 217
77 3300005719 Ga0068861_100011697 Ga0068861_1000116976 217
78 3300005719 Ga0068861_100047199 Ga0068861_1000471991 217
79 3300005840 Ga0068870_10023832 Ga0068870_100238322 217
80 3300005840 Ga0068870_10045561 Ga0068870_100455613 217
81 3300005841 Ga0068863_100153734 Ga0068863_1001537343 217
82 3300005842 Ga0068858_100079819 Ga0068858_1000798193 217
83 3300005842 Ga0068858_100619390 Ga0068858_1006193902 217
84 3300005843 Ga0068860_100000870 Ga0068860_1000008709 217
85 3300005844 Ga0068862_100001615 Ga0068862_10000161516 217
86 3300005844 Ga0068862_100024353 Ga0068862_1000243533 217
87 3300005937 Ga0081455_10127184 Ga0081455_101271842 217
88 3300005937 Ga0081455_10214622 Ga0081455_102146222 217
89 3300005985 Ga0081539_10075057 Ga0081539_100750572 217
90 3300006028 Ga0070717_10039956 Ga0070717_100399564 217
91 3300006028 Ga0070717_10462564 Ga0070717_104625642 217
92 3300006038 Ga0075365_10014341 Ga0075365_100143415 217
93 3300006038 Ga0075365_10028268 Ga0075365_100282682 217
94 3300006042 Ga0075368_10007864 Ga0075368_100078642 217
95 3300006051 Ga0075364_10004068 Ga0075364_100040684 217
96 3300006058 Ga0075432_10016126 Ga0075432_100161261 217
97 3300006163 Ga0070715_10014347 Ga0070715_100143472 217
98 3300006173 Ga0070716_100008982 Ga0070716_1000089823 217
99 3300006173 Ga0070716_100013157 Ga0070716_1000131572 217
100 3300006175 Ga0070712_100018061 Ga0070712_1000180612 217
101 3300006175 Ga0070712_100028581 Ga0070712_1000285814 217
102 3300006175 Ga0070712_100198070 Ga0070712_1001980701 217
103 3300006177 Ga0075362_10010621 Ga0075362_100106213 217
104 3300006178 Ga0075367_10014751 Ga0075367_100147515 217
105 3300006178 Ga0075367_10018028 Ga0075367_100180284 217
106 3300006186 Ga0075369_10025269 Ga0075369_100252692 217
107 3300006852 Ga0075433_10005169 Ga0075433_100051699 217
108 3300006871 Ga0075434_100001060 Ga0075434_10000106023 217
109 3300006871 Ga0075434_100059001 Ga0075434_1000590013 217
110 3300006881 Ga0068865_100165848 Ga0068865_1001658482 217
111 3300006931 Ga0097620_100001900 Ga0097620_1000019006 217
112 3300006931 Ga0097620_100398507 Ga0097620_1003985072 217
113 3300007076 Ga0075435_100178806 Ga0075435_1001788062 217
114 3300007265 Ga0099794_10165882 Ga0099794_101658822 217
115 3300009147 Ga0114129_10099832 Ga0114129_100998322 217
116 3300009147 Ga0114129_10108325 Ga0114129_101083253 217
117 3300009147 Ga0114129_10310564 Ga0114129_103105642 217
118 3300009147 Ga0114129_10490184 Ga0114129_104901842 217
119 3300009148 Ga0105243_10099580 Ga0105243_100995803 217
120 3300009174 Ga0105241_10005107 Ga0105241_100051076 217
121 3300009177 Ga0105248_10216222 Ga0105248_102162223 217
122 3300009177 Ga0105248_10649667 Ga0105248_106496672 217
123 3300009545 Ga0105237_10019228 Ga0105237_100192286 217
124 3300009545 Ga0105237_10125868 Ga0105237_101258683 217
125 3300009545 Ga0105237_10431468 Ga0105237_104314681 217
126 3300009551 Ga0105238_10071756 Ga0105238_100717565 217
127 3300009551 Ga0105238_10817267 Ga0105238_108172671 217
128 3300009553 Ga0105249_10001320 Ga0105249_1000132010 217
129 3300009553 Ga0105249_10073420 Ga0105249_100734202 217
130 3300010375 Ga0105239_10125529 Ga0105239_101255291 217
131 3300011119 Ga0105246_10565152 Ga0105246_105651522 217
132 3300013104 Ga0157370_10182133 Ga0157370_101821332 217
133 3300013297 Ga0157378_10150847 Ga0157378_101508472 217
134 3300013297 Ga0157378_11135858 Ga0157378_111358582 217
135 3300013306 Ga0163162_10754469 Ga0163162_107544692 217
136 3300013307 Ga0157372_10785526 Ga0157372_107855262 217
137 3300014325 Ga0163163_10121111 Ga0163163_101211113 217
138 3300014326 Ga0157380_10063889 Ga0157380_100638892 217
139 3300014968 Ga0157379_10211813 Ga0157379_102118131 217
140 3300020069 Ga0197907_10534692 Ga0197907_105346922 217
141 3300020070 Ga0206356_10421548 Ga0206356_104215482 217
142 3300020070 Ga0206356_11190142 Ga0206356_111901422 217
143 3300020076 Ga0206355_1227927 Ga0206355_12279272 217
144 3300020078 Ga0206352_10935876 Ga0206352_109358761 217
145 3300020081 Ga0206354_10308217 Ga0206354_103082171 217
146 3300021441 Ga0213871_10031431 Ga0213871_100314311 217
147 3300022467 Ga0224712_10060805 Ga0224712_100608051 217
148 3300025272 Ga0209455_1004205 Ga0209455_10042051 217
149 3300025284 Ga0209130_1000503 Ga0209130_100050311 217
150 3300025294 Ga0209025_1000206 Ga0209025_1000206102 217
151 3300025297 Ga0209758_1001695 Ga0209758_100169516 217
152 3300025297 Ga0209758_1045767 Ga0209758_10457672 217
153 3300025302 Ga0207426_1000358 Ga0207426_100035831 217
154 3300025885 Ga0207653_10001223 Ga0207653_100012233 217
155 3300025898 Ga0207692_10007438 Ga0207692_100074384 217
156 3300025898 Ga0207692_10411181 Ga0207692_104111812 217
157 3300025904 Ga0207647_10057381 Ga0207647_100573812 217
158 3300025906 Ga0207699_10021822 Ga0207699_100218222 217
159 3300025908 Ga0207643_10041102 Ga0207643_100411023 217
160 3300025908 Ga0207643_10074556 Ga0207643_100745562 217
161 3300025910 Ga0207684_10065115 Ga0207684_100651152 217
162 3300025912 Ga0207707_10013935 Ga0207707_100139353 217
163 3300025912 Ga0207707_10060583 Ga0207707_100605833 217
164 3300025912 Ga0207707_10179941 Ga0207707_101799412 217
165 3300025914 Ga0207671_10285951 Ga0207671_102859512 217
166 3300025915 Ga0207693_10002566 Ga0207693_100025662 217
167 3300025915 Ga0207693_10099275 Ga0207693_100992752 217
168 3300025916 Ga0207663_10002298 Ga0207663_100022987 217
169 3300025916 Ga0207663_10017163 Ga0207663_100171633 217
170 3300025917 Ga0207660_10011616 Ga0207660_100116164 217
171 3300025917 Ga0207660_10131273 Ga0207660_101312733 217
172 3300025921 Ga0207652_10054300 Ga0207652_100543002 217
173 3300025921 Ga0207652_10076068 Ga0207652_100760682 217
174 3300025921 Ga0207652_10379949 Ga0207652_103799492 217
175 3300025924 Ga0207694_10141809 Ga0207694_101418092 217
176 3300025924 Ga0207694_10381589 Ga0207694_103815891 217
177 3300025928 Ga0207700_10119534 Ga0207700_101195342 217
178 3300025928 Ga0207700_10379377 Ga0207700_103793772 217
179 3300025929 Ga0207664_10022055 Ga0207664_100220553 217
180 3300025929 Ga0207664_10205585 Ga0207664_102055852 217
181 3300025932 Ga0207690_10501262 Ga0207690_105012622 217
182 3300025933 Ga0207706_10496384 Ga0207706_104963841 217
183 3300025935 Ga0207709_10076670 Ga0207709_100766702 217
184 3300025936 Ga0207670_10661955 Ga0207670_106619552 217
185 3300025938 Ga0207704_10143320 Ga0207704_101433201 217
186 3300025939 Ga0207665_10012300 Ga0207665_100123002 217
187 3300025941 Ga0207711_10268566 Ga0207711_102685662 217
188 3300025944 Ga0207661_10579874 Ga0207661_105798742 217
189 3300025945 Ga0207679_10096350 Ga0207679_100963502 217
190 3300025949 Ga0207667_10387471 Ga0207667_103874712 217
191 3300025961 Ga0207712_10065544 Ga0207712_100655442 217
192 3300025961 Ga0207712_10277950 Ga0207712_102779502 217
193 3300026035 Ga0207703_10110905 Ga0207703_101109051 217
194 3300026035 Ga0207703_10441417 Ga0207703_104414172 217
195 3300026035 Ga0207703_11011515 Ga0207703_110115152 217
196 3300026041 Ga0207639_10061457 Ga0207639_100614572 217
197 3300026067 Ga0207678_10074956 Ga0207678_100749563 217
198 3300026067 Ga0207678_10108668 Ga0207678_101086682 217
199 3300026075 Ga0207708_10001022 Ga0207708_1000102217 217
200 3300026095 Ga0207676_10008478 Ga0207676_100084782 217
201 3300026116 Ga0207674_10003569 Ga0207674_1000356916 217
202 3300026116 Ga0207674_10023358 Ga0207674_100233587 217
203 3300026116 Ga0207674_10213434 Ga0207674_102134342 217
204 3300026118 Ga0207675_100246331 Ga0207675_1002463313 217
205 3300026142 Ga0207698_10601540 Ga0207698_106015402 217
206 3300026142 Ga0207698_10665815 Ga0207698_106658152 217
207 3300027866 Ga0209813_10003732 Ga0209813_100037322 217
208 3300027907 Ga0207428_10333802 Ga0207428_103338022 217
209 3300028379 Ga0268266_10615315 Ga0268266_106153152 217
210 3300028380 Ga0268265_10002040 Ga0268265_1000204012 217
211 3300028381 Ga0268264_10001009 Ga0268264_1000100912 217
212 3300031616 Ga0307508_10000021 Ga0307508_1000002181 217
213 3300031616 Ga0307508_10029829 Ga0307508_100298293 217
214 3300031852 Ga0307410_10553837 Ga0307410_105538372 217
215 3300031901 Ga0307406_10066123 Ga0307406_100661231 217
216 3300031911 Ga0307412_10141311 Ga0307412_101413111 217
217 3300032004 Ga0307414_10051494 Ga0307414_100514943 217
218 3300032005 Ga0307411_10086932 Ga0307411_100869323 217
219 3300034817 Ga0373948_0069473 Ga0373948_0069473_85_738 217
220 3300034819 Ga0373958_0050985 Ga0373958_0050985_18_671 217
221 3300034820 Ga0373959_0061032 Ga0373959_0061032_62_715 217
222 3300035088 Ga0373940_0038734 Ga0373940_0038734_465_1118 217
223 3300035091 Ga0373951_0015990 Ga0373951_0015990_506_1159 217
224 3300035207 Ga0373942_0159134 Ga0373942_0159134_13_666 217
225 3300035242 Ga0373962_0090663 Ga0373962_0090663_255_908 217
226 3300035691 Ga0373931_0011590 Ga0373931_0011590_2398_3051 217
227 3300035695 Ga0373927_0010448 Ga0373927_0010448_1230_1883 217
228 3300037418 Ga0395900_0202234 Ga0395900_0202234_1177_1830 217
229 3300037418 Ga0395900_0531297 Ga0395900_0531297_135_788 217
230 3300039437 Ga0436365_0816258 Ga0436365_0816258_55_708 217
231 3300046512 Ga0495610_0007539 Ga0495610_0007539_4850_5503 217
232 3300046515 Ga0495620_0237433 Ga0495620_0237433_19_672 217
233 3300048903 Ga0496100_0147164 Ga0496100_0147164_523_1176 217
234 3300048904 Ga0496101_0085674 Ga0496101_0085674_744_1397 217
235 3300048905 Ga0496102_0005628 Ga0496102_0005628_3465_4118 217
236 3300048905 Ga0496102_0006640 Ga0496102_0006640_2565_3218 217
237 3300048905 Ga0496102_0356995 Ga0496102_0356995_562_1215 217
238 3300048906 Ga0496103_0008644 Ga0496103_0008644_2437_3090 217
239 3300048907 Ga0496104_0186137 Ga0496104_0186137_419_1072 217
240 3300048908 Ga0496105_0391116 Ga0496105_0391116_294_947 217
241 3300048909 Ga0496106_0001865 Ga0496106_0001865_9272_9925 217
242 3300048909 Ga0496106_0006496 Ga0496106_0006496_5419_6072 217
243 3300048910 Ga0496107_0000470 Ga0496107_0000470_4140_4793 217
244 3300048910 Ga0496107_0035311 Ga0496107_0035311_1572_2225 217
245 3300048911 Ga0496108_0064999 Ga0496108_0064999_1469_2122 217
246 3300048911 Ga0496108_0103285 Ga0496108_0103285_1357_2010 217
247 3300048912 Ga0496109_0054856 Ga0496109_0054856_2561_3214 217
248 3300048913 Ga0496110_0028134 Ga0496110_0028134_3556_4209 217
249 3300048914 Ga0496111_0535628 Ga0496111_0535628_133_786 217
250 3300048916 Ga0496113_0358298 Ga0496113_0358298_208_861 217
251 3300048918 Ga0496115_0010382 Ga0496115_0010382_2978_3631 217
252 3300048918 Ga0496115_0022385 Ga0496115_0022385_2347_3000 217
253 3300048918 Ga0496115_0120518 Ga0496115_0120518_374_1027 217
254 3300048924 Ga0496121_0126793 Ga0496121_0126793_121_774 217
255 3300048929 Ga0496126_0032926 Ga0496126_0032926_853_1506 217
256 3300048929 Ga0496126_0294834 Ga0496126_0294834_658_1311 217
257 3300049569 Ga0501032_0186093 Ga0501032_0186093_92_745 217
258 3300049571 Ga0501034_0000013 Ga0501034_0000013_210834_211487 217
259 3300049571 Ga0501034_0495576 Ga0501034_0495576_348_1007 217
260 3300049572 Ga0501036_0148530 Ga0501036_0148530_921_1598 217
261 3300049572 Ga0501036_0170911 Ga0501036_0170911_945_1598 217
262 3300049573 Ga0501037_0010600 Ga0501037_0010600_4565_5218 217
263 3300049573 Ga0501037_0451797 Ga0501037_0451797_166_819 217
264 3300049574 Ga0501038_0003054 Ga0501038_0003054_4267_4920 217
265 3300049574 Ga0501038_0054605 Ga0501038_0054605_359_1012 217
266 3300049575 Ga0501039_0000710 Ga0501039_0000710_12447_13100 217
267 3300049575 Ga0501039_0059892 Ga0501039_0059892_989_1642 217
268 3300049576 Ga0501040_0450504 Ga0501040_0450504_156_809 217
269 3300049576 Ga0501040_0521910 Ga0501040_0521910_164_817 217
270 3300049577 Ga0501041_0093112 Ga0501041_0093112_341_994 217
271 3300049579 Ga0501043_0076198 Ga0501043_0076198_183_836 217
272 3300049579 Ga0501043_0106741 Ga0501043_0106741_1472_2125 217
273 3300049580 Ga0501046_0059563 Ga0501046_0059563_614_1267 217
274 3300049580 Ga0501046_0235486 Ga0501046_0235486_206_991 217
275 3300049580 Ga0501046_0250443 Ga0501046_0250443_46_699 217
276 3300049581 Ga0501047_0000721 Ga0501047_0000721_9194_9847 217
277 3300049581 Ga0501047_0593957 Ga0501047_0593957_38_691 217
278 3300049582 Ga0501048_0310430 Ga0501048_0310430_131_784 217
279 3300049583 Ga0501067_0055006 Ga0501067_0055006_842_1495 217
280 3300049588 Ga0501072_0238658 Ga0501072_0238658_179_832 217
281 3300049588 Ga0501072_0427261 Ga0501072_0427261_183_836 217
282 3300049589 Ga0501073_0032065 Ga0501073_0032065_2601_3254 217
283 3300049591 Ga0501075_0053514 Ga0501075_0053514_112_765 217
284 3300049591 Ga0501075_0122423 Ga0501075_0122423_1112_1765 217
285 3300049742 Ga0501080_0000003 Ga0501080_0000003_203364_204017 217
286 3300049742 Ga0501080_0202756 Ga0501080_0202756_1006_1683 217
287 3300049743 Ga0501081_0041698 Ga0501081_0041698_1271_1924 217
288 3300049822 Ga0501035_0000058 Ga0501035_0000058_46687_47340 217
289 3300049823 Ga0501044_0000023 Ga0501044_0000023_108102_108755 217
290 3300049824 Ga0501045_0071325 Ga0501045_0071325_1482_2135 217
291 3300050489 nmdc:mga03683_21623_c1 nmdc:mga03683_21623_c1_336_989 217
292 3300050490 nmdc:mga03n38_240872_c1 nmdc:mga03n38_240872_c1_172_825 217
293 3300050490 nmdc:mga03n38_57861_c1 nmdc:mga03n38_57861_c1_1001_1654 217
294 3300050491 nmdc:mga00v17_27593_c1 nmdc:mga00v17_27593_c1_1987_2640 217
295 3300050492 nmdc:mga0yw44_161891_c1 nmdc:mga0yw44_161891_c1_147_800 217
296 3300050492 nmdc:mga0yw44_17575_c1 nmdc:mga0yw44_17575_c1_2203_2856 217
297 3300050492 nmdc:mga0yw44_428949_c1 nmdc:mga0yw44_428949_c1_209_862 217
298 3300050494 nmdc:mga06z11_17370_c1 nmdc:mga06z11_17370_c1_2212_2865 217
299 3300050494 nmdc:mga06z11_9145_c1 nmdc:mga06z11_9145_c1_3310_3963 217
300 3300050507 nmdc:mga05p37_138419_c1 nmdc:mga05p37_138419_c1_1175_1828 217
301 3300050507 nmdc:mga05p37_89636_c1 nmdc:mga05p37_89636_c1_1987_2640 217
302 3300050508 nmdc:mga09592_384602_c1 nmdc:mga09592_384602_c1_276_929 217
303 3300050510 nmdc:mga06r32_594154_c1 nmdc:mga06r32_594154_c1_115_768 217
304 3300050510 nmdc:mga06r32_9797_c1 nmdc:mga06r32_9797_c1_2353_3027 217
305 3300050511 nmdc:mga08y16_82810_c1 nmdc:mga08y16_82810_c1_2375_3028 217
306 3300050512 nmdc:mga0n895_3395_c1 nmdc:mga0n895_3395_c1_4804_5457 217
307 3300050512 nmdc:mga0n895_646_c1 nmdc:mga0n895_646_c1_21734_22387 217
308 3300050512 nmdc:mga0n895_647800_c1 nmdc:mga0n895_647800_c1_237_893 217
309 3300050513 nmdc:mga0rr50_179816_c1 nmdc:mga0rr50_179816_c1_1032_1685 217
310 3300050515 nmdc:mga0a205_172838_c1 nmdc:mga0a205_172838_c1_463_1116 217
311 3300050515 nmdc:mga0a205_183888_c1 nmdc:mga0a205_183888_c1_1286_1939 217
312 3300050515 nmdc:mga0a205_6734_c1 nmdc:mga0a205_6734_c1_592_1245 217
313 3300050516 nmdc:mga0sz30_24378_c1 nmdc:mga0sz30_24378_c1_1472_2125 217
314 3300053111 Ga0500572_000346 Ga0500572_000346_4679_5332 217
315 3300053136 Ga0500559_0004222 Ga0500559_0004222_3280_3933 217
316 3300053178 Ga0500637_0276353 Ga0500637_0276353_183_875 217
317 3300053725 Ga0500576_056313 Ga0500576_056313_613_1266 217
318 3300053730 Ga0500645_072128 Ga0500645_072128_126_779 217
319 3300053735 Ga0500596_002159 Ga0500596_002159_3008_3661 217
320 3300059506 Ga0587085_003908 Ga0587085_003908_860_1513 217
321 3300060353 Ga0501082_0055163 Ga0501082_0055163_45_698 217
322 3300060353 Ga0501082_0071525 Ga0501082_0071525_341_994 217
323 3300060353 Ga0501082_0155291 Ga0501082_0155291_761_1414 217
324 3300060353 Ga0501082_0410151 Ga0501082_0410151_251_979 217
325 3300061734 Ga0530510_0148813 Ga0530510_0148813_24_701 217
326 3300061734 Ga0530510_0175839 Ga0530510_0175839_139_792 217
327 3300061734 Ga0530510_0359047 Ga0530510_0359047_159_812 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

16

132

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.7824 13 216
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.7719 13 216
5cgz-assembly1.cif.gz_A crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 0.7672 13 217
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.7517 13 212
3dfi-assembly1.cif.gz_A the crystal structure of antimicrobial reagent a40926 pseudoaglycone deacetylase dbv21 0.748 15 211
ID Description Score Start End Superfamily
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7719 13 216 3.40.50.10320
5cgzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7672 13 217 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7584 4 174 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7425 13 217 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7306 1 210 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A536HLR8-F1-model_v4 PIG-L family deacetylase 0.9865 47 216
AF-A0A4R1S7T4-F1-model_v4 LmbE family N-acetylglucosaminyl deacetylase 0.9829 1 217 GO:0016811
AF-A0A0S8ESC3-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9801 13 217 GO:0016811
AF-A0A3D2CWW8-F1-model_v4 deleted 0.9794 107 217
AF-A0A656Z3R4-F1-model_v4 GlcNAc-PI de-N-acetylase 0.979 12 202 GO:0016811

Feature Viewer

pLDDT pTM Quality
92.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map