F408789

General Info

Members Datasets Scaffolds Average Seq Length
327 233 327 222

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10330337|Ga0157375_103303372
Length 245
Sequence MEFSFPPAQFSPNNSAGGWMRILAMAVAGLGLAAGSLSAQMNDPTKTVADAGVKMAGWTGRVDPQAAKQGKSINDDKLVSMGSGFHITSGPAAIYWNPKNTASGNYTVSGSFTQTKSPSHAEAYGLFIGGKNLNAANQSYAYFVVRQDGKYLINHRANDSTVHKIVDWTANPAVVSADANGKATNKLSIVVGADKVSFVANGVEVSSLPRAQLDGMGQGTAGIAGVRVNHNLDVHVDGFAVTPAK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
119 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
211 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2845164 2162886012 Unclassified 1482
2 Ga0058862_12856308 3300004803 Bacteria 941
3 Ga0070683_100319410 3300005329 Bacteria 1478
4 Ga0070670_100028469 3300005331 Bacteria 4809
5 Ga0070670_100511264 3300005331 Bacteria 1069
6 Ga0070670_100586163 3300005331 Bacteria 997
7 Ga0070670_100820511 3300005331 Unclassified 841
8 Ga0070677_10069970 3300005333 Bacteria 1474
9 Ga0070666_10109800 3300005335 Unclassified 1907
10 Ga0070680_100277278 3300005336 Bacteria 1420
11 Ga0068868_100245061 3300005338 Bacteria 1507
12 Ga0070660_100499274 3300005339 Unclassified 1012
13 Ga0070660_100537084 3300005339 Unclassified 975
14 Ga0070689_100572579 3300005340 Unclassified 975
15 Ga0070661_100207203 3300005344 Bacteria 1500
16 Ga0070669_100022515 3300005353 Bacteria 4505
17 Ga0070669_100495581 3300005353 Bacteria 1013
18 Ga0070675_100004273 3300005354 Bacteria 10875
19 Ga0070671_100118104 3300005355 Bacteria 2230
20 Ga0070671_100194989 3300005355 Unclassified 1717
21 Ga0070671_100396902 3300005355 Bacteria 1180
22 Ga0070673_100094225 3300005364 Bacteria 2454
23 Ga0070673_100261834 3300005364 Bacteria 1511
24 Ga0070673_100553551 3300005364 Bacteria 1045
25 Ga0070673_100724562 3300005364 Unclassified 914
26 Ga0070673_100883676 3300005364 Unclassified 828
27 Ga0070667_100244321 3300005367 Bacteria 1604
28 Ga0070667_100485657 3300005367 Bacteria 1131
29 Ga0070667_100612320 3300005367 Bacteria 1004
30 Ga0070709_10012554 3300005434 Bacteria 4743
31 Ga0070709_10037987 3300005434 Bacteria 2945
32 Ga0070709_10106970 3300005434 Unclassified 1874
33 Ga0070709_10121182 3300005434 Bacteria 1773
34 Ga0070714_100016142 3300005435 Bacteria 6024
35 Ga0070714_100037771 3300005435 Bacteria 4059
36 Ga0070713_100003442 3300005436 Bacteria 10444
37 Ga0070713_100041028 3300005436 Bacteria 3768
38 Ga0070713_100080594 3300005436 Bacteria 2776
39 Ga0070711_100012563 3300005439 Bacteria 5294
40 Ga0070711_100137678 3300005439 Unclassified 1827
41 Ga0070705_100727199 3300005440 Bacteria 782
42 Ga0070678_100011918 3300005456 Bacteria 5381
43 Ga0070678_100038233 3300005456 Unclassified 3377
44 Ga0070662_100143620 3300005457 Bacteria 1852
45 Ga0070681_10001056 3300005458 Bacteria 23441
46 Ga0070681_10079502 3300005458 Bacteria 3236
47 Ga0070681_10187397 3300005458 Unclassified 1989
48 Ga0068867_100524289 3300005459 Bacteria 1022
49 Ga0070707_100109272 3300005468 Bacteria 2682
50 Ga0070707_100602255 3300005468 Bacteria 1061
51 Ga0070707_100680315 3300005468 Unclassified 992
52 Ga0070698_100445535 3300005471 Unclassified 1230
53 Ga0070699_100171931 3300005518 Bacteria 1920
54 Ga0070699_100551497 3300005518 Bacteria 1049
55 Ga0070679_100037062 3300005530 Bacteria 4841
56 Ga0070679_100098477 3300005530 Unclassified 2911
57 Ga0070679_100113973 3300005530 Bacteria 2689
58 Ga0070684_100058472 3300005535 Bacteria 3369
59 Ga0070693_100292610 3300005547 Unclassified 1095
60 Ga0070665_100122009 3300005548 Unclassified 2608
61 Ga0068855_100016159 3300005563 Bacteria 8973
62 Ga0070664_100926148 3300005564 Bacteria 817
63 Ga0068854_100248656 3300005578 Bacteria 1419
64 Ga0068856_100171142 3300005614 Bacteria 2184
65 Ga0068852_100473676 3300005616 Bacteria 1243
66 Ga0068864_100060433 3300005618 Bacteria 3281
67 Ga0068864_100671742 3300005618 Bacteria 1010
68 Ga0068861_100258726 3300005719 Bacteria 1489
69 Ga0068851_10042192 3300005834 Unclassified 2296
70 Ga0068851_10086903 3300005834 Unclassified 1641
71 Ga0068863_100030708 3300005841 Bacteria 5131
72 Ga0068860_100269243 3300005843 Unclassified 1662
73 Ga0081538_10045676 3300005981 Bacteria 2712
74 Ga0070717_10001954 3300006028 Bacteria 14398
75 Ga0070716_100253652 3300006173 Bacteria 1200
76 Ga0070712_100041006 3300006175 Unclassified 3176
77 Ga0070712_100110247 3300006175 Unclassified 2052
78 Ga0075428_100078829 3300006844 Bacteria 3595
79 Ga0075434_100207928 3300006871 Bacteria 1978
80 Ga0075436_100228021 3300006914 Unclassified 1323
81 Ga0075435_100004211 3300007076 Bacteria 9872
82 Ga0075435_100227875 3300007076 Bacteria 1583
83 Ga0105240_10063685 3300009093 Bacteria 4585
84 Ga0105240_10262324 3300009093 Unclassified 1992
85 Ga0105240_10471395 3300009093 Unclassified 1401
86 Ga0105240_10698495 3300009093 Bacteria 1107
87 Ga0111539_10080664 3300009094 Bacteria 3827
88 Ga0105245_10368591 3300009098 Unclassified 1427
89 Ga0114129_10067770 3300009147 Bacteria 4976
90 Ga0105243_10539759 3300009148 Bacteria 1112
91 Ga0105248_10121598 3300009177 Bacteria 2945
92 Ga0105248_10187583 3300009177 Bacteria 2330
93 Ga0105248_10957239 3300009177 Unclassified 967
94 Ga0105237_10412066 3300009545 Bacteria 1356
95 Ga0105238_10102475 3300009551 Unclassified 2844
96 Ga0105249_11115278 3300009553 Unclassified 859
97 Ga0157370_10681572 3300013104 Unclassified 939
98 Ga0157369_10274314 3300013105 Unclassified 1757
99 Ga0157374_10497783 3300013296 Bacteria 1223
100 Ga0157374_10619621 3300013296 Unclassified 1093
101 Ga0157378_10135774 3300013297 Unclassified 2281
102 Ga0157375_10330337 3300013308 Unclassified 1689
103 Ga0206356_10509994 3300020070 Bacteria 1596
104 Ga0206352_10048663 3300020078 Bacteria 823
105 Ga0213876_10128218 3300021384 Bacteria 1348
106 Ga0224712_10177257 3300022467 Unclassified 959
107 Ga0207656_10066291 3300025321 Unclassified 1596
108 Ga0207682_10067867 3300025893 Bacteria 1506
109 Ga0207680_10144512 3300025903 Unclassified 1580
110 Ga0207699_10039156 3300025906 Unclassified 2722
111 Ga0207707_10088771 3300025912 Unclassified 2701
112 Ga0207695_10126647 3300025913 Bacteria 2515
113 Ga0207695_10159531 3300025913 Unclassified 2188
114 Ga0207693_10007601 3300025915 Bacteria 8904
115 Ga0207693_10051032 3300025915 Unclassified 3247
116 Ga0207660_10234600 3300025917 Unclassified 1443
117 Ga0207657_10002484 3300025919 Bacteria 19935
118 Ga0207657_10295120 3300025919 Unclassified 1285
119 Ga0207649_10104149 3300025920 Bacteria 1883
120 Ga0207652_10043987 3300025921 Bacteria 3804
121 Ga0207652_10046331 3300025921 Unclassified 3710
122 Ga0207652_10210588 3300025921 Bacteria 1750
123 Ga0207652_10739114 3300025921 Bacteria 876
124 Ga0207646_10373631 3300025922 Bacteria 1288
125 Ga0207646_10559317 3300025922 Bacteria 1028
126 Ga0207681_10368878 3300025923 Bacteria 1153
127 Ga0207650_10688051 3300025925 Bacteria 863
128 Ga0207659_10133602 3300025926 Bacteria 1919
129 Ga0207687_10167103 3300025927 Unclassified 1693
130 Ga0207700_10018301 3300025928 Bacteria 4704
131 Ga0207700_10153090 3300025928 Bacteria 1907
132 Ga0207700_10444604 3300025928 Bacteria 1142
133 Ga0207700_10826830 3300025928 Unclassified 829
134 Ga0207664_10022544 3300025929 Bacteria 4705
135 Ga0207644_10200333 3300025931 Unclassified 1575
136 Ga0207706_10064211 3300025933 Bacteria 3232
137 Ga0207706_10153474 3300025933 Unclassified 2026
138 Ga0207706_10367267 3300025933 Bacteria 1250
139 Ga0207665_10135114 3300025939 Unclassified 1754
140 Ga0207711_10065508 3300025941 Bacteria 3141
141 Ga0207661_10117682 3300025944 Bacteria 2258
142 Ga0207679_10024321 3300025945 Bacteria 4152
143 Ga0207667_10975866 3300025949 Bacteria 836
144 Ga0207651_10122268 3300025960 Bacteria 1976
145 Ga0207651_10166439 3300025960 Unclassified 1734
146 Ga0207651_10247727 3300025960 Bacteria 1456
147 Ga0207640_10242185 3300025981 Bacteria 1394
148 Ga0207640_10586979 3300025981 Bacteria 941
149 Ga0207658_10514474 3300025986 Unclassified 1068
150 Ga0207678_10169197 3300026067 Unclassified 1866
151 Ga0207702_10415837 3300026078 Bacteria 1299
152 Ga0207648_10121413 3300026089 Bacteria 2298
153 Ga0207648_10196298 3300026089 Bacteria 1790
154 Ga0207676_10464724 3300026095 Unclassified 1195
155 Ga0207675_100287707 3300026118 Bacteria 1598
156 Ga0207675_100342348 3300026118 Bacteria 1464
157 Ga0207683_10001039 3300026121 Bacteria 25326
158 Ga0207683_10211662 3300026121 Bacteria 1765
159 Ga0207698_10548401 3300026142 Bacteria 1133
160 Ga0209995_1004515 3300027471 Bacteria 2226
161 Ga0209971_1049857 3300027682 Bacteria 1011
162 Ga0209966_1002360 3300027695 Bacteria 3144
163 Ga0209998_10000665 3300027717 Bacteria 9162
164 Ga0268266_10035200 3300028379 Bacteria 4260
165 Ga0268264_10552793 3300028381 Unclassified 1129
166 Ga0307413_10059455 3300031824 Unclassified 2348
167 Ga0307413_10572851 3300031824 Bacteria 920
168 Ga0307410_10092541 3300031852 Bacteria 2150
169 Ga0307410_10129057 3300031852 Unclassified 1855
170 Ga0307407_10094023 3300031903 Bacteria 1844
171 Ga0307407_10180756 3300031903 Unclassified 1398
172 Ga0307409_100004640 3300031995 Bacteria 7763
173 Ga0307416_100004464 3300032002 Bacteria 8439
174 Ga0307416_100206113 3300032002 Unclassified 1871
175 Ga0307416_100658957 3300032002 Bacteria 1132
176 Ga0307416_100682269 3300032002 Unclassified 1115
177 Ga0307414_10111463 3300032004 Bacteria 2084
178 Ga0307414_10327487 3300032004 Bacteria 1306
179 Ga0307411_10033595 3300032005 Bacteria 3183
180 Ga0307411_10037821 3300032005 Bacteria 3038
181 Ga0373950_0002201 3300034818 Unclassified 2657
182 Ga0373958_0002461 3300034819 Unclassified 2598
183 Ga0373959_0001486 3300034820 Unclassified 3745
184 Ga0373938_0000298 3300034957 Bacteria 7983
185 Ga0373926_0024933 3300035083 Bacteria 2085
186 Ga0373929_0000871 3300035085 Bacteria 5875
187 Ga0373934_0001881 3300035086 Bacteria 7700
188 Ga0373940_0001139 3300035088 Bacteria 4652
189 Ga0373949_0002613 3300035090 Bacteria 4560
190 Ga0373952_0000270 3300035092 Bacteria 8535
191 Ga0373923_0024399 3300035111 Bacteria 2387
192 Ga0373932_0006059 3300035112 Bacteria 2853
193 Ga0373939_0001056 3300035114 Bacteria 6791
194 Ga0373941_0001886 3300035115 Bacteria 4539
195 Ga0373953_0021141 3300035117 Bacteria 2438
196 Ga0373956_0000393 3300035119 Bacteria 17814
197 Ga0373957_0135808 3300035120 Bacteria 1003
198 Ga0373943_0000728 3300035170 Bacteria 14413
199 Ga0373946_0000892 3300035171 Bacteria 10236
200 Ga0373955_0004121 3300035172 Bacteria 6414
201 Ga0373942_0000793 3300035207 Bacteria 8726
202 Ga0373961_0000851 3300035241 Bacteria 10310
203 Ga0373962_0002091 3300035242 Unclassified 4769
204 Ga0373924_0135851 3300035410 Bacteria 1071
205 Ga0373931_0002820 3300035691 Bacteria 7743
206 Ga0373927_0001633 3300035695 Bacteria 16801
207 Ga0373933_0000183 3300035724 Bacteria 41364
208 Ga0373947_0000262 3300035725 Bacteria 29790
209 Ga0373937_0000533 3300036401 Bacteria 34025
210 Ga0373925_0000391 3300037068 Bacteria 44684
211 Ga0436365_0327239 3300039437 Bacteria 1768
212 Ga0436365_1021014 3300039437 Bacteria 1925
213 Ga0436365_1595344 3300039437 Bacteria 5045
214 Ga0439434_0038429 3300042435 Unclassified 1467
215 Ga0466966_0108673 3300044684 Unclassified 1711
216 Ga0466963_0033284 3300044694 Bacteria 3345
217 Ga0466964_0208301 3300044706 Unclassified 943
218 Ga0466957_0095039 3300044842 Bacteria 1872
219 Ga0466959_0768604 3300045049 Bacteria 644
220 Ga0451576_0012064 3300045051 Bacteria 9753
221 Ga0451576_0493200 3300045051 Bacteria 1287
222 Ga0451576_1152465 3300045051 Unclassified 810
223 Ga0466958_0172002 3300045836 Bacteria 1372
224 Ga0466967_0216287 3300045976 Unclassified 1819
225 Ga0466967_0240192 3300045976 Bacteria 1728
226 Ga0495592_0003228 3300046454 Bacteria 11688
227 Ga0495603_0002086 3300046455 Bacteria 11750
228 Ga0495629_0070088 3300046459 Bacteria 2446
229 Ga0495651_0001298 3300046462 Bacteria 19378
230 Ga0495653_0000271 3300046463 Bacteria 41959
231 Ga0495580_0000058 3300046472 Bacteria 64494
232 Ga0495582_0002406 3300046473 Bacteria 10445
233 Ga0495639_0000673 3300046475 Bacteria 15738
234 Ga0495639_0067057 3300046475 Bacteria 1653
235 Ga0495594_0105353 3300046499 Bacteria 1588
236 Ga0495608_0009615 3300046511 Bacteria 6748
237 Ga0495628_0000358 3300046516 Bacteria 41642
238 Ga0495630_0003247 3300046517 Bacteria 11331
239 Ga0495652_0004851 3300046529 Bacteria 12773
240 Ga0495665_0035968 3300046531 Bacteria 2643
241 Ga0495665_0208487 3300046531 Bacteria 1012
242 Ga0495645_0000060 3300046543 Bacteria 79142
243 Ga0495667_0002466 3300046559 Bacteria 12354
244 Ga0495635_0000260 3300046663 Bacteria 33902
245 Ga0495588_0000455 3300046674 Bacteria 20559
246 Ga0495657_0003150 3300046675 Bacteria 13610
247 Ga0495599_0044705 3300046678 Bacteria 2777
248 Ga0495623_0000151 3300046679 Bacteria 42876
249 Ga0495646_0003329 3300046680 Bacteria 9991
250 Ga0495658_0000058 3300046683 Bacteria 56027
251 Ga0495613_0059326 3300046689 Bacteria 2805
252 Ga0495600_0007033 3300046809 Bacteria 6874
253 Ga0495600_0028214 3300046809 Bacteria 3631
254 Ga0495581_0005714 3300047315 Bacteria 7214
255 Ga0495604_0000494 3300047317 Bacteria 34628
256 Ga0495674_0001853 3300047319 Bacteria 20830
257 Ga0495680_0009752 3300047322 Bacteria 8614
258 Ga0495675_0043702 3300047444 Bacteria 2854
259 Ga0495684_0000428 3300047471 Bacteria 34287
260 Ga0495593_0000529 3300047673 Bacteria 21639
261 Ga0495593_0159469 3300047673 Bacteria 1139
262 Ga0495602_0000545 3300048088 Bacteria 35134
263 Ga0495614_0000105 3300048089 Bacteria 28798
264 Ga0496106_0200093 3300048909 Bacteria 1590
265 Ga0501292_005548 3300049515 Bacteria 1763
266 Ga0501031_0443213 3300049568 Bacteria 839
267 Ga0501033_0025960 3300049570 Bacteria 4411
268 Ga0501033_0032804 3300049570 Bacteria 3900
269 Ga0501034_0052942 3300049571 Bacteria 4089
270 Ga0501034_0135038 3300049571 Bacteria 2448
271 Ga0501036_0038590 3300049572 Bacteria 4042
272 Ga0501036_0649532 3300049572 Bacteria 873
273 Ga0501037_0407770 3300049573 Unclassified 931
274 Ga0501038_0023616 3300049574 Bacteria 5494
275 Ga0501038_0079635 3300049574 Bacteria 2762
276 Ga0501038_0117587 3300049574 Bacteria 2196
277 Ga0501039_0041315 3300049575 Bacteria 3561
278 Ga0501041_0138954 3300049577 Unclassified 1514
279 Ga0501043_0197230 3300049579 Unclassified 1564
280 Ga0501046_0032073 3300049580 Bacteria 4256
281 Ga0501046_0197659 3300049580 Bacteria 1497
282 Ga0501046_0338494 3300049580 Unclassified 1094
283 Ga0501047_0024629 3300049581 Bacteria 5777
284 Ga0501047_0238197 3300049581 Bacteria 1671
285 Ga0501048_0121063 3300049582 Unclassified 1849
286 Ga0501071_0005775 3300049587 Bacteria 7992
287 Ga0501072_0009687 3300049588 Bacteria 7327
288 Ga0501072_0230815 3300049588 Bacteria 1474
289 Ga0501075_0008956 3300049591 Bacteria 6984
290 Ga0501075_0136452 3300049591 Unclassified 1869
291 Ga0501076_0009013 3300049592 Bacteria 7348
292 Ga0501076_0177053 3300049592 Unclassified 1738
293 Ga0501077_0005064 3300049593 Bacteria 7996
294 Ga0501077_0055992 3300049593 Unclassified 2503
295 Ga0501209_008430 3300049656 Bacteria 2031
296 Ga0501217_000945 3300049661 Bacteria 5206
297 Ga0501235_000085 3300049669 Bacteria 14702
298 Ga0501249_011667 3300049679 Bacteria 1848
299 Ga0501257_004601 3300049686 Bacteria 3015
300 Ga0501221_001287 3300049704 Bacteria 4144
301 Ga0501225_0007043 3300049705 Bacteria 3271
302 Ga0501079_0002680 3300049741 Bacteria 12948
303 Ga0501080_0097396 3300049742 Unclassified 2731
304 Ga0501081_0031683 3300049743 Bacteria 3583
305 Ga0501081_0111791 3300049743 Bacteria 1939
306 Ga0501081_0303942 3300049743 Bacteria 1170
307 Ga0501268_001323 3300049765 Bacteria 3071
308 Ga0501035_0043127 3300049822 Bacteria 4066
309 Ga0501035_0123545 3300049822 Unclassified 2261
310 Ga0501044_0017161 3300049823 Bacteria 7768
311 Ga0501045_0002259 3300049824 Bacteria 13074
312 Ga0501045_0039485 3300049824 Unclassified 3435
313 nmdc:mga0rr50_473317_c1 3300050513 Bacteria 1063
314 nmdc:mga0rr50_7385_c1 3300050513 Bacteria 6776
315 nmdc:mga08x19_49260_c1 3300050514 Bacteria 2701
316 Ga0495612_0014442 3300053078 Bacteria 3176
317 Ga0495619_0001001 3300053085 Bacteria 18494
318 Ga0501084_0005716 3300054114 Bacteria 10222
319 Ga0501084_0124207 3300054114 Bacteria 2171
320 Ga0501084_0737879 3300054114 Bacteria 830
321 Ga0590071_000497 3300059421 Bacteria 11481
322 Ga0590074_000876 3300059423 Bacteria 4684
323 Ga0590077_007733 3300059426 Bacteria 2195
324 Ga0501082_0008564 3300060353 Bacteria 8823
325 Ga0501082_0021044 3300060353 Bacteria 5626
326 Ga0501082_0525337 3300060353 Bacteria 1035
327 Ga0530510_0049826 3300061734 Unclassified 3025

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0737879 Ga0501084_0737879_137_790 182
2 3300060353 Ga0501082_0525337 Ga0501082_0525337_204_857 182
3 3300045049 Ga0466959_0768604 Ga0466959_0768604_30_599 189
4 3300031824 Ga0307413_10059455 Ga0307413_100594553 196
5 3300031903 Ga0307407_10180756 Ga0307407_101807561 196
6 3300032002 Ga0307416_100682269 Ga0307416_1006822691 196
7 3300032005 Ga0307411_10037821 Ga0307411_100378214 196
8 3300005367 Ga0070667_100485657 Ga0070667_1004856572 198
9 3300005456 Ga0070678_100038233 Ga0070678_1000382332 198
10 3300005548 Ga0070665_100122009 Ga0070665_1001220092 198
11 3300005618 Ga0068864_100671742 Ga0068864_1006717422 198
12 3300005834 Ga0068851_10086903 Ga0068851_100869033 198
13 3300009177 Ga0105248_10121598 Ga0105248_101215983 198
14 3300009545 Ga0105237_10412066 Ga0105237_104120662 198
15 3300009551 Ga0105238_10102475 Ga0105238_101024752 198
16 3300025321 Ga0207656_10066291 Ga0207656_100662912 198
17 3300025941 Ga0207711_10065508 Ga0207711_100655082 198
18 3300026121 Ga0207683_10211662 Ga0207683_102116622 198
19 3300028379 Ga0268266_10035200 Ga0268266_100352002 198
20 3300005339 Ga0070660_100499274 Ga0070660_1004992741 200
21 3300013104 Ga0157370_10681572 Ga0157370_106815722 200
22 3300022467 Ga0224712_10177257 Ga0224712_101772571 200
23 3300025912 Ga0207707_10088771 Ga0207707_100887712 200
24 3300025919 Ga0207657_10295120 Ga0207657_102951201 200
25 3300025921 Ga0207652_10046331 Ga0207652_100463312 200
26 3300049572 Ga0501036_0649532 Ga0501036_0649532_14_625 200
27 3300049571 Ga0501034_0135038 Ga0501034_0135038_1594_2238 202
28 3300049581 Ga0501047_0238197 Ga0501047_0238197_613_1257 202
29 3300005578 Ga0068854_100248656 Ga0068854_1002486562 203
30 3300046475 Ga0495639_0000673 Ga0495639_0000673_30_677 209
31 3300005331 Ga0070670_100586163 Ga0070670_1005861632 210
32 3300005331 Ga0070670_100820511 Ga0070670_1008205111 210
33 3300005355 Ga0070671_100194989 Ga0070671_1001949892 210
34 3300005364 Ga0070673_100094225 Ga0070673_1000942252 210
35 3300005367 Ga0070667_100612320 Ga0070667_1006123201 210
36 3300005981 Ga0081538_10045676 Ga0081538_100456763 210
37 3300025960 Ga0207651_10247727 Ga0207651_102477272 210
38 3300025986 Ga0207658_10514474 Ga0207658_105144742 210
39 3300032002 Ga0307416_100206113 Ga0307416_1002061134 210
40 3300049570 Ga0501033_0032804 Ga0501033_0032804_1744_2394 210
41 3300049572 Ga0501036_0038590 Ga0501036_0038590_149_799 210
42 3300049573 Ga0501037_0407770 Ga0501037_0407770_20_670 210
43 3300049574 Ga0501038_0023616 Ga0501038_0023616_1273_1923 210
44 3300049575 Ga0501039_0041315 Ga0501039_0041315_2731_3381 210
45 3300049577 Ga0501041_0138954 Ga0501041_0138954_850_1500 210
46 3300049580 Ga0501046_0032073 Ga0501046_0032073_2890_3540 210
47 3300049587 Ga0501071_0005775 Ga0501071_0005775_3201_3851 210
48 3300049588 Ga0501072_0009687 Ga0501072_0009687_4125_4775 210
49 3300049591 Ga0501075_0008956 Ga0501075_0008956_3232_3882 210
50 3300049592 Ga0501076_0009013 Ga0501076_0009013_2872_3522 210
51 3300049593 Ga0501077_0005064 Ga0501077_0005064_5781_6431 210
52 3300049741 Ga0501079_0002680 Ga0501079_0002680_3868_4518 210
53 3300049742 Ga0501080_0097396 Ga0501080_0097396_1644_2294 210
54 3300049743 Ga0501081_0031683 Ga0501081_0031683_1589_2239 210
55 3300049822 Ga0501035_0123545 Ga0501035_0123545_1600_2250 210
56 3300049824 Ga0501045_0002259 Ga0501045_0002259_3796_4446 210
57 3300060353 Ga0501082_0021044 Ga0501082_0021044_2311_2961 210
58 3300009094 Ga0111539_10080664 Ga0111539_100806644 211
59 3300009147 Ga0114129_10067770 Ga0114129_100677705 211
60 3300044694 Ga0466963_0033284 Ga0466963_0033284_994_1632 211
61 3300049568 Ga0501031_0443213 Ga0501031_0443213_120_794 211
62 3300049574 Ga0501038_0117587 Ga0501038_0117587_290_964 211
63 3300049579 Ga0501043_0197230 Ga0501043_0197230_48_722 211
64 3300049580 Ga0501046_0197659 Ga0501046_0197659_483_1136 211
65 3300049582 Ga0501048_0121063 Ga0501048_0121063_301_975 211
66 3300049588 Ga0501072_0230815 Ga0501072_0230815_365_1039 211
67 3300049591 Ga0501075_0136452 Ga0501075_0136452_520_1173 211
68 3300049592 Ga0501076_0177053 Ga0501076_0177053_239_913 211
69 3300049593 Ga0501077_0055992 Ga0501077_0055992_1343_2017 211
70 3300049743 Ga0501081_0111791 Ga0501081_0111791_1189_1842 211
71 3300049743 Ga0501081_0303942 Ga0501081_0303942_86_760 211
72 3300049824 Ga0501045_0039485 Ga0501045_0039485_1435_2109 211
73 3300054114 Ga0501084_0005716 Ga0501084_0005716_9037_9711 211
74 3300054114 Ga0501084_0124207 Ga0501084_0124207_1475_2128 211
75 3300059426 Ga0590077_007733 Ga0590077_007733_548_1201 211
76 3300060353 Ga0501082_0008564 Ga0501082_0008564_2476_3150 211
77 3300061734 Ga0530510_0049826 Ga0530510_0049826_1105_1779 211
78 3300005331 Ga0070670_100511264 Ga0070670_1005112641 212
79 3300005333 Ga0070677_10069970 Ga0070677_100699702 212
80 3300005353 Ga0070669_100495581 Ga0070669_1004955812 212
81 3300005354 Ga0070675_100004273 Ga0070675_1000042735 212
82 3300005364 Ga0070673_100261834 Ga0070673_1002618342 212
83 3300005435 Ga0070714_100037771 Ga0070714_1000377712 212
84 3300005456 Ga0070678_100011918 Ga0070678_1000119185 212
85 3300005459 Ga0068867_100524289 Ga0068867_1005242892 212
86 3300005719 Ga0068861_100258726 Ga0068861_1002587262 212
87 3300009093 Ga0105240_10063685 Ga0105240_100636852 212
88 3300009148 Ga0105243_10539759 Ga0105243_105397592 212
89 3300009553 Ga0105249_11115278 Ga0105249_111152781 212
90 3300025893 Ga0207682_10067867 Ga0207682_100678672 212
91 3300025913 Ga0207695_10159531 Ga0207695_101595311 212
92 3300025923 Ga0207681_10368878 Ga0207681_103688781 212
93 3300025925 Ga0207650_10688051 Ga0207650_106880511 212
94 3300025928 Ga0207700_10826830 Ga0207700_108268301 212
95 3300025933 Ga0207706_10367267 Ga0207706_103672671 212
96 3300025960 Ga0207651_10122268 Ga0207651_101222682 212
97 3300026089 Ga0207648_10196298 Ga0207648_101962982 212
98 3300026118 Ga0207675_100287707 Ga0207675_1002877072 212
99 3300026121 Ga0207683_10001039 Ga0207683_100010398 212
100 3300045051 Ga0451576_0493200 Ga0451576_0493200_448_1158 212
101 3300004803 Ga0058862_12856308 Ga0058862_128563081 213
102 3300005335 Ga0070666_10109800 Ga0070666_101098002 213
103 3300005355 Ga0070671_100396902 Ga0070671_1003969022 213
104 3300005364 Ga0070673_100553551 Ga0070673_1005535512 213
105 3300005457 Ga0070662_100143620 Ga0070662_1001436201 213
106 3300005458 Ga0070681_10079502 Ga0070681_100795022 213
107 3300005530 Ga0070679_100037062 Ga0070679_1000370622 213
108 3300005530 Ga0070679_100113973 Ga0070679_1001139733 213
109 3300005563 Ga0068855_100016159 Ga0068855_1000161595 213
110 3300005614 Ga0068856_100171142 Ga0068856_1001711422 213
111 3300005616 Ga0068852_100473676 Ga0068852_1004736761 213
112 3300005618 Ga0068864_100060433 Ga0068864_1000604334 213
113 3300005841 Ga0068863_100030708 Ga0068863_1000307083 213
114 3300005843 Ga0068860_100269243 Ga0068860_1002692431 213
115 3300006914 Ga0075436_100228021 Ga0075436_1002280212 213
116 3300007076 Ga0075435_100004211 Ga0075435_1000042116 213
117 3300009093 Ga0105240_10471395 Ga0105240_104713952 213
118 3300009093 Ga0105240_10698495 Ga0105240_106984951 213
119 3300009098 Ga0105245_10368591 Ga0105245_103685912 213
120 3300009177 Ga0105248_10187583 Ga0105248_101875832 213
121 3300020070 Ga0206356_10509994 Ga0206356_105099941 213
122 3300025903 Ga0207680_10144512 Ga0207680_101445122 213
123 3300025913 Ga0207695_10126647 Ga0207695_101266472 213
124 3300025919 Ga0207657_10002484 Ga0207657_100024849 213
125 3300025921 Ga0207652_10210588 Ga0207652_102105881 213
126 3300025921 Ga0207652_10739114 Ga0207652_107391141 213
127 3300025927 Ga0207687_10167103 Ga0207687_101671032 213
128 3300025933 Ga0207706_10064211 Ga0207706_100642112 213
129 3300025960 Ga0207651_10166439 Ga0207651_101664392 213
130 3300025981 Ga0207640_10242185 Ga0207640_102421852 213
131 3300025981 Ga0207640_10586979 Ga0207640_105869791 213
132 3300026078 Ga0207702_10415837 Ga0207702_104158372 213
133 3300026095 Ga0207676_10464724 Ga0207676_104647243 213
134 3300026142 Ga0207698_10548401 Ga0207698_105484012 213
135 3300034818 Ga0373950_0002201 Ga0373950_0002201_384_1052 213
136 3300034819 Ga0373958_0002461 Ga0373958_0002461_1683_2351 213
137 3300034820 Ga0373959_0001486 Ga0373959_0001486_2634_3302 213
138 3300034957 Ga0373938_0000298 Ga0373938_0000298_2713_3381 213
139 3300035085 Ga0373929_0000871 Ga0373929_0000871_1677_2345 213
140 3300035088 Ga0373940_0001139 Ga0373940_0001139_3015_3683 213
141 3300035090 Ga0373949_0002613 Ga0373949_0002613_2274_2942 213
142 3300035092 Ga0373952_0000270 Ga0373952_0000270_3589_4257 213
143 3300035112 Ga0373932_0006059 Ga0373932_0006059_1682_2350 213
144 3300035114 Ga0373939_0001056 Ga0373939_0001056_4609_5277 213
145 3300035115 Ga0373941_0001886 Ga0373941_0001886_770_1438 213
146 3300035207 Ga0373942_0000793 Ga0373942_0000793_5067_5735 213
147 3300035241 Ga0373961_0000851 Ga0373961_0000851_9500_10168 213
148 3300035242 Ga0373962_0002091 Ga0373962_0002091_49_717 213
149 3300035691 Ga0373931_0002820 Ga0373931_0002820_5986_6654 213
150 3300045051 Ga0451576_0012064 Ga0451576_0012064_4454_5122 213
151 3300048909 Ga0496106_0200093 Ga0496106_0200093_63_713 213
152 3300050513 nmdc:mga0rr50_7385_c1 nmdc:mga0rr50_7385_c1_939_1607 213
153 3300050514 nmdc:mga08x19_49260_c1 nmdc:mga08x19_49260_c1_597_1265 213
154 3300059421 Ga0590071_000497 Ga0590071_000497_8980_9642 213
155 3300059423 Ga0590074_000876 Ga0590074_000876_1460_2122 213
156 3300020078 Ga0206352_10048663 Ga0206352_100486631 214
157 3300005329 Ga0070683_100319410 Ga0070683_1003194101 215
158 3300005458 Ga0070681_10187397 Ga0070681_101873973 215
159 3300005530 Ga0070679_100098477 Ga0070679_1000984772 215
160 3300005535 Ga0070684_100058472 Ga0070684_1000584723 215
161 3300021384 Ga0213876_10128218 Ga0213876_101282182 215
162 3300025917 Ga0207660_10234600 Ga0207660_102346002 215
163 3300025926 Ga0207659_10133602 Ga0207659_101336021 215
164 3300025944 Ga0207661_10117682 Ga0207661_101176822 215
165 3300039437 Ga0436365_0327239 Ga0436365_0327239_104_823 215
166 3300039437 Ga0436365_1021014 Ga0436365_1021014_604_1323 215
167 3300039437 Ga0436365_1595344 Ga0436365_1595344_1477_2196 215
168 3300046475 Ga0495639_0067057 Ga0495639_0067057_87_737 215
169 3300046499 Ga0495594_0105353 Ga0495594_0105353_87_737 215
170 3300046689 Ga0495613_0059326 Ga0495613_0059326_828_1478 215
171 3300046809 Ga0495600_0028214 Ga0495600_0028214_2970_3620 215
172 3300049570 Ga0501033_0025960 Ga0501033_0025960_631_1347 215
173 3300049571 Ga0501034_0052942 Ga0501034_0052942_1331_2047 215
174 3300049574 Ga0501038_0079635 Ga0501038_0079635_694_1410 215
175 3300049580 Ga0501046_0338494 Ga0501046_0338494_132_848 215
176 3300049581 Ga0501047_0024629 Ga0501047_0024629_4701_5417 215
177 3300049822 Ga0501035_0043127 Ga0501035_0043127_1806_2522 215
178 3300049823 Ga0501044_0017161 Ga0501044_0017161_1577_2293 215
179 3300025931 Ga0207644_10200333 Ga0207644_102003332 216
180 3300031824 Ga0307413_10572851 Ga0307413_105728511 216
181 3300035083 Ga0373926_0024933 Ga0373926_0024933_684_1358 217
182 3300044706 Ga0466964_0208301 Ga0466964_0208301_177_854 218
183 3300045836 Ga0466958_0172002 Ga0466958_0172002_622_1299 218
184 3300045976 Ga0466967_0216287 Ga0466967_0216287_572_1249 218
185 3300005340 Ga0070689_100572579 Ga0070689_1005725792 220
186 3300005353 Ga0070669_100022515 Ga0070669_1000225153 220
187 3300005434 Ga0070709_10012554 Ga0070709_100125542 220
188 3300005434 Ga0070709_10037987 Ga0070709_100379872 220
189 3300005434 Ga0070709_10121182 Ga0070709_101211822 220
190 3300005435 Ga0070714_100016142 Ga0070714_1000161424 220
191 3300005436 Ga0070713_100003442 Ga0070713_1000034422 220
192 3300005436 Ga0070713_100041028 Ga0070713_1000410282 220
193 3300005436 Ga0070713_100080594 Ga0070713_1000805943 220
194 3300005439 Ga0070711_100012563 Ga0070711_1000125634 220
195 3300005439 Ga0070711_100137678 Ga0070711_1001376782 220
196 3300005440 Ga0070705_100727199 Ga0070705_1007271991 220
197 3300005458 Ga0070681_10001056 Ga0070681_100010564 220
198 3300005547 Ga0070693_100292610 Ga0070693_1002926101 220
199 3300005564 Ga0070664_100926148 Ga0070664_1009261481 220
200 3300006028 Ga0070717_10001954 Ga0070717_100019541 220
201 3300006173 Ga0070716_100253652 Ga0070716_1002536522 220
202 3300006175 Ga0070712_100041006 Ga0070712_1000410062 220
203 3300006175 Ga0070712_100110247 Ga0070712_1001102472 220
204 3300006844 Ga0075428_100078829 Ga0075428_1000788293 220
205 3300006871 Ga0075434_100207928 Ga0075434_1002079282 220
206 3300007076 Ga0075435_100227875 Ga0075435_1002278751 220
207 3300013296 Ga0157374_10497783 Ga0157374_104977832 220
208 3300013296 Ga0157374_10619621 Ga0157374_106196212 220
209 3300025906 Ga0207699_10039156 Ga0207699_100391562 220
210 3300025915 Ga0207693_10007601 Ga0207693_100076016 220
211 3300025915 Ga0207693_10051032 Ga0207693_100510322 220
212 3300025921 Ga0207652_10043987 Ga0207652_100439872 220
213 3300025928 Ga0207700_10018301 Ga0207700_100183013 220
214 3300025928 Ga0207700_10153090 Ga0207700_101530902 220
215 3300025928 Ga0207700_10444604 Ga0207700_104446042 220
216 3300025929 Ga0207664_10022544 Ga0207664_100225445 220
217 3300025939 Ga0207665_10135114 Ga0207665_101351142 220
218 3300025945 Ga0207679_10024321 Ga0207679_100243212 220
219 3300035086 Ga0373934_0001881 Ga0373934_0001881_101_787 220
220 3300035111 Ga0373923_0024399 Ga0373923_0024399_60_746 220
221 3300035117 Ga0373953_0021141 Ga0373953_0021141_1708_2394 220
222 3300035119 Ga0373956_0000393 Ga0373956_0000393_79_765 220
223 3300035120 Ga0373957_0135808 Ga0373957_0135808_74_760 220
224 3300035170 Ga0373943_0000728 Ga0373943_0000728_8729_9412 220
225 3300035171 Ga0373946_0000892 Ga0373946_0000892_4589_5272 220
226 3300035172 Ga0373955_0004121 Ga0373955_0004121_5670_6356 220
227 3300035410 Ga0373924_0135851 Ga0373924_0135851_31_717 220
228 3300035695 Ga0373927_0001633 Ga0373927_0001633_12521_13204 220
229 3300035724 Ga0373933_0000183 Ga0373933_0000183_40617_41303 220
230 3300035725 Ga0373947_0000262 Ga0373947_0000262_4870_5553 220
231 3300036401 Ga0373937_0000533 Ga0373937_0000533_52_738 220
232 3300037068 Ga0373925_0000391 Ga0373925_0000391_15764_16447 220
233 3300042435 Ga0439434_0038429 Ga0439434_0038429_312_974 220
234 3300044684 Ga0466966_0108673 Ga0466966_0108673_312_995 220
235 3300044842 Ga0466957_0095039 Ga0466957_0095039_48_731 220
236 3300046454 Ga0495592_0003228 Ga0495592_0003228_2078_2764 220
237 3300046455 Ga0495603_0002086 Ga0495603_0002086_226_909 220
238 3300046459 Ga0495629_0070088 Ga0495629_0070088_1676_2359 220
239 3300046462 Ga0495651_0001298 Ga0495651_0001298_18618_19304 220
240 3300046463 Ga0495653_0000271 Ga0495653_0000271_41233_41919 220
241 3300046472 Ga0495580_0000058 Ga0495580_0000058_16203_16886 220
242 3300046473 Ga0495582_0002406 Ga0495582_0002406_4870_5553 220
243 3300046511 Ga0495608_0009615 Ga0495608_0009615_24_710 220
244 3300046516 Ga0495628_0000358 Ga0495628_0000358_66_752 220
245 3300046517 Ga0495630_0003247 Ga0495630_0003247_6983_7666 220
246 3300046529 Ga0495652_0004851 Ga0495652_0004851_11994_12680 220
247 3300046531 Ga0495665_0035968 Ga0495665_0035968_240_923 220
248 3300046531 Ga0495665_0208487 Ga0495665_0208487_62_748 220
249 3300046543 Ga0495645_0000060 Ga0495645_0000060_23996_24682 220
250 3300046559 Ga0495667_0002466 Ga0495667_0002466_7529_8215 220
251 3300046663 Ga0495635_0000260 Ga0495635_0000260_63_749 220
252 3300046674 Ga0495588_0000455 Ga0495588_0000455_3488_4171 220
253 3300046675 Ga0495657_0003150 Ga0495657_0003150_47_733 220
254 3300046678 Ga0495599_0044705 Ga0495599_0044705_2045_2731 220
255 3300046679 Ga0495623_0000151 Ga0495623_0000151_42122_42808 220
256 3300046680 Ga0495646_0003329 Ga0495646_0003329_9243_9929 220
257 3300046683 Ga0495658_0000058 Ga0495658_0000058_48153_48836 220
258 3300046809 Ga0495600_0007033 Ga0495600_0007033_57_743 220
259 3300047315 Ga0495581_0005714 Ga0495581_0005714_720_1403 220
260 3300047317 Ga0495604_0000494 Ga0495604_0000494_20386_21072 220
261 3300047319 Ga0495674_0001853 Ga0495674_0001853_6516_7202 220
262 3300047322 Ga0495680_0009752 Ga0495680_0009752_88_774 220
263 3300047444 Ga0495675_0043702 Ga0495675_0043702_2135_2821 220
264 3300047471 Ga0495684_0000428 Ga0495684_0000428_33512_34198 220
265 3300047673 Ga0495593_0000529 Ga0495593_0000529_15998_16681 220
266 3300047673 Ga0495593_0159469 Ga0495593_0159469_364_1050 220
267 3300048088 Ga0495602_0000545 Ga0495602_0000545_126_812 220
268 3300048089 Ga0495614_0000105 Ga0495614_0000105_18551_19234 220
269 3300050513 nmdc:mga0rr50_473317_c1 nmdc:mga0rr50_473317_c1_293_976 220
270 3300053078 Ga0495612_0014442 Ga0495612_0014442_34_720 220
271 3300053085 Ga0495619_0001001 Ga0495619_0001001_17768_18454 220
272 3300045976 Ga0466967_0240192 Ga0466967_0240192_289_975 221
273 3300005331 Ga0070670_100028469 Ga0070670_1000284692 225
274 3300005336 Ga0070680_100277278 Ga0070680_1002772781 225
275 3300005338 Ga0068868_100245061 Ga0068868_1002450611 225
276 3300005355 Ga0070671_100118104 Ga0070671_1001181042 225
277 3300005364 Ga0070673_100724562 Ga0070673_1007245621 225
278 3300005367 Ga0070667_100244321 Ga0070667_1002443211 225
279 3300005468 Ga0070707_100680315 Ga0070707_1006803152 225
280 3300005518 Ga0070699_100551497 Ga0070699_1005514972 225
281 3300005834 Ga0068851_10042192 Ga0068851_100421922 225
282 3300009177 Ga0105248_10957239 Ga0105248_109572391 225
283 3300013308 Ga0157375_10330337 Ga0157375_103303372 225
284 3300025922 Ga0207646_10373631 Ga0207646_103736311 225
285 3300025933 Ga0207706_10153474 Ga0207706_101534742 225
286 3300026067 Ga0207678_10169197 Ga0207678_101691972 225
287 3300026089 Ga0207648_10121413 Ga0207648_101214132 225
288 3300026118 Ga0207675_100342348 Ga0207675_1003423482 225
289 3300028381 Ga0268264_10552793 Ga0268264_105527931 225
290 3300045051 Ga0451576_1152465 Ga0451576_1152465_24_704 225
291 3300005434 Ga0070709_10106970 Ga0070709_101069703 227
292 3300009093 Ga0105240_10262324 Ga0105240_102623242 227
293 3300013105 Ga0157369_10274314 Ga0157369_102743142 227
294 3300013297 Ga0157378_10135774 Ga0157378_101357742 227
295 3300031852 Ga0307410_10129057 Ga0307410_101290572 227
296 2162886012 MBSR1b_contig_2845164 MBSR1b_0962.00001570 228
297 3300005339 Ga0070660_100537084 Ga0070660_1005370841 228
298 3300005344 Ga0070661_100207203 Ga0070661_1002072032 228
299 3300005364 Ga0070673_100883676 Ga0070673_1008836761 228
300 3300005468 Ga0070707_100109272 Ga0070707_1001092723 228
301 3300005468 Ga0070707_100602255 Ga0070707_1006022552 228
302 3300005471 Ga0070698_100445535 Ga0070698_1004455351 228
303 3300005518 Ga0070699_100171931 Ga0070699_1001719312 228
304 3300025920 Ga0207649_10104149 Ga0207649_101041491 228
305 3300025922 Ga0207646_10559317 Ga0207646_105593171 228
306 3300025949 Ga0207667_10975866 Ga0207667_109758661 228
307 3300027471 Ga0209995_1004515 Ga0209995_10045152 228
308 3300027682 Ga0209971_1049857 Ga0209971_10498571 228
309 3300027695 Ga0209966_1002360 Ga0209966_10023603 228
310 3300027717 Ga0209998_10000665 Ga0209998_100006654 228
311 3300031852 Ga0307410_10092541 Ga0307410_100925411 228
312 3300031903 Ga0307407_10094023 Ga0307407_100940232 228
313 3300031995 Ga0307409_100004640 Ga0307409_1000046407 228
314 3300032002 Ga0307416_100004464 Ga0307416_1000044645 228
315 3300032002 Ga0307416_100658957 Ga0307416_1006589572 228
316 3300032004 Ga0307414_10111463 Ga0307414_101114632 228
317 3300032004 Ga0307414_10327487 Ga0307414_103274871 228
318 3300032005 Ga0307411_10033595 Ga0307411_100335952 228
319 3300049515 Ga0501292_005548 Ga0501292_005548_856_1548 228
320 3300049656 Ga0501209_008430 Ga0501209_008430_15_707 228
321 3300049661 Ga0501217_000945 Ga0501217_000945_3168_3860 228
322 3300049669 Ga0501235_000085 Ga0501235_000085_4962_5654 228
323 3300049679 Ga0501249_011667 Ga0501249_011667_302_994 228
324 3300049686 Ga0501257_004601 Ga0501257_004601_1428_2120 228
325 3300049704 Ga0501221_001287 Ga0501221_001287_1563_2255 228
326 3300049705 Ga0501225_0007043 Ga0501225_0007043_2110_2802 228
327 3300049765 Ga0501268_001323 Ga0501268_001323_1254_1946 228

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7771 28 225
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7643 28 225
6kjw-assembly1.cif.gz_A galectin-13 variant c136s 0.7455 82 225
6n3r-assembly4.cif.gz_F sheep galectin-11 (lgals11) complex with galactose 0.7297 61 224
6n44-assembly3.cif.gz_C sheep galectin-11 (lgals11) complex with glycerol 0.7221 61 224
ID Description Score Start End Superfamily
af_Q10102_66_225_3.50.70.10 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase; 0.806 166 189 3.50.70.10
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7771 28 225 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7643 28 225 2.60.120.560
af_G5EFI4_179_311_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7268 82 227 2.60.120.200
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7221 57 223 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A838QID1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.995 71 228
AF-A0A838QID1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9887 71 228
AF-A0A2V7RIS3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9674 52 228
AF-A0A2V7RIS3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9619 52 228
AF-A0A7C7X854-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9611 69 225

Feature Viewer

pLDDT pTM Quality
89.99 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map