F408825

General Info

Members Datasets Scaffolds Average Seq Length
327 157 654 201

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10126166|Ga0207661_101261663
Length 225
Sequence MCRWWWSSTYDVVAQPVRSADAPQGRRSVKLALLRHGPTDWNAAGRIQGHTDIPLSDAGLAKMAALRLPLAVRVLRTYASPMLRARQTAEALGLSEPIHDARLMEQNWGSWEGLSRDEIFARHGADAFIKAGANQGEAFRPGGGESTGELHARVASFLKDVAKGEGDAVAVAHLGVLRAAYTLATGWDMATPMPAELDVSKILVLALAKDGVPKIERLNLDYLSL

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
153 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
154 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
155 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 0.31
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10126166 3300025944 Bacteria 2186
2 Ga0070658_10005258 3300005327 Bacteria 10513
3 Ga0070658_10085480 3300005327 Bacteria 2594
4 Ga0070658_10190801 3300005327 Unclassified 1727
5 Ga0070658_10368039 3300005327 Unclassified 1232
6 Ga0070680_100026384 3300005336 Bacteria 4647
7 Ga0068868_100073265 3300005338 Bacteria 2734
8 Ga0070660_100007514 3300005339 Bacteria 7600
9 Ga0070660_100061040 3300005339 Bacteria 2927
10 Ga0070691_10000082 3300005341 Bacteria 26541
11 Ga0070671_100040794 3300005355 Bacteria 3857
12 Ga0070659_100041299 3300005366 Bacteria 3605
13 Ga0070667_100165944 3300005367 Bacteria 1948
14 Ga0070709_10001323 3300005434 Bacteria 13496
15 Ga0070714_100004415 3300005435 Bacteria 10586
16 Ga0070713_100000011 3300005436 Bacteria 146314
17 Ga0070710_10021461 3300005437 Bacteria 3366
18 Ga0070705_100233851 3300005440 Bacteria 1280
19 Ga0070694_100044420 3300005444 Bacteria 2973
20 Ga0070678_100047009 3300005456 Bacteria 3099
21 Ga0070681_10062963 3300005458 Bacteria 3682
22 Ga0070681_10490590 3300005458 Bacteria 1141
23 Ga0070679_100057036 3300005530 Bacteria 3892
24 Ga0070684_100913588 3300005535 Bacteria 823
25 Ga0068853_100003108 3300005539 Bacteria 12692
26 Ga0068853_100090337 3300005539 Bacteria 2692
27 Ga0068853_100465442 3300005539 Bacteria 1190
28 Ga0068853_101231991 3300005539 Archaea 723
29 Ga0070695_100007691 3300005545 Bacteria 6383
30 Ga0070695_100058106 3300005545 Bacteria 2500
31 Ga0070693_100474760 3300005547 Bacteria 882
32 Ga0070665_100000943 3300005548 Bacteria 37102
33 Ga0070665_100014913 3300005548 Bacteria 7801
34 Ga0070665_100035446 3300005548 Bacteria 5017
35 Ga0070665_100049944 3300005548 Bacteria 4197
36 Ga0070665_100058860 3300005548 Bacteria 3851
37 Ga0068855_100049811 3300005563 Bacteria 4938
38 Ga0068855_100107454 3300005563 Bacteria 3206
39 Ga0068855_100249988 3300005563 Bacteria 1978
40 Ga0068857_100000485 3300005577 Bacteria 28393
41 Ga0068857_100208484 3300005577 Bacteria 1783
42 Ga0068857_100411393 3300005577 Bacteria 1260
43 Ga0068856_100000964 3300005614 Bacteria 30705
44 Ga0068856_100069888 3300005614 Bacteria 3472
45 Ga0068856_101563823 3300005614 Bacteria 673
46 Ga0068852_100078559 3300005616 Bacteria 2920
47 Ga0068852_100257301 3300005616 Bacteria 1675
48 Ga0068866_10137978 3300005718 Bacteria 1396
49 Ga0068870_10339915 3300005840 Bacteria 960
50 Ga0068858_100023006 3300005842 Bacteria 5812
51 Ga0068860_100254482 3300005843 Bacteria 1711
52 Ga0068860_100309217 3300005843 Bacteria 1549
53 Ga0070712_100000014 3300006175 Bacteria 108668
54 Ga0070712_100158083 3300006175 Unclassified 1748
55 Ga0097621_100013400 3300006237 Bacteria 6112
56 Ga0097621_100368163 3300006237 Bacteria 1281
57 Ga0097621_100750403 3300006237 Bacteria 901
58 Ga0068871_100114443 3300006358 Bacteria 2273
59 Ga0068871_100194411 3300006358 Unclassified 1749
60 Ga0068871_100215450 3300006358 Unclassified 1662
61 Ga0068865_100001317 3300006881 Bacteria 14473
62 Ga0068865_100152245 3300006881 Unclassified 1756
63 Ga0075436_100000047 3300006914 Bacteria 72907
64 Ga0075436_100012060 3300006914 Bacteria 5928
65 Ga0075436_100055922 3300006914 Bacteria 2726
66 Ga0075435_100038521 3300007076 Bacteria 3811
67 Ga0075435_100104498 3300007076 Bacteria 2350
68 Ga0105240_10000355 3300009093 Bacteria 86025
69 Ga0105240_10075304 3300009093 Bacteria 4163
70 Ga0105240_10161306 3300009093 Bacteria 2663
71 Ga0105240_10225585 3300009093 Bacteria 2180
72 Ga0105240_10253308 3300009093 Bacteria 2035
73 Ga0105240_10293156 3300009093 Bacteria 1864
74 Ga0105240_10460907 3300009093 Bacteria 1420
75 Ga0105240_10466442 3300009093 Bacteria 1410
76 Ga0105240_10572694 3300009093 Bacteria 1247
77 Ga0105245_10415806 3300009098 Bacteria 1347
78 Ga0105245_11210243 3300009098 Bacteria 803
79 Ga0105241_10055995 3300009174 Bacteria 3022
80 Ga0105241_10314315 3300009174 Bacteria 1348
81 Ga0105241_10359223 3300009174 Bacteria 1267
82 Ga0105241_10526590 3300009174 Bacteria 1058
83 Ga0105242_10157204 3300009176 Bacteria 1987
84 Ga0105242_10491966 3300009176 Bacteria 1165
85 Ga0105242_10893263 3300009176 Bacteria 888
86 Ga0105248_10202312 3300009177 Bacteria 2237
87 Ga0105237_10011984 3300009545 Bacteria 9160
88 Ga0105237_10128017 3300009545 Bacteria 2533
89 Ga0105237_10157621 3300009545 Bacteria 2267
90 Ga0105237_10191596 3300009545 Bacteria 2045
91 Ga0105237_10219379 3300009545 Bacteria 1902
92 Ga0105238_10002673 3300009551 Bacteria 17728
93 Ga0105238_10086345 3300009551 Bacteria 3125
94 Ga0105238_10175767 3300009551 Bacteria 2118
95 Ga0105238_10241763 3300009551 Bacteria 1783
96 Ga0105238_10342621 3300009551 Bacteria 1483
97 Ga0105238_10401897 3300009551 Bacteria 1363
98 Ga0105238_10838527 3300009551 Archaea 936
99 Ga0105239_10021957 3300010375 Bacteria 7035
100 Ga0105239_10138950 3300010375 Bacteria 2706
101 Ga0105239_11409449 3300010375 Unclassified 804
102 Ga0105246_10135983 3300011119 Bacteria 1842
103 Ga0157370_10000280 3300013104 Bacteria 64677
104 Ga0157370_10066284 3300013104 Bacteria 3415
105 Ga0157369_10024534 3300013105 Bacteria 6706
106 Ga0157369_10207405 3300013105 Bacteria 2055
107 Ga0157369_11292390 3300013105 Bacteria 744
108 Ga0157374_10015694 3300013296 Bacteria 6649
109 Ga0157374_10085896 3300013296 Bacteria 2993
110 Ga0157374_10561943 3300013296 Bacteria 1149
111 Ga0157378_10459413 3300013297 Unclassified 1265
112 Ga0157378_11130040 3300013297 Bacteria 821
113 Ga0163162_10059945 3300013306 Bacteria 3839
114 Ga0163162_10106594 3300013306 Bacteria 2898
115 Ga0163162_10110018 3300013306 Bacteria 2853
116 Ga0163162_10313890 3300013306 Bacteria 1700
117 Ga0157372_10028316 3300013307 Bacteria 6114
118 Ga0157375_10010088 3300013308 Bacteria 8305
119 Ga0163163_10000012 3300014325 Bacteria 257369
120 Ga0163163_10009127 3300014325 Bacteria 8838
121 Ga0163163_10133348 3300014325 Bacteria 2524
122 Ga0163163_10215169 3300014325 Bacteria 1970
123 Ga0157379_10001799 3300014968 Bacteria 17671
124 Ga0157379_10001810 3300014968 Bacteria 17652
125 Ga0157379_10002104 3300014968 Bacteria 16498
126 Ga0157379_10008828 3300014968 Bacteria 8790
127 Ga0157379_10016993 3300014968 Bacteria 6404
128 Ga0157379_10069919 3300014968 Bacteria 3140
129 Ga0157376_10148719 3300014969 Bacteria 2110
130 Ga0163161_10185845 3300017792 Bacteria 1595
131 Ga0213873_10023545 3300021358 Bacteria 1469
132 Ga0213876_10106801 3300021384 Bacteria 1485
133 Ga0207692_10077160 3300025898 Bacteria 1772
134 Ga0207680_10002669 3300025903 Bacteria 8342
135 Ga0207685_10217326 3300025905 Bacteria 907
136 Ga0207699_10000324 3300025906 Bacteria 25505
137 Ga0207705_10008248 3300025909 Bacteria 7616
138 Ga0207705_10015813 3300025909 Bacteria 5418
139 Ga0207654_10021762 3300025911 Bacteria 3413
140 Ga0207654_10027015 3300025911 Bacteria 3116
141 Ga0207654_10310971 3300025911 Bacteria 1074
142 Ga0207654_10577360 3300025911 Bacteria 801
143 Ga0207707_10137167 3300025912 Bacteria 2139
144 Ga0207707_10517726 3300025912 Bacteria 1016
145 Ga0207695_10005087 3300025913 Bacteria 17628
146 Ga0207695_10011699 3300025913 Bacteria 10604
147 Ga0207695_10041035 3300025913 Bacteria 4954
148 Ga0207695_10042318 3300025913 Bacteria 4867
149 Ga0207695_10145670 3300025913 Bacteria 2313
150 Ga0207695_10354142 3300025913 Bacteria 1355
151 Ga0207671_10019629 3300025914 Bacteria 5165
152 Ga0207671_10224344 3300025914 Bacteria 1473
153 Ga0207693_10000018 3300025915 Bacteria 138365
154 Ga0207693_10568190 3300025915 Bacteria 884
155 Ga0207660_10093474 3300025917 Bacteria 2234
156 Ga0207657_10016102 3300025919 Bacteria 7218
157 Ga0207657_10290942 3300025919 Bacteria 1295
158 Ga0207649_10907079 3300025920 Unclassified 691
159 Ga0207652_10030278 3300025921 Bacteria 4531
160 Ga0207652_10050049 3300025921 Bacteria 3579
161 Ga0207694_10142789 3300025924 Bacteria 1925
162 Ga0207694_10164813 3300025924 Bacteria 1792
163 Ga0207700_10000005 3300025928 Bacteria 394836
164 Ga0207700_10622321 3300025928 Bacteria 961
165 Ga0207664_10015453 3300025929 Bacteria 5542
166 Ga0207644_10096691 3300025931 Bacteria 2211
167 Ga0207690_10058139 3300025932 Bacteria 2614
168 Ga0207686_10084347 3300025934 Bacteria 2081
169 Ga0207669_10253985 3300025937 Bacteria 1311
170 Ga0207669_10725507 3300025937 Bacteria 819
171 Ga0207704_10005022 3300025938 Bacteria 6085
172 Ga0207711_10206764 3300025941 Bacteria 1792
173 Ga0207667_10004769 3300025949 Bacteria 16572
174 Ga0207667_10051717 3300025949 Bacteria 4329
175 Ga0207667_10063793 3300025949 Bacteria 3849
176 Ga0207667_10115733 3300025949 Bacteria 2764
177 Ga0207667_10383742 3300025949 Archaea 1431
178 Ga0207667_10502171 3300025949 Bacteria 1230
179 Ga0207667_10664039 3300025949 Bacteria 1047
180 Ga0207658_10272906 3300025986 Bacteria 1446
181 Ga0207703_10050788 3300026035 Bacteria 3358
182 Ga0207639_10005648 3300026041 Bacteria 8467
183 Ga0207702_10000173 3300026078 Bacteria 77458
184 Ga0207702_10016546 3300026078 Bacteria 6103
185 Ga0207702_10554686 3300026078 Bacteria 1124
186 Ga0207674_10000112 3300026116 Bacteria 94220
187 Ga0207674_10016858 3300026116 Bacteria 7983
188 Ga0207683_10077174 3300026121 Bacteria 2950
189 Ga0268266_10000463 3300028379 Bacteria 59089
190 Ga0268266_10154974 3300028379 Bacteria 2068
191 Ga0268266_10373485 3300028379 Bacteria 1343
192 Ga0268264_10028932 3300028381 Bacteria 4536
193 Ga0268264_10037923 3300028381 Bacteria 3975
194 Ga0265338_10001087 3300028800 Bacteria 45161
195 Ga0265338_10082322 3300028800 Bacteria 2695
196 Ga0265338_10086453 3300028800 Bacteria 2609
197 Ga0265338_10102139 3300028800 Bacteria 2332
198 Ga0265330_10089489 3300031235 Bacteria 1322
199 Ga0265332_10018326 3300031238 Bacteria 3089
200 Ga0265332_10073881 3300031238 Bacteria 1450
201 Ga0265332_10151492 3300031238 Bacteria 970
202 Ga0265320_10000462 3300031240 Bacteria 31842
203 Ga0265320_10147278 3300031240 Bacteria 1064
204 Ga0265325_10000118 3300031241 Bacteria 54374
205 Ga0265325_10009493 3300031241 Bacteria 5675
206 Ga0265325_10027978 3300031241 Bacteria 3043
207 Ga0265325_10040702 3300031241 Bacteria 2439
208 Ga0265325_10099850 3300031241 Bacteria 1422
209 Ga0265340_10000159 3300031247 Bacteria 34106
210 Ga0265340_10006089 3300031247 Bacteria 6650
211 Ga0265339_10123613 3300031249 Bacteria 1328
212 Ga0265339_10144629 3300031249 Bacteria 1207
213 Ga0265339_10292063 3300031249 Unclassified 779
214 Ga0265331_10006178 3300031250 Bacteria 7110
215 Ga0265331_10024384 3300031250 Bacteria 3061
216 Ga0265331_10026456 3300031250 Bacteria 2915
217 Ga0265331_10038375 3300031250 Bacteria 2342
218 Ga0265316_10003090 3300031344 Bacteria 16962
219 Ga0265316_10020529 3300031344 Bacteria 5621
220 Ga0265316_10114947 3300031344 Bacteria 2035
221 Ga0265316_10166795 3300031344 Bacteria 1644
222 Ga0265313_10000599 3300031595 Bacteria 37436
223 Ga0265314_10009151 3300031711 Bacteria 8405
224 Ga0265314_10018412 3300031711 Bacteria 5445
225 Ga0265314_10018782 3300031711 Bacteria 5374
226 Ga0265314_10067431 3300031711 Bacteria 2410
227 Ga0265314_10087227 3300031711 Bacteria 2041
228 Ga0265342_10002218 3300031712 Bacteria 17059
229 Ga0265342_10036379 3300031712 Bacteria 3008
230 Ga0265342_10093056 3300031712 Bacteria 1726
231 Ga0373923_0160307 3300035111 Bacteria 1026
232 Ga0373954_0179979 3300035118 Unclassified 1037
233 Ga0373957_0143217 3300035120 Unclassified 978
234 Ga0373955_0216438 3300035172 Bacteria 1143
235 Ga0373931_0020566 3300035691 Bacteria 3304
236 Ga0373927_0715715 3300035695 Bacteria 661
237 Ga0373933_0021499 3300035724 Bacteria 3665
238 Ga0373933_0260994 3300035724 Bacteria 1117
239 Ga0373937_0000718 3300036401 Bacteria 28861
240 Ga0373925_0015741 3300037068 Bacteria 5475
241 Ga0395900_0045335 3300037418 Bacteria 4529
242 Ga0395898_0013604 3300037466 Bacteria 8375
243 Ga0395898_0063095 3300037466 Bacteria 3596
244 Ga0395901_0099546 3300038443 Bacteria 3048
245 Ga0436362_0070418 3300039453 Bacteria 3300
246 Ga0451577_0043265 3300042876 Bacteria 4035
247 Ga0466967_0116930 3300045976 Bacteria 2457
248 Ga0495587_0012962 3300046536 Bacteria 5241
249 Ga0495645_0381960 3300046543 Bacteria 901
250 Ga0495599_0155160 3300046678 Unclassified 1417
251 Ga0495684_0106056 3300047471 Bacteria 2123
252 Ga0495602_0651582 3300048088 Bacteria 719
253 Ga0496111_0010209 3300048914 Bacteria 6292
254 Ga0496121_0006998 3300048924 Bacteria 13702
255 Ga0496126_0000653 3300048929 Bacteria 64292
256 Ga0501032_0014059 3300049569 Bacteria 5678
257 Ga0501033_0002118 3300049570 Bacteria 17169
258 Ga0501033_0014233 3300049570 Bacteria 6046
259 Ga0501033_0021788 3300049570 Bacteria 4836
260 Ga0501033_0096408 3300049570 Bacteria 2161
261 Ga0501033_0108728 3300049570 Bacteria 2020
262 Ga0501033_0192025 3300049570 Bacteria 1461
263 Ga0501033_0616605 3300049570 Unclassified 743
264 Ga0501034_0039298 3300049571 Bacteria 4792
265 Ga0501036_0002420 3300049572 Bacteria 14607
266 Ga0501036_0078698 3300049572 Bacteria 2789
267 Ga0501036_0230539 3300049572 Bacteria 1554
268 Ga0501037_0021864 3300049573 Bacteria 4734
269 Ga0501037_0022712 3300049573 Bacteria 4638
270 Ga0501038_0039051 3300049574 Bacteria 4154
271 Ga0501038_0039990 3300049574 Bacteria 4098
272 Ga0501038_0141654 3300049574 Bacteria 1967
273 Ga0501040_0128186 3300049576 Bacteria 1783
274 Ga0501042_0057164 3300049578 Bacteria 2784
275 Ga0501043_0042465 3300049579 Bacteria 3573
276 Ga0501043_0064966 3300049579 Bacteria 2865
277 Ga0501043_0189750 3300049579 Bacteria 1599
278 Ga0501046_0005596 3300049580 Bacteria 11216
279 Ga0501046_0045692 3300049580 Bacteria 3478
280 Ga0501047_0008948 3300049581 Bacteria 9454
281 Ga0501047_0018249 3300049581 Bacteria 6724
282 Ga0501047_0025131 3300049581 Bacteria 5722
283 Ga0501047_0099499 3300049581 Bacteria 2787
284 Ga0501047_0183096 3300049581 Bacteria 1961
285 Ga0501047_0329941 3300049581 Bacteria 1364
286 Ga0501047_0360806 3300049581 Bacteria 1289
287 Ga0501047_0645300 3300049581 Bacteria 878
288 Ga0501048_0006603 3300049582 Bacteria 8813
289 Ga0501067_0002650 3300049583 Bacteria 9909
290 Ga0501068_0095639 3300049584 Bacteria 1837
291 Ga0501070_0008408 3300049586 Bacteria 8716
292 Ga0501072_0090195 3300049588 Bacteria 2433
293 Ga0501074_0001938 3300049590 Bacteria 14219
294 Ga0501074_0276534 3300049590 Bacteria 1194
295 Ga0501079_0008020 3300049741 Bacteria 8001
296 Ga0501079_0233912 3300049741 Unclassified 1436
297 Ga0501080_0043176 3300049742 Bacteria 4197
298 Ga0501080_0330884 3300049742 Bacteria 1378
299 Ga0501083_0022473 3300049744 Bacteria 4376
300 Ga0501083_0030254 3300049744 Bacteria 3721
301 Ga0501035_0002523 3300049822 Bacteria 17906
302 Ga0501035_0063821 3300049822 Bacteria 3275
303 Ga0501035_0129477 3300049822 Bacteria 2201
304 Ga0501035_0161698 3300049822 Bacteria 1938
305 Ga0501035_0534180 3300049822 Bacteria 962
306 Ga0501044_0022005 3300049823 Bacteria 6798
307 Ga0501044_0059202 3300049823 Bacteria 3925
308 Ga0501044_0081020 3300049823 Bacteria 3287
309 Ga0501044_0110733 3300049823 Bacteria 2754
310 Ga0501044_0168984 3300049823 Bacteria 2159
311 Ga0501044_0216347 3300049823 Bacteria 1868
312 Ga0501044_0592532 3300049823 Unclassified 1002
313 Ga0501045_0040497 3300049824 Bacteria 3390
314 nmdc:mga0rr50_161502_c1 3300050513 Bacteria 1819
315 nmdc:mga0rr50_210133_c1 3300050513 Unclassified 1603
316 nmdc:mga08x19_29144_c1 3300050514 Bacteria 3461
317 nmdc:mga08x19_62_c1 3300050514 Bacteria 114601
318 nmdc:mga08x19_71115_c1 3300050514 Bacteria 2268
319 Ga0500555_027438 3300053103 Bacteria 1624
320 Ga0500595_001781 3300053119 Bacteria 11211
321 Ga0500655_069599 3300053133 Bacteria 716
322 Ga0500639_078010 3300053163 Bacteria 1674
323 Ga0501084_0004173 3300054114 Bacteria 11785
324 Ga0501084_0216758 3300054114 Bacteria 1615
325 Ga0501084_1100773 3300054114 Bacteria 667
326 Ga0501082_0031137 3300060353 Bacteria 4598
327 Ga0501082_0137456 3300060353 Bacteria 2120
328 Ga0207661_10126166
329 Ga0070658_10005258
330 Ga0070658_10085480
331 Ga0070658_10190801
332 Ga0070658_10368039
333 Ga0070680_100026384
334 Ga0068868_100073265
335 Ga0070660_100007514
336 Ga0070660_100061040
337 Ga0070691_10000082
338 Ga0070671_100040794
339 Ga0070659_100041299
340 Ga0070667_100165944
341 Ga0070709_10001323
342 Ga0070714_100004415
343 Ga0070713_100000011
344 Ga0070710_10021461
345 Ga0070705_100233851
346 Ga0070694_100044420
347 Ga0070678_100047009
348 Ga0070681_10062963
349 Ga0070681_10490590
350 Ga0070679_100057036
351 Ga0070684_100913588
352 Ga0068853_100003108
353 Ga0068853_100090337
354 Ga0068853_100465442
355 Ga0068853_101231991
356 Ga0070695_100007691
357 Ga0070695_100058106
358 Ga0070693_100474760
359 Ga0070665_100000943
360 Ga0070665_100014913
361 Ga0070665_100035446
362 Ga0070665_100049944
363 Ga0070665_100058860
364 Ga0068855_100049811
365 Ga0068855_100107454
366 Ga0068855_100249988
367 Ga0068857_100000485
368 Ga0068857_100208484
369 Ga0068857_100411393
370 Ga0068856_100000964
371 Ga0068856_100069888
372 Ga0068856_101563823
373 Ga0068852_100078559
374 Ga0068852_100257301
375 Ga0068866_10137978
376 Ga0068870_10339915
377 Ga0068858_100023006
378 Ga0068860_100254482
379 Ga0068860_100309217
380 Ga0070712_100000014
381 Ga0070712_100158083
382 Ga0097621_100013400
383 Ga0097621_100368163
384 Ga0097621_100750403
385 Ga0068871_100114443
386 Ga0068871_100194411
387 Ga0068871_100215450
388 Ga0068865_100001317
389 Ga0068865_100152245
390 Ga0075436_100000047
391 Ga0075436_100012060
392 Ga0075436_100055922
393 Ga0075435_100038521
394 Ga0075435_100104498
395 Ga0105240_10000355
396 Ga0105240_10075304
397 Ga0105240_10161306
398 Ga0105240_10225585
399 Ga0105240_10253308
400 Ga0105240_10293156
401 Ga0105240_10460907
402 Ga0105240_10466442
403 Ga0105240_10572694
404 Ga0105245_10415806
405 Ga0105245_11210243
406 Ga0105241_10055995
407 Ga0105241_10314315
408 Ga0105241_10359223
409 Ga0105241_10526590
410 Ga0105242_10157204
411 Ga0105242_10491966
412 Ga0105242_10893263
413 Ga0105248_10202312
414 Ga0105237_10011984
415 Ga0105237_10128017
416 Ga0105237_10157621
417 Ga0105237_10191596
418 Ga0105237_10219379
419 Ga0105238_10002673
420 Ga0105238_10086345
421 Ga0105238_10175767
422 Ga0105238_10241763
423 Ga0105238_10342621
424 Ga0105238_10401897
425 Ga0105238_10838527
426 Ga0105239_10021957
427 Ga0105239_10138950
428 Ga0105239_11409449
429 Ga0105246_10135983
430 Ga0157370_10000280
431 Ga0157370_10066284
432 Ga0157369_10024534
433 Ga0157369_10207405
434 Ga0157369_11292390
435 Ga0157374_10015694
436 Ga0157374_10085896
437 Ga0157374_10561943
438 Ga0157378_10459413
439 Ga0157378_11130040
440 Ga0163162_10059945
441 Ga0163162_10106594
442 Ga0163162_10110018
443 Ga0163162_10313890
444 Ga0157372_10028316
445 Ga0157375_10010088
446 Ga0163163_10000012
447 Ga0163163_10009127
448 Ga0163163_10133348
449 Ga0163163_10215169
450 Ga0157379_10001799
451 Ga0157379_10001810
452 Ga0157379_10002104
453 Ga0157379_10008828
454 Ga0157379_10016993
455 Ga0157379_10069919
456 Ga0157376_10148719
457 Ga0163161_10185845
458 Ga0213873_10023545
459 Ga0213876_10106801
460 Ga0207692_10077160
461 Ga0207680_10002669
462 Ga0207685_10217326
463 Ga0207699_10000324
464 Ga0207705_10008248
465 Ga0207705_10015813
466 Ga0207654_10021762
467 Ga0207654_10027015
468 Ga0207654_10310971
469 Ga0207654_10577360
470 Ga0207707_10137167
471 Ga0207707_10517726
472 Ga0207695_10005087
473 Ga0207695_10011699
474 Ga0207695_10041035
475 Ga0207695_10042318
476 Ga0207695_10145670
477 Ga0207695_10354142
478 Ga0207671_10019629
479 Ga0207671_10224344
480 Ga0207693_10000018
481 Ga0207693_10568190
482 Ga0207660_10093474
483 Ga0207657_10016102
484 Ga0207657_10290942
485 Ga0207649_10907079
486 Ga0207652_10030278
487 Ga0207652_10050049
488 Ga0207694_10142789
489 Ga0207694_10164813
490 Ga0207700_10000005
491 Ga0207700_10622321
492 Ga0207664_10015453
493 Ga0207644_10096691
494 Ga0207690_10058139
495 Ga0207686_10084347
496 Ga0207669_10253985
497 Ga0207669_10725507
498 Ga0207704_10005022
499 Ga0207711_10206764
500 Ga0207667_10004769
501 Ga0207667_10051717
502 Ga0207667_10063793
503 Ga0207667_10115733
504 Ga0207667_10383742
505 Ga0207667_10502171
506 Ga0207667_10664039
507 Ga0207658_10272906
508 Ga0207703_10050788
509 Ga0207639_10005648
510 Ga0207702_10000173
511 Ga0207702_10016546
512 Ga0207702_10554686
513 Ga0207674_10000112
514 Ga0207674_10016858
515 Ga0207683_10077174
516 Ga0268266_10000463
517 Ga0268266_10154974
518 Ga0268266_10373485
519 Ga0268264_10028932
520 Ga0268264_10037923
521 Ga0265338_10001087
522 Ga0265338_10082322
523 Ga0265338_10086453
524 Ga0265338_10102139
525 Ga0265330_10089489
526 Ga0265332_10018326
527 Ga0265332_10073881
528 Ga0265332_10151492
529 Ga0265320_10000462
530 Ga0265320_10147278
531 Ga0265325_10000118
532 Ga0265325_10009493
533 Ga0265325_10027978
534 Ga0265325_10040702
535 Ga0265325_10099850
536 Ga0265340_10000159
537 Ga0265340_10006089
538 Ga0265339_10123613
539 Ga0265339_10144629
540 Ga0265339_10292063
541 Ga0265331_10006178
542 Ga0265331_10024384
543 Ga0265331_10026456
544 Ga0265331_10038375
545 Ga0265316_10003090
546 Ga0265316_10020529
547 Ga0265316_10114947
548 Ga0265316_10166795
549 Ga0265313_10000599
550 Ga0265314_10009151
551 Ga0265314_10018412
552 Ga0265314_10018782
553 Ga0265314_10067431
554 Ga0265314_10087227
555 Ga0265342_10002218
556 Ga0265342_10036379
557 Ga0265342_10093056
558 Ga0373923_0160307
559 Ga0373954_0179979
560 Ga0373957_0143217
561 Ga0373955_0216438
562 Ga0373931_0020566
563 Ga0373927_0715715
564 Ga0373933_0021499
565 Ga0373933_0260994
566 Ga0373937_0000718
567 Ga0373925_0015741
568 Ga0395900_0045335
569 Ga0395898_0013604
570 Ga0395898_0063095
571 Ga0395901_0099546
572 Ga0436362_0070418
573 Ga0451577_0043265
574 Ga0466967_0116930
575 Ga0495587_0012962
576 Ga0495645_0381960
577 Ga0495599_0155160
578 Ga0495684_0106056
579 Ga0495602_0651582
580 Ga0496111_0010209
581 Ga0496121_0006998
582 Ga0496126_0000653
583 Ga0501032_0014059
584 Ga0501033_0002118
585 Ga0501033_0014233
586 Ga0501033_0021788
587 Ga0501033_0096408
588 Ga0501033_0108728
589 Ga0501033_0192025
590 Ga0501033_0616605
591 Ga0501034_0039298
592 Ga0501036_0002420
593 Ga0501036_0078698
594 Ga0501036_0230539
595 Ga0501037_0021864
596 Ga0501037_0022712
597 Ga0501038_0039051
598 Ga0501038_0039990
599 Ga0501038_0141654
600 Ga0501040_0128186
601 Ga0501042_0057164
602 Ga0501043_0042465
603 Ga0501043_0064966
604 Ga0501043_0189750
605 Ga0501046_0005596
606 Ga0501046_0045692
607 Ga0501047_0008948
608 Ga0501047_0018249
609 Ga0501047_0025131
610 Ga0501047_0099499
611 Ga0501047_0183096
612 Ga0501047_0329941
613 Ga0501047_0360806
614 Ga0501047_0645300
615 Ga0501048_0006603
616 Ga0501067_0002650
617 Ga0501068_0095639
618 Ga0501070_0008408
619 Ga0501072_0090195
620 Ga0501074_0001938
621 Ga0501074_0276534
622 Ga0501079_0008020
623 Ga0501079_0233912
624 Ga0501080_0043176
625 Ga0501080_0330884
626 Ga0501083_0022473
627 Ga0501083_0030254
628 Ga0501035_0002523
629 Ga0501035_0063821
630 Ga0501035_0129477
631 Ga0501035_0161698
632 Ga0501035_0534180
633 Ga0501044_0022005
634 Ga0501044_0059202
635 Ga0501044_0081020
636 Ga0501044_0110733
637 Ga0501044_0168984
638 Ga0501044_0216347
639 Ga0501044_0592532
640 Ga0501045_0040497
641 nmdc:mga0rr50_161502_c1
642 nmdc:mga0rr50_210133_c1
643 nmdc:mga08x19_29144_c1
644 nmdc:mga08x19_62_c1
645 nmdc:mga08x19_71115_c1
646 Ga0500555_027438
647 Ga0500595_001781
648 Ga0500655_069599
649 Ga0500639_078010
650 Ga0501084_0004173
651 Ga0501084_0216758
652 Ga0501084_1100773
653 Ga0501082_0031137
654 Ga0501082_0137456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

31

221

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8325 2 186
2p9y-assembly2.cif.gz_B crystal structure of tthb049 from thermus thermophilus hb8 0.8233 1 190
2p9y-assembly2.cif.gz_B crystal structure of tthb049 from thermus thermophilus hb8 0.8144 1 190
2p78-assembly2.cif.gz_B crystal structure of tthb049 from thermus thermophilus hb8 0.8132 1 191
2p9z-assembly2.cif.gz_B crystal structure of tthb049 from thermus thermophilus hb8 0.8126 1 190
ID Description Score Start End Superfamily
af_O06240_1_204_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8413 1 189 3.40.50.1240
1ebbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8325 2 186 3.40.50.1240
af_A0A1D6QHM8_37_228_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8235 1 178 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8195 1 189 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8147 3 152 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A846MXJ2-F1-model_v4 Putative phosphoglycerate mutase (EC 5.4.2.12) 0.9744 1 198 GO:0016791
GO:0016853
AF-A0A846MXJ2-F1-model_v4 Putative phosphoglycerate mutase (EC 5.4.2.12) 0.9601 1 198 GO:0016791
GO:0016853
AF-A0A3D2VEP4-F1-model_v4 Histidine phosphatase family protein 0.9333 3 154 GO:0005737
GO:0016791
AF-A0A2D7FJR6-F1-model_v4 Phosphoglycerate mutase 0.9306 2 197 GO:0005737
GO:0016791
AF-A0A2D8HI13-F1-model_v4 Phosphoglycerate mutase 0.9298 1 195 GO:0005737
GO:0016791

Map