F408826

General Info

Members Datasets Scaffolds Average Seq Length
327 204 654 263

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10130064|Ga0207679_101300643
Length 298
Sequence LDLGGHPRLAAHLSTQAAAGRFLAYAIRLHDSQHRPDVRIATYNVNGINGRLPRLLEWLAETRPDVVCLQELKTDDSKFPVRALADAGYGAVWHGQRAHHGVAILARDETPREVLRGLPGDPGDAQTRYLEATVRGLVVSSVYLPNGNPQPGPKFDYKLAWFERLIAHARVLYAAGAPTVLAGDFNVVPTDRDIYNPWLWRWDAVMQPESRHAYGRLLAQGWTDATRRVYPDERIYTYWVNAHAFGRDNGFRMDFLLLSAEATSRLLAAGLDASYRGRERPSDHARPGLTCPRPRTSV

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
202 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
203 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
204 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0.31
Rhizoplane 2.75
Rhizosphere 90.21
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10130064 3300025945 Bacteria 2018
2 SwRhRL2b_contig_1540189 2162886007 Bacteria 2907
3 JGI25165J46597_1000012 3300003214 Bacteria 421074
4 Ga0055532_1005262 3300003758 Bacteria 1837
5 Ga0070658_10163145 3300005327 Bacteria 1870
6 Ga0070676_10102557 3300005328 Bacteria 1770
7 Ga0070683_100027492 3300005329 Bacteria 5130
8 Ga0070683_100315439 3300005329 Bacteria 1488
9 Ga0070690_100000674 3300005330 Bacteria 17423
10 Ga0070670_100008925 3300005331 Bacteria 8561
11 Ga0070670_100075603 3300005331 Bacteria 2894
12 Ga0070670_100189341 3300005331 Bacteria 1787
13 Ga0068869_100009763 3300005334 Bacteria 6234
14 Ga0068869_100491499 3300005334 Bacteria 1023
15 Ga0070666_10006295 3300005335 Bacteria 7300
16 Ga0070666_10008643 3300005335 Bacteria 6331
17 Ga0070666_10162125 3300005335 Bacteria 1563
18 Ga0070666_10200515 3300005335 Bacteria 1404
19 Ga0070680_100012586 3300005336 Bacteria 6578
20 Ga0070680_100044449 3300005336 Bacteria 3609
21 Ga0068868_100001668 3300005338 Bacteria 15169
22 Ga0070689_100037029 3300005340 Bacteria 3732
23 Ga0070689_100061525 3300005340 Bacteria 2920
24 Ga0070661_100041598 3300005344 Bacteria 3353
25 Ga0070668_100015634 3300005347 Bacteria 5673
26 Ga0070668_100200069 3300005347 Bacteria 1640
27 Ga0070669_100306891 3300005353 Bacteria 1278
28 Ga0070675_100025238 3300005354 Bacteria 4764
29 Ga0070675_100040079 3300005354 Bacteria 3823
30 Ga0070675_100139918 3300005354 Bacteria 2068
31 Ga0070671_100005745 3300005355 Bacteria 9880
32 Ga0070671_100006640 3300005355 Bacteria 9248
33 Ga0070671_100024637 3300005355 Bacteria 4928
34 Ga0070671_100047580 3300005355 Bacteria 3566
35 Ga0070674_100417851 3300005356 Bacteria 1100
36 Ga0070673_100004666 3300005364 Bacteria 8699
37 Ga0070673_100041249 3300005364 Bacteria 3548
38 Ga0070673_100189167 3300005364 Bacteria 1767
39 Ga0070673_100394302 3300005364 Bacteria 1237
40 Ga0070659_100113531 3300005366 Bacteria 2188
41 Ga0070667_100000401 3300005367 Bacteria 46849
42 Ga0070667_100008687 3300005367 Bacteria 8420
43 Ga0070667_100018341 3300005367 Bacteria 5803
44 Ga0070714_100007736 3300005435 Bacteria 8372
45 Ga0070663_100000590 3300005455 Bacteria 19317
46 Ga0070678_100001560 3300005456 Bacteria 12263
47 Ga0070678_100051910 3300005456 Bacteria 2975
48 Ga0070681_10001291 3300005458 Bacteria 21857
49 Ga0068867_100284799 3300005459 Bacteria 1356
50 Ga0068867_100536156 3300005459 Bacteria 1011
51 Ga0070679_100034164 3300005530 Bacteria 5039
52 Ga0070684_100001171 3300005535 Bacteria 18817
53 Ga0070672_100029448 3300005543 Bacteria 4118
54 Ga0070672_100044472 3300005543 Bacteria 3430
55 Ga0070672_100556219 3300005543 Bacteria 996
56 Ga0070665_100009452 3300005548 Bacteria 9866
57 Ga0070665_100009545 3300005548 Bacteria 9813
58 Ga0070665_100028647 3300005548 Bacteria 5608
59 Ga0068855_100035330 3300005563 Bacteria 5954
60 Ga0068855_100183049 3300005563 Bacteria 2368
61 Ga0068855_100220545 3300005563 Bacteria 2127
62 Ga0070664_100013464 3300005564 Bacteria 6661
63 Ga0070664_100016564 3300005564 Bacteria 6045
64 Ga0070664_100032890 3300005564 Bacteria 4339
65 Ga0068857_100473952 3300005577 Bacteria 1172
66 Ga0068854_100050889 3300005578 Bacteria 2966
67 Ga0068856_100022007 3300005614 Bacteria 6199
68 Ga0068856_100144042 3300005614 Bacteria 2391
69 Ga0068852_100022718 3300005616 Bacteria 5035
70 Ga0068852_100341779 3300005616 Bacteria 1459
71 Ga0068859_100002993 3300005617 Bacteria 17130
72 Ga0068859_100026600 3300005617 Bacteria 5802
73 Ga0068859_100605369 3300005617 Bacteria 1189
74 Ga0068864_100003039 3300005618 Bacteria 13855
75 Ga0068864_100069441 3300005618 Bacteria 3064
76 Ga0068864_100265291 3300005618 Bacteria 1598
77 Ga0068864_100615478 3300005618 Bacteria 1055
78 Ga0068861_100704988 3300005719 Bacteria 938
79 Ga0068851_10010792 3300005834 Bacteria 4271
80 Ga0068863_100001479 3300005841 Bacteria 23291
81 Ga0068863_100008632 3300005841 Bacteria 9956
82 Ga0068858_100000472 3300005842 Bacteria 41922
83 Ga0068858_100001164 3300005842 Bacteria 27258
84 Ga0068858_100007745 3300005842 Bacteria 10366
85 Ga0068858_100061062 3300005842 Bacteria 3484
86 Ga0068860_100010292 3300005843 Bacteria 9252
87 Ga0068862_100006291 3300005844 Bacteria 9881
88 Ga0070717_10630512 3300006028 Bacteria 973
89 Ga0070712_100351960 3300006175 Bacteria 1206
90 Ga0075366_10076605 3300006195 Bacteria 1996
91 Ga0097621_100216741 3300006237 Bacteria 1666
92 Ga0097621_100330874 3300006237 Bacteria 1351
93 Ga0068871_100110344 3300006358 Bacteria 2313
94 Ga0097620_100002993 3300006931 Bacteria 17130
95 Ga0097620_100026597 3300006931 Bacteria 5802
96 Ga0097620_100605398 3300006931 Bacteria 1189
97 Ga0105240_10095242 3300009093 Unclassified 3630
98 Ga0105240_10408206 3300009093 Unclassified 1528
99 Ga0105240_10504846 3300009093 Bacteria 1344
100 Ga0111539_10734138 3300009094 Bacteria 1150
101 Ga0105245_10005691 3300009098 Bacteria 10947
102 Ga0105247_10032476 3300009101 Bacteria 3172
103 Ga0105243_10680042 3300009148 Bacteria 1001
104 Ga0105241_10001153 3300009174 Bacteria 20106
105 Ga0105241_10747593 3300009174 Bacteria 896
106 Ga0105248_10006814 3300009177 Bacteria 12524
107 Ga0105248_10015019 3300009177 Bacteria 8524
108 Ga0105237_10001657 3300009545 Bacteria 28897
109 Ga0105237_10142734 3300009545 Bacteria 2389
110 Ga0105238_10107810 3300009551 Bacteria 2766
111 Ga0105238_10477831 3300009551 Bacteria 1245
112 Ga0105249_10001007 3300009553 Bacteria 24946
113 Ga0105239_11112067 3300010375 Bacteria 910
114 Ga0157373_10001625 3300013100 Bacteria 17155
115 Ga0157370_10285327 3300013104 Bacteria 1525
116 Ga0157369_10543909 3300013105 Bacteria 1201
117 Ga0157378_10233426 3300013297 Bacteria 1754
118 Ga0163162_10211033 3300013306 Unclassified 2071
119 Ga0163162_10606682 3300013306 Bacteria 1220
120 Ga0157372_10001119 3300013307 Bacteria 29120
121 Ga0157372_10049942 3300013307 Bacteria 4653
122 Ga0157375_10009010 3300013308 Bacteria 8734
123 Ga0163163_10004818 3300014325 Bacteria 11591
124 Ga0163163_10251955 3300014325 Bacteria 1816
125 Ga0157380_10084727 3300014326 Bacteria 2599
126 Ga0157380_10756150 3300014326 Bacteria 984
127 Ga0157379_10021534 3300014968 Bacteria 5708
128 Ga0157379_10220214 3300014968 Bacteria 1720
129 Ga0157376_10060968 3300014969 Bacteria 3170
130 Ga0163161_10151463 3300017792 Bacteria 1763
131 Ga0163161_10262269 3300017792 Bacteria 1350
132 Ga0163161_10451411 3300017792 Bacteria 1039
133 Ga0214544_1000002 3300021320 Bacteria 753857
134 Ga0209147_102450 3300025229 Bacteria 4604
135 Ga0207697_10022824 3300025315 Bacteria 2563
136 Ga0207697_10042360 3300025315 Bacteria 1871
137 Ga0207656_10110339 3300025321 Bacteria 1270
138 Ga0207682_10050103 3300025893 Bacteria 1726
139 Ga0207682_10055163 3300025893 Bacteria 1652
140 Ga0207680_10008440 3300025903 Bacteria 5059
141 Ga0207680_10008447 3300025903 Bacteria 5056
142 Ga0207645_10231760 3300025907 Bacteria 1219
143 Ga0207643_10088520 3300025908 Bacteria 1802
144 Ga0207643_10174667 3300025908 Bacteria 1298
145 Ga0207705_10140766 3300025909 Bacteria 1801
146 Ga0207654_10011092 3300025911 Bacteria 4586
147 Ga0207654_10021431 3300025911 Bacteria 3436
148 Ga0207707_10030196 3300025912 Bacteria 4741
149 Ga0207671_10060962 3300025914 Bacteria 2799
150 Ga0207671_10065739 3300025914 Bacteria 2698
151 Ga0207657_10000524 3300025919 Bacteria 40619
152 Ga0207649_10043741 3300025920 Bacteria 2740
153 Ga0207652_10117939 3300025921 Bacteria 2358
154 Ga0207652_10140149 3300025921 Bacteria 2162
155 Ga0207681_10250620 3300025923 Bacteria 1382
156 Ga0207681_10428851 3300025923 Bacteria 1072
157 Ga0207650_10000443 3300025925 Bacteria 35591
158 Ga0207650_10003770 3300025925 Bacteria 10366
159 Ga0207650_10126927 3300025925 Bacteria 1992
160 Ga0207650_10172495 3300025925 Bacteria 1720
161 Ga0207659_10001360 3300025926 Bacteria 14606
162 Ga0207659_10027607 3300025926 Bacteria 3846
163 Ga0207659_10426300 3300025926 Bacteria 1113
164 Ga0207687_10000853 3300025927 Bacteria 20620
165 Ga0207687_10207405 3300025927 Unclassified 1535
166 Ga0207664_10042280 3300025929 Bacteria 3556
167 Ga0207644_10014175 3300025931 Bacteria 5331
168 Ga0207644_10060346 3300025931 Bacteria 2744
169 Ga0207644_10116408 3300025931 Bacteria 2028
170 Ga0207644_10369345 3300025931 Bacteria 1168
171 Ga0207706_10293831 3300025933 Bacteria 1416
172 Ga0207709_10036621 3300025935 Bacteria 2908
173 Ga0207670_10020357 3300025936 Bacteria 4076
174 Ga0207670_10070963 3300025936 Bacteria 2407
175 Ga0207669_10111529 3300025937 Bacteria 1834
176 Ga0207665_10201434 3300025939 Bacteria 1451
177 Ga0207691_10008722 3300025940 Bacteria 9726
178 Ga0207691_10018930 3300025940 Bacteria 6523
179 Ga0207691_10077473 3300025940 Bacteria 2995
180 Ga0207691_10285182 3300025940 Bacteria 1421
181 Ga0207691_10575450 3300025940 Bacteria 954
182 Ga0207711_10004367 3300025941 Bacteria 12064
183 Ga0207711_10021426 3300025941 Bacteria 5400
184 Ga0207711_10022264 3300025941 Bacteria 5299
185 Ga0207711_10254947 3300025941 Bacteria 1612
186 Ga0207689_10127991 3300025942 Bacteria 2088
187 Ga0207689_10483890 3300025942 Bacteria 1036
188 Ga0207679_10008330 3300025945 Bacteria 6604
189 Ga0207667_10023396 3300025949 Bacteria 6803
190 Ga0207667_10024386 3300025949 Bacteria 6641
191 Ga0207667_10105599 3300025949 Bacteria 2906
192 Ga0207651_10005362 3300025960 Bacteria 6574
193 Ga0207651_10012981 3300025960 Bacteria 4744
194 Ga0207651_10290489 3300025960 Bacteria 1355
195 Ga0207651_10297746 3300025960 Bacteria 1340
196 Ga0207712_10000772 3300025961 Bacteria 23947
197 Ga0207668_10002068 3300025972 Bacteria 11697
198 Ga0207668_10103424 3300025972 Bacteria 2121
199 Ga0207640_10151166 3300025981 Bacteria 1706
200 Ga0207658_10007788 3300025986 Bacteria 7294
201 Ga0207658_10041997 3300025986 Bacteria 3315
202 Ga0207677_10004773 3300026023 Bacteria 7312
203 Ga0207677_10055865 3300026023 Bacteria 2702
204 Ga0207703_10000568 3300026035 Bacteria 37997
205 Ga0207703_10005563 3300026035 Bacteria 10112
206 Ga0207703_10005879 3300026035 Bacteria 9830
207 Ga0207703_10051050 3300026035 Bacteria 3350
208 Ga0207639_10204067 3300026041 Bacteria 1697
209 Ga0207678_10000974 3300026067 Bacteria 26088
210 Ga0207702_10010434 3300026078 Bacteria 7771
211 Ga0207702_10082153 3300026078 Bacteria 2801
212 Ga0207641_10001486 3300026088 Bacteria 22946
213 Ga0207641_10007765 3300026088 Bacteria 8914
214 Ga0207648_10197273 3300026089 Bacteria 1785
215 Ga0207676_10002826 3300026095 Bacteria 12355
216 Ga0207676_10018089 3300026095 Bacteria 5117
217 Ga0207674_10000045 3300026116 Bacteria 122251
218 Ga0207683_10019109 3300026121 Bacteria 5848
219 Ga0207683_10081717 3300026121 Bacteria 2868
220 Ga0207698_10033864 3300026142 Bacteria 3717
221 Ga0207698_10095582 3300026142 Bacteria 2446
222 Ga0207698_10152374 3300026142 Bacteria 2009
223 Ga0207698_10247886 3300026142 Bacteria 1628
224 Ga0209966_1005907 3300027695 Bacteria 2113
225 Ga0268266_10014177 3300028379 Bacteria 6857
226 Ga0268266_10019571 3300028379 Bacteria 5767
227 Ga0268266_10091757 3300028379 Bacteria 2664
228 Ga0268265_10028358 3300028380 Bacteria 4007
229 Ga0268264_10000477 3300028381 Bacteria 53721
230 Ga0268264_10027888 3300028381 Bacteria 4617
231 Ga0307515_10025824 3300028794 Bacteria 10141
232 Ga0265338_10129654 3300028800 Bacteria 1994
233 Ga0307509_10390287 3300031507 Bacteria 1102
234 Ga0307408_100007630 3300031548 Bacteria 7154
235 Ga0307508_10001821 3300031616 Bacteria 23580
236 Ga0307405_10007847 3300031731 Bacteria 5372
237 Ga0307405_10280957 3300031731 Bacteria 1253
238 Ga0307410_10455406 3300031852 Bacteria 1044
239 Ga0307406_10399883 3300031901 Bacteria 1088
240 Ga0307407_10029593 3300031903 Bacteria 2944
241 Ga0307407_10128405 3300031903 Bacteria 1618
242 Ga0307412_10029842 3300031911 Bacteria 3426
243 Ga0307412_10160428 3300031911 Bacteria 1670
244 Ga0307412_10268945 3300031911 Bacteria 1333
245 Ga0307416_100012251 3300032002 Bacteria 5765
246 Ga0307416_100096075 3300032002 Bacteria 2561
247 Ga0307414_10044672 3300032004 Bacteria 3028
248 Ga0307414_10056608 3300032004 Bacteria 2752
249 Ga0307415_100033734 3300032126 Bacteria 3324
250 Ga0307510_10002824 3300033180 Bacteria 19930
251 Ga0395900_0091123 3300037418 Bacteria 3133
252 Ga0395898_0616571 3300037466 Bacteria 1028
253 Ga0395905_0146874 3300037471 Bacteria 2219
254 Ga0439431_0042452 3300041997 Bacteria 1162
255 Ga0450895_008681 3300042132 Bacteria 854
256 Ga0450898_012573 3300042134 Bacteria 1400
257 Ga0439434_0047618 3300042435 Bacteria 1325
258 Ga0451577_0493975 3300042876 Bacteria 1111
259 Ga0466963_0107236 3300044694 Unclassified 1916
260 Ga0466960_0063798 3300044901 Bacteria 1814
261 Ga0495627_000494 3300046453 Bacteria 33081
262 Ga0495627_001223 3300046453 Bacteria 16020
263 Ga0495607_0025551 3300046501 Bacteria 3672
264 Ga0495607_0214262 3300046501 Bacteria 946
265 Ga0495610_0000068 3300046512 Bacteria 122949
266 Ga0495628_0252623 3300046516 Unclassified 1316
267 Ga0495637_0045000 3300046520 Bacteria 1875
268 Ga0495643_0000030 3300046522 Bacteria 260229
269 Ga0495648_0021477 3300046524 Bacteria 4468
270 Ga0495648_0034696 3300046524 Bacteria 3280
271 Ga0495642_0200070 3300046528 Bacteria 871
272 Ga0495621_0000865 3300046539 Bacteria 7713
273 Ga0495621_0001885 3300046539 Bacteria 5513
274 Ga0495621_0085678 3300046539 Bacteria 1181
275 Ga0495645_0250604 3300046543 Bacteria 1177
276 Ga0495622_0034133 3300046557 Bacteria 2374
277 Ga0495633_0000515 3300046558 Bacteria 38895
278 Ga0495668_0001793 3300046616 Bacteria 19612
279 Ga0495625_0000153 3300046660 Bacteria 105123
280 Ga0495661_0074709 3300046665 Bacteria 1972
281 Ga0495669_0084904 3300046684 Bacteria 1456
282 Ga0495669_0213629 3300046684 Bacteria 924
283 Ga0495670_0006319 3300046691 Bacteria 5819
284 Ga0495671_0000072 3300046692 Bacteria 97315
285 Ga0495673_0078663 3300047469 Bacteria 1370
286 Ga0495681_0000055 3300047470 Bacteria 104502
287 Ga0495681_0020395 3300047470 Bacteria 3598
288 Ga0495686_0013566 3300047472 Bacteria 5650
289 Ga0496104_0008971 3300048907 Bacteria 8892
290 Ga0496108_0000728 3300048911 Bacteria 25565
291 Ga0496109_0270110 3300048912 Bacteria 1602
292 Ga0496110_0518336 3300048913 Bacteria 1085
293 Ga0496112_0015841 3300048915 Bacteria 7045
294 Ga0496112_0229492 3300048915 Bacteria 1811
295 Ga0496113_0086432 3300048916 Bacteria 2410
296 Ga0496114_0074626 3300048917 Bacteria 2855
297 Ga0496114_0159389 3300048917 Bacteria 1961
298 Ga0496116_0052597 3300048919 Bacteria 2697
299 Ga0496116_0201037 3300048919 Bacteria 1043
300 Ga0496121_0000610 3300048924 Bacteria 66844
301 Ga0496121_0007787 3300048924 Bacteria 12828
302 Ga0496125_0050568 3300048928 Bacteria 3439
303 Ga0496126_0389575 3300048929 Bacteria 1132
304 Ga0495678_027517 3300049459 Bacteria 2412
305 Ga0501036_0205733 3300049572 Bacteria 1655
306 Ga0501039_0423136 3300049575 Bacteria 1046
307 Ga0501043_0557264 3300049579 Bacteria 851
308 Ga0501047_0279308 3300049581 Bacteria 1515
309 Ga0501233_002320 3300049668 Bacteria 3347
310 Ga0501080_0028061 3300049742 Bacteria 5234
311 Ga0501269_006750 3300049766 Bacteria 1386
312 Ga0501035_0050748 3300049822 Bacteria 3717
313 Ga0501044_0051438 3300049823 Bacteria 4248
314 Ga0501044_0551172 3300049823 Bacteria 1050
315 nmdc:mga06r32_12925_c1 3300050510 Bacteria 7548
316 Ga0500641_0028509 3300053096 Bacteria 2182
317 Ga0500642_0045726 3300053130 Bacteria 1912
318 Ga0500559_0060295 3300053136 Bacteria 1690
319 Ga0500573_0000015 3300053140 Bacteria 192264
320 Ga0500616_0004477 3300053153 Bacteria 9930
321 Ga0500636_0108264 3300053177 Bacteria 1573
322 Ga0590071_004539 3300059421 Bacteria 3367
323 Ga0590075_022460 3300059424 Bacteria 1579
324 2885430192 2885429604 Bacteria 3642894
325 2946789253 2946787523 Bacteria 4366789
326 3005484462 3005483717 Bacteria 7877331
327 3005587895 3005587118 Bacteria 7794411
328 Ga0207679_10130064
329 SwRhRL2b_contig_1540189
330 JGI25165J46597_1000012
331 Ga0055532_1005262
332 Ga0070658_10163145
333 Ga0070676_10102557
334 Ga0070683_100027492
335 Ga0070683_100315439
336 Ga0070690_100000674
337 Ga0070670_100008925
338 Ga0070670_100075603
339 Ga0070670_100189341
340 Ga0068869_100009763
341 Ga0068869_100491499
342 Ga0070666_10006295
343 Ga0070666_10008643
344 Ga0070666_10162125
345 Ga0070666_10200515
346 Ga0070680_100012586
347 Ga0070680_100044449
348 Ga0068868_100001668
349 Ga0070689_100037029
350 Ga0070689_100061525
351 Ga0070661_100041598
352 Ga0070668_100015634
353 Ga0070668_100200069
354 Ga0070669_100306891
355 Ga0070675_100025238
356 Ga0070675_100040079
357 Ga0070675_100139918
358 Ga0070671_100005745
359 Ga0070671_100006640
360 Ga0070671_100024637
361 Ga0070671_100047580
362 Ga0070674_100417851
363 Ga0070673_100004666
364 Ga0070673_100041249
365 Ga0070673_100189167
366 Ga0070673_100394302
367 Ga0070659_100113531
368 Ga0070667_100000401
369 Ga0070667_100008687
370 Ga0070667_100018341
371 Ga0070714_100007736
372 Ga0070663_100000590
373 Ga0070678_100001560
374 Ga0070678_100051910
375 Ga0070681_10001291
376 Ga0068867_100284799
377 Ga0068867_100536156
378 Ga0070679_100034164
379 Ga0070684_100001171
380 Ga0070672_100029448
381 Ga0070672_100044472
382 Ga0070672_100556219
383 Ga0070665_100009452
384 Ga0070665_100009545
385 Ga0070665_100028647
386 Ga0068855_100035330
387 Ga0068855_100183049
388 Ga0068855_100220545
389 Ga0070664_100013464
390 Ga0070664_100016564
391 Ga0070664_100032890
392 Ga0068857_100473952
393 Ga0068854_100050889
394 Ga0068856_100022007
395 Ga0068856_100144042
396 Ga0068852_100022718
397 Ga0068852_100341779
398 Ga0068859_100002993
399 Ga0068859_100026600
400 Ga0068859_100605369
401 Ga0068864_100003039
402 Ga0068864_100069441
403 Ga0068864_100265291
404 Ga0068864_100615478
405 Ga0068861_100704988
406 Ga0068851_10010792
407 Ga0068863_100001479
408 Ga0068863_100008632
409 Ga0068858_100000472
410 Ga0068858_100001164
411 Ga0068858_100007745
412 Ga0068858_100061062
413 Ga0068860_100010292
414 Ga0068862_100006291
415 Ga0070717_10630512
416 Ga0070712_100351960
417 Ga0075366_10076605
418 Ga0097621_100216741
419 Ga0097621_100330874
420 Ga0068871_100110344
421 Ga0097620_100002993
422 Ga0097620_100026597
423 Ga0097620_100605398
424 Ga0105240_10095242
425 Ga0105240_10408206
426 Ga0105240_10504846
427 Ga0111539_10734138
428 Ga0105245_10005691
429 Ga0105247_10032476
430 Ga0105243_10680042
431 Ga0105241_10001153
432 Ga0105241_10747593
433 Ga0105248_10006814
434 Ga0105248_10015019
435 Ga0105237_10001657
436 Ga0105237_10142734
437 Ga0105238_10107810
438 Ga0105238_10477831
439 Ga0105249_10001007
440 Ga0105239_11112067
441 Ga0157373_10001625
442 Ga0157370_10285327
443 Ga0157369_10543909
444 Ga0157378_10233426
445 Ga0163162_10211033
446 Ga0163162_10606682
447 Ga0157372_10001119
448 Ga0157372_10049942
449 Ga0157375_10009010
450 Ga0163163_10004818
451 Ga0163163_10251955
452 Ga0157380_10084727
453 Ga0157380_10756150
454 Ga0157379_10021534
455 Ga0157379_10220214
456 Ga0157376_10060968
457 Ga0163161_10151463
458 Ga0163161_10262269
459 Ga0163161_10451411
460 Ga0214544_1000002
461 Ga0209147_102450
462 Ga0207697_10022824
463 Ga0207697_10042360
464 Ga0207656_10110339
465 Ga0207682_10050103
466 Ga0207682_10055163
467 Ga0207680_10008440
468 Ga0207680_10008447
469 Ga0207645_10231760
470 Ga0207643_10088520
471 Ga0207643_10174667
472 Ga0207705_10140766
473 Ga0207654_10011092
474 Ga0207654_10021431
475 Ga0207707_10030196
476 Ga0207671_10060962
477 Ga0207671_10065739
478 Ga0207657_10000524
479 Ga0207649_10043741
480 Ga0207652_10117939
481 Ga0207652_10140149
482 Ga0207681_10250620
483 Ga0207681_10428851
484 Ga0207650_10000443
485 Ga0207650_10003770
486 Ga0207650_10126927
487 Ga0207650_10172495
488 Ga0207659_10001360
489 Ga0207659_10027607
490 Ga0207659_10426300
491 Ga0207687_10000853
492 Ga0207687_10207405
493 Ga0207664_10042280
494 Ga0207644_10014175
495 Ga0207644_10060346
496 Ga0207644_10116408
497 Ga0207644_10369345
498 Ga0207706_10293831
499 Ga0207709_10036621
500 Ga0207670_10020357
501 Ga0207670_10070963
502 Ga0207669_10111529
503 Ga0207665_10201434
504 Ga0207691_10008722
505 Ga0207691_10018930
506 Ga0207691_10077473
507 Ga0207691_10285182
508 Ga0207691_10575450
509 Ga0207711_10004367
510 Ga0207711_10021426
511 Ga0207711_10022264
512 Ga0207711_10254947
513 Ga0207689_10127991
514 Ga0207689_10483890
515 Ga0207679_10008330
516 Ga0207667_10023396
517 Ga0207667_10024386
518 Ga0207667_10105599
519 Ga0207651_10005362
520 Ga0207651_10012981
521 Ga0207651_10290489
522 Ga0207651_10297746
523 Ga0207712_10000772
524 Ga0207668_10002068
525 Ga0207668_10103424
526 Ga0207640_10151166
527 Ga0207658_10007788
528 Ga0207658_10041997
529 Ga0207677_10004773
530 Ga0207677_10055865
531 Ga0207703_10000568
532 Ga0207703_10005563
533 Ga0207703_10005879
534 Ga0207703_10051050
535 Ga0207639_10204067
536 Ga0207678_10000974
537 Ga0207702_10010434
538 Ga0207702_10082153
539 Ga0207641_10001486
540 Ga0207641_10007765
541 Ga0207648_10197273
542 Ga0207676_10002826
543 Ga0207676_10018089
544 Ga0207674_10000045
545 Ga0207683_10019109
546 Ga0207683_10081717
547 Ga0207698_10033864
548 Ga0207698_10095582
549 Ga0207698_10152374
550 Ga0207698_10247886
551 Ga0209966_1005907
552 Ga0268266_10014177
553 Ga0268266_10019571
554 Ga0268266_10091757
555 Ga0268265_10028358
556 Ga0268264_10000477
557 Ga0268264_10027888
558 Ga0307515_10025824
559 Ga0265338_10129654
560 Ga0307509_10390287
561 Ga0307408_100007630
562 Ga0307508_10001821
563 Ga0307405_10007847
564 Ga0307405_10280957
565 Ga0307410_10455406
566 Ga0307406_10399883
567 Ga0307407_10029593
568 Ga0307407_10128405
569 Ga0307412_10029842
570 Ga0307412_10160428
571 Ga0307412_10268945
572 Ga0307416_100012251
573 Ga0307416_100096075
574 Ga0307414_10044672
575 Ga0307414_10056608
576 Ga0307415_100033734
577 Ga0307510_10002824
578 Ga0395900_0091123
579 Ga0395898_0616571
580 Ga0395905_0146874
581 Ga0439431_0042452
582 Ga0450895_008681
583 Ga0450898_012573
584 Ga0439434_0047618
585 Ga0451577_0493975
586 Ga0466963_0107236
587 Ga0466960_0063798
588 Ga0495627_000494
589 Ga0495627_001223
590 Ga0495607_0025551
591 Ga0495607_0214262
592 Ga0495610_0000068
593 Ga0495628_0252623
594 Ga0495637_0045000
595 Ga0495643_0000030
596 Ga0495648_0021477
597 Ga0495648_0034696
598 Ga0495642_0200070
599 Ga0495621_0000865
600 Ga0495621_0001885
601 Ga0495621_0085678
602 Ga0495645_0250604
603 Ga0495622_0034133
604 Ga0495633_0000515
605 Ga0495668_0001793
606 Ga0495625_0000153
607 Ga0495661_0074709
608 Ga0495669_0084904
609 Ga0495669_0213629
610 Ga0495670_0006319
611 Ga0495671_0000072
612 Ga0495673_0078663
613 Ga0495681_0000055
614 Ga0495681_0020395
615 Ga0495686_0013566
616 Ga0496104_0008971
617 Ga0496108_0000728
618 Ga0496109_0270110
619 Ga0496110_0518336
620 Ga0496112_0015841
621 Ga0496112_0229492
622 Ga0496113_0086432
623 Ga0496114_0074626
624 Ga0496114_0159389
625 Ga0496116_0052597
626 Ga0496116_0201037
627 Ga0496121_0000610
628 Ga0496121_0007787
629 Ga0496125_0050568
630 Ga0496126_0389575
631 Ga0495678_027517
632 Ga0501036_0205733
633 Ga0501039_0423136
634 Ga0501043_0557264
635 Ga0501047_0279308
636 Ga0501233_002320
637 Ga0501080_0028061
638 Ga0501269_006750
639 Ga0501035_0050748
640 Ga0501044_0051438
641 Ga0501044_0551172
642 nmdc:mga06r32_12925_c1
643 Ga0500641_0028509
644 Ga0500642_0045726
645 Ga0500559_0060295
646 Ga0500573_0000015
647 Ga0500616_0004477
648 Ga0500636_0108264
649 Ga0590071_004539
650 Ga0590075_022460
651 2885430192
652 2946789253
653 3005484462
654 3005587895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

41

284

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.965 22 276
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9645 22 276
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9563 22 274
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.954 22 276
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9499 22 276
ID Description Score Start End Superfamily
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9651 22 276 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9552 22 274 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9505 22 276 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9429 22 278 3.60.10.10
af_P96273_24_289_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9417 22 276 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A436KS41-F1-model_v4 deleted 0.9981 22 98
AF-A0A520INZ3-F1-model_v4 Exodeoxyribonuclease III 0.9957 123 277 GO:0006281
GO:0008311
GO:0046872
AF-A0A2W5R7Q2-F1-model_v4 deleted 0.9894 21 278
AF-A0A4Q2XU45-F1-model_v4 deleted 0.9885 163 277
AF-A0A4Q3C055-F1-model_v4 deleted 0.9883 22 276

Map