F408676
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 168 | 327 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_101044096|Ga0070707_1010440962 |
| Length | 179 |
| Sequence | MNDTFDTFDLRVGESHIEVHKFRGGAIVAATIVALFLQTSVPVYFQKFAILDLPMLVTIYFGLSRRNPSTGLLLGMAIGLLQDSLSGPTVPLGLYGIAKTVVGYLASSIGARLDTEHPIARFALTVVFFATHQGLLVLTRRLLLAQPQVWFDWRLGIAAAVNAIIAVFLFMLLDRLRKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 42 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 43 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 61 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 62 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 87 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 92 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 93 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 94 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 95 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 96 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 99 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 103 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 106 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 115 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 116 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 1.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.14 |
| Rhizosphere | 96.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100090212 | 3300005334 | Bacteria | 2303 |
| 2 | Ga0070689_100448570 | 3300005340 | Unclassified | 1097 |
| 3 | Ga0070667_100098963 | 3300005367 | Bacteria | 2517 |
| 4 | Ga0070703_10000732 | 3300005406 | Bacteria | 11017 |
| 5 | Ga0070709_10005849 | 3300005434 | Bacteria | 6669 |
| 6 | Ga0070709_10075402 | 3300005434 | Unclassified | 2188 |
| 7 | Ga0070709_10119207 | 3300005434 | Eukaryota | 1786 |
| 8 | Ga0070709_10121357 | 3300005434 | Bacteria | 1772 |
| 9 | Ga0070709_10478909 | 3300005434 | Unclassified | 942 |
| 10 | Ga0070709_10596860 | 3300005434 | Unclassified | 850 |
| 11 | Ga0070709_11216492 | 3300005434 | Unclassified | 606 |
| 12 | Ga0070714_100118500 | 3300005435 | Unclassified | 2352 |
| 13 | Ga0070714_100219388 | 3300005435 | Unclassified | 1747 |
| 14 | Ga0070713_100003396 | 3300005436 | Bacteria | 10518 |
| 15 | Ga0070713_100056124 | 3300005436 | Bacteria | 3276 |
| 16 | Ga0070713_100123331 | 3300005436 | Unclassified | 2275 |
| 17 | Ga0070713_100482330 | 3300005436 | Unclassified | 1168 |
| 18 | Ga0070713_100900571 | 3300005436 | Unclassified | 851 |
| 19 | Ga0070710_10248109 | 3300005437 | Bacteria | 1143 |
| 20 | Ga0070710_10511251 | 3300005437 | Unclassified | 824 |
| 21 | Ga0070711_100000832 | 3300005439 | Bacteria | 16170 |
| 22 | Ga0070711_100069940 | 3300005439 | Bacteria | 2470 |
| 23 | Ga0070711_100661577 | 3300005439 | Unclassified | 877 |
| 24 | Ga0070705_100004846 | 3300005440 | Bacteria | 6546 |
| 25 | Ga0070705_100107225 | 3300005440 | Bacteria | 1777 |
| 26 | Ga0070705_100347518 | 3300005440 | Unclassified | 1080 |
| 27 | Ga0070708_100000994 | 3300005445 | Bacteria | 21636 |
| 28 | Ga0070708_100230041 | 3300005445 | Bacteria | 1739 |
| 29 | Ga0070708_100320657 | 3300005445 | Unclassified | 1460 |
| 30 | Ga0070708_100692291 | 3300005445 | Bacteria | 960 |
| 31 | Ga0070708_100893081 | 3300005445 | Bacteria | 834 |
| 32 | Ga0070681_10151777 | 3300005458 | Bacteria | 2243 |
| 33 | Ga0070706_100008975 | 3300005467 | Bacteria | 9311 |
| 34 | Ga0070706_100037812 | 3300005467 | Bacteria | 4457 |
| 35 | Ga0070706_100265318 | 3300005467 | Bacteria | 1602 |
| 36 | Ga0070707_100001608 | 3300005468 | Bacteria | 21875 |
| 37 | Ga0070707_100010867 | 3300005468 | Bacteria | 8480 |
| 38 | Ga0070707_100569388 | 3300005468 | Unclassified | 1095 |
| 39 | Ga0070707_100858635 | 3300005468 | Unclassified | 872 |
| 40 | Ga0070707_101044096 | 3300005468 | Bacteria | 783 |
| 41 | Ga0070707_101062404 | 3300005468 | Unclassified | 775 |
| 42 | Ga0070698_100002861 | 3300005471 | Bacteria | 19002 |
| 43 | Ga0070698_100014282 | 3300005471 | Bacteria | 8396 |
| 44 | Ga0070698_100048647 | 3300005471 | Bacteria | 4333 |
| 45 | Ga0070699_100007115 | 3300005518 | Bacteria | 9719 |
| 46 | Ga0070699_100024934 | 3300005518 | Bacteria | 5156 |
| 47 | Ga0070699_100047390 | 3300005518 | Bacteria | 3719 |
| 48 | Ga0070699_100365075 | 3300005518 | Unclassified | 1302 |
| 49 | Ga0070679_100038965 | 3300005530 | Bacteria | 4725 |
| 50 | Ga0070697_100000937 | 3300005536 | Bacteria | 21952 |
| 51 | Ga0070697_100002412 | 3300005536 | Bacteria | 14389 |
| 52 | Ga0070697_100362828 | 3300005536 | Unclassified | 1252 |
| 53 | Ga0068853_101761499 | 3300005539 | Unclassified | 600 |
| 54 | Ga0070686_100378512 | 3300005544 | Unclassified | 1071 |
| 55 | Ga0070695_100014446 | 3300005545 | Bacteria | 4761 |
| 56 | Ga0070695_100135833 | 3300005545 | Unclassified | 1700 |
| 57 | Ga0070695_100775698 | 3300005545 | Bacteria | 766 |
| 58 | Ga0070696_100000611 | 3300005546 | Bacteria | 22935 |
| 59 | Ga0070696_100125578 | 3300005546 | Bacteria | 1861 |
| 60 | Ga0070693_100000041 | 3300005547 | Bacteria | 49532 |
| 61 | Ga0070665_100003517 | 3300005548 | Bacteria | 16661 |
| 62 | Ga0070704_100002019 | 3300005549 | Bacteria | 11241 |
| 63 | Ga0068859_100276362 | 3300005617 | Bacteria | 1772 |
| 64 | Ga0068866_10465823 | 3300005718 | Unclassified | 829 |
| 65 | Ga0068863_100021278 | 3300005841 | Bacteria | 6191 |
| 66 | Ga0068860_100005030 | 3300005843 | Bacteria | 13453 |
| 67 | Ga0070717_10248857 | 3300006028 | Unclassified | 1569 |
| 68 | Ga0070717_10302539 | 3300006028 | Unclassified | 1422 |
| 69 | Ga0070715_10123272 | 3300006163 | Bacteria | 1238 |
| 70 | Ga0070716_100013935 | 3300006173 | Unclassified | 4110 |
| 71 | Ga0070716_100021771 | 3300006173 | Bacteria | 3381 |
| 72 | Ga0070716_100040187 | 3300006173 | Bacteria | 2601 |
| 73 | Ga0070716_100047431 | 3300006173 | Bacteria | 2423 |
| 74 | Ga0070716_100047500 | 3300006173 | Unclassified | 2422 |
| 75 | Ga0070716_100093020 | 3300006173 | Bacteria | 1829 |
| 76 | Ga0070716_100162408 | 3300006173 | Unclassified | 1449 |
| 77 | Ga0070716_100201765 | 3300006173 | Unclassified | 1323 |
| 78 | Ga0070716_100772898 | 3300006173 | Bacteria | 741 |
| 79 | Ga0070716_101039474 | 3300006173 | Unclassified | 650 |
| 80 | Ga0070712_100033489 | 3300006175 | Unclassified | 3477 |
| 81 | Ga0070712_100039499 | 3300006175 | Bacteria | 3230 |
| 82 | Ga0070712_100091768 | 3300006175 | Bacteria | 2226 |
| 83 | Ga0070712_100093735 | 3300006175 | Bacteria | 2205 |
| 84 | Ga0070712_100740086 | 3300006175 | Unclassified | 841 |
| 85 | Ga0097621_100022401 | 3300006237 | Bacteria | 4904 |
| 86 | Ga0068871_100019284 | 3300006358 | Bacteria | 5206 |
| 87 | Ga0075433_10163936 | 3300006852 | Bacteria | 1978 |
| 88 | Ga0075433_11301009 | 3300006852 | Unclassified | 630 |
| 89 | Ga0075434_100005522 | 3300006871 | Bacteria | 11513 |
| 90 | Ga0075434_100166102 | 3300006871 | Bacteria | 2227 |
| 91 | Ga0075434_100211761 | 3300006871 | Bacteria | 1958 |
| 92 | Ga0068865_100610365 | 3300006881 | Unclassified | 923 |
| 93 | Ga0075436_100005997 | 3300006914 | Bacteria | 8348 |
| 94 | Ga0075436_100017972 | 3300006914 | Bacteria | 4842 |
| 95 | Ga0075436_100124614 | 3300006914 | Unclassified | 1805 |
| 96 | Ga0075436_100292841 | 3300006914 | Unclassified | 1165 |
| 97 | Ga0075436_100406617 | 3300006914 | Bacteria | 987 |
| 98 | Ga0097620_100276359 | 3300006931 | Bacteria | 1772 |
| 99 | Ga0075435_100025783 | 3300007076 | Bacteria | 4580 |
| 100 | Ga0075435_100081129 | 3300007076 | Bacteria | 2664 |
| 101 | Ga0075435_100202347 | 3300007076 | Unclassified | 1683 |
| 102 | Ga0075435_101121130 | 3300007076 | Unclassified | 688 |
| 103 | Ga0099794_10001541 | 3300007265 | Bacteria | 8116 |
| 104 | Ga0099794_10009630 | 3300007265 | Bacteria | 4073 |
| 105 | Ga0099794_10013683 | 3300007265 | Bacteria | 3538 |
| 106 | Ga0099794_10020460 | 3300007265 | Bacteria | 2995 |
| 107 | Ga0099794_10024141 | 3300007265 | Bacteria | 2788 |
| 108 | Ga0099794_10030324 | 3300007265 | Bacteria | 2525 |
| 109 | Ga0099794_10052895 | 3300007265 | Unclassified | 1958 |
| 110 | Ga0099794_10078083 | 3300007265 | Bacteria | 1630 |
| 111 | Ga0099794_10134183 | 3300007265 | Unclassified | 1251 |
| 112 | Ga0099794_10151702 | 3300007265 | Bacteria | 1176 |
| 113 | Ga0099794_10160209 | 3300007265 | Unclassified | 1144 |
| 114 | Ga0099794_10218165 | 3300007265 | Bacteria | 979 |
| 115 | Ga0099795_10031922 | 3300007788 | Bacteria | 1818 |
| 116 | Ga0099795_10032623 | 3300007788 | Bacteria | 1802 |
| 117 | Ga0099795_10136608 | 3300007788 | Unclassified | 994 |
| 118 | Ga0105240_10017753 | 3300009093 | Bacteria | 9577 |
| 119 | Ga0105245_10249046 | 3300009098 | Bacteria | 1725 |
| 120 | Ga0105243_10192831 | 3300009148 | Bacteria | 1781 |
| 121 | Ga0105241_10753154 | 3300009174 | Unclassified | 893 |
| 122 | Ga0105242_10393699 | 3300009176 | Bacteria | 1291 |
| 123 | Ga0105237_10065949 | 3300009545 | Bacteria | 3615 |
| 124 | Ga0099796_10011665 | 3300010159 | Bacteria | 2458 |
| 125 | Ga0099796_10075518 | 3300010159 | Unclassified | 1226 |
| 126 | Ga0105239_10123559 | 3300010375 | Bacteria | 2876 |
| 127 | Ga0157370_10779072 | 3300013104 | Unclassified | 871 |
| 128 | Ga0157374_10224340 | 3300013296 | Bacteria | 1845 |
| 129 | Ga0157378_10007348 | 3300013297 | Bacteria | 9625 |
| 130 | Ga0157378_10009550 | 3300013297 | Bacteria | 8448 |
| 131 | Ga0157378_10193808 | 3300013297 | Unclassified | 1918 |
| 132 | Ga0157372_10113626 | 3300013307 | Bacteria | 3103 |
| 133 | Ga0157375_10497889 | 3300013308 | Unclassified | 1383 |
| 134 | Ga0157375_11223235 | 3300013308 | Unclassified | 881 |
| 135 | Ga0157379_10006363 | 3300014968 | Bacteria | 10168 |
| 136 | Ga0157379_11185451 | 3300014968 | Bacteria | 734 |
| 137 | Ga0157376_10000008 | 3300014969 | Bacteria | 351192 |
| 138 | Ga0157376_10000215 | 3300014969 | Bacteria | 40000 |
| 139 | Ga0213876_10010226 | 3300021384 | Bacteria | 5039 |
| 140 | Ga0224572_1005091 | 3300024225 | Unclassified | 2329 |
| 141 | Ga0228598_1000088 | 3300024227 | Bacteria | 14716 |
| 142 | Ga0228598_1003542 | 3300024227 | Bacteria | 3357 |
| 143 | Ga0207653_10000955 | 3300025885 | Bacteria | 9547 |
| 144 | Ga0207699_10095679 | 3300025906 | Unclassified | 1873 |
| 145 | Ga0207699_10120052 | 3300025906 | Eukaryota | 1699 |
| 146 | Ga0207699_10261375 | 3300025906 | Unclassified | 1196 |
| 147 | Ga0207684_10018288 | 3300025910 | Bacteria | 5998 |
| 148 | Ga0207684_10127226 | 3300025910 | Bacteria | 2186 |
| 149 | Ga0207684_10166347 | 3300025910 | Unclassified | 1900 |
| 150 | Ga0207684_10824266 | 3300025910 | Bacteria | 783 |
| 151 | Ga0207707_10122539 | 3300025912 | Bacteria | 2274 |
| 152 | Ga0207671_10237870 | 3300025914 | Unclassified | 1430 |
| 153 | Ga0207693_10020560 | 3300025915 | Bacteria | 5249 |
| 154 | Ga0207693_10043803 | 3300025915 | Bacteria | 3519 |
| 155 | Ga0207693_10095362 | 3300025915 | Bacteria | 2332 |
| 156 | Ga0207693_10259552 | 3300025915 | Unclassified | 1363 |
| 157 | Ga0207693_10265573 | 3300025915 | Unclassified | 1345 |
| 158 | Ga0207693_10333380 | 3300025915 | Bacteria | 1188 |
| 159 | Ga0207693_10366931 | 3300025915 | Unclassified | 1126 |
| 160 | Ga0207663_10022481 | 3300025916 | Unclassified | 3605 |
| 161 | Ga0207663_10047481 | 3300025916 | Bacteria | 2651 |
| 162 | Ga0207660_10361930 | 3300025917 | Unclassified | 1164 |
| 163 | Ga0207652_10049590 | 3300025921 | Bacteria | 3595 |
| 164 | Ga0207646_10000080 | 3300025922 | Bacteria | 128981 |
| 165 | Ga0207646_10005130 | 3300025922 | Bacteria | 13887 |
| 166 | Ga0207646_10554919 | 3300025922 | Bacteria | 1033 |
| 167 | Ga0207687_10245503 | 3300025927 | Bacteria | 1421 |
| 168 | Ga0207700_10002514 | 3300025928 | Bacteria | 10519 |
| 169 | Ga0207700_10008741 | 3300025928 | Bacteria | 6290 |
| 170 | Ga0207700_10010106 | 3300025928 | Bacteria | 5933 |
| 171 | Ga0207700_10232671 | 3300025928 | Unclassified | 1567 |
| 172 | Ga0207664_10303700 | 3300025929 | Unclassified | 1405 |
| 173 | Ga0207664_10390270 | 3300025929 | Bacteria | 1237 |
| 174 | Ga0207704_10565431 | 3300025938 | Unclassified | 926 |
| 175 | Ga0207665_10001225 | 3300025939 | Bacteria | 17314 |
| 176 | Ga0207665_10004114 | 3300025939 | Bacteria | 9701 |
| 177 | Ga0207665_10006098 | 3300025939 | Bacteria | 8005 |
| 178 | Ga0207665_10042636 | 3300025939 | Bacteria | 3033 |
| 179 | Ga0207665_10090631 | 3300025939 | Bacteria | 2119 |
| 180 | Ga0207665_10110553 | 3300025939 | Unclassified | 1931 |
| 181 | Ga0207665_10768936 | 3300025939 | Bacteria | 760 |
| 182 | Ga0207689_10194919 | 3300025942 | Bacteria | 1672 |
| 183 | Ga0207703_10605648 | 3300026035 | Bacteria | 1036 |
| 184 | Ga0207641_10034166 | 3300026088 | Unclassified | 4228 |
| 185 | Ga0209179_1072578 | 3300027512 | Unclassified | 755 |
| 186 | Ga0209588_1001617 | 3300027671 | Bacteria | 5925 |
| 187 | Ga0209588_1006168 | 3300027671 | Bacteria | 3470 |
| 188 | Ga0209588_1009109 | 3300027671 | Bacteria | 2959 |
| 189 | Ga0209588_1037036 | 3300027671 | Bacteria | 1570 |
| 190 | Ga0209588_1092218 | 3300027671 | Bacteria | 976 |
| 191 | Ga0209588_1101997 | 3300027671 | Unclassified | 923 |
| 192 | Ga0209588_1149307 | 3300027671 | Bacteria | 741 |
| 193 | Ga0265354_1000610 | 3300028016 | Bacteria | 6019 |
| 194 | Ga0265354_1002558 | 3300028016 | Bacteria | 2225 |
| 195 | Ga0268266_10000283 | 3300028379 | Bacteria | 83686 |
| 196 | Ga0268265_11401726 | 3300028380 | Unclassified | 701 |
| 197 | Ga0268264_10013901 | 3300028381 | Bacteria | 6617 |
| 198 | Ga0268264_10708314 | 3300028381 | Unclassified | 1000 |
| 199 | Ga0265338_10003786 | 3300028800 | Bacteria | 21029 |
| 200 | Ga0265338_10020685 | 3300028800 | Bacteria | 6906 |
| 201 | Ga0265338_10138667 | 3300028800 | Unclassified | 1908 |
| 202 | Ga0265338_10287658 | 3300028800 | Unclassified | 1199 |
| 203 | Ga0265770_1001894 | 3300030878 | Unclassified | 2856 |
| 204 | Ga0265770_1005999 | 3300030878 | Unclassified | 1682 |
| 205 | Ga0265770_1035984 | 3300030878 | Unclassified | 849 |
| 206 | Ga0265765_1003376 | 3300030879 | Unclassified | 1599 |
| 207 | Ga0265760_10009965 | 3300031090 | Unclassified | 2711 |
| 208 | Ga0265760_10014435 | 3300031090 | Unclassified | 2263 |
| 209 | Ga0265320_10161824 | 3300031240 | Unclassified | 1008 |
| 210 | Ga0265325_10001400 | 3300031241 | Bacteria | 17012 |
| 211 | Ga0265340_10124477 | 3300031247 | Bacteria | 1185 |
| 212 | Ga0265316_10421254 | 3300031344 | Unclassified | 960 |
| 213 | Ga0316212_1002642 | 3300033547 | Unclassified | 2562 |
| 214 | Ga0373926_0000883 | 3300035083 | Bacteria | 8586 |
| 215 | Ga0373934_0002484 | 3300035086 | Bacteria | 6780 |
| 216 | Ga0373923_0236619 | 3300035111 | Unclassified | 852 |
| 217 | Ga0373945_0337144 | 3300035116 | Unclassified | 652 |
| 218 | Ga0373953_0004380 | 3300035117 | Bacteria | 4497 |
| 219 | Ga0373954_0000470 | 3300035118 | Bacteria | 15116 |
| 220 | Ga0373954_0044914 | 3300035118 | Unclassified | 2063 |
| 221 | Ga0373956_0010212 | 3300035119 | Bacteria | 3840 |
| 222 | Ga0373957_0004329 | 3300035120 | Bacteria | 4309 |
| 223 | Ga0373946_0002752 | 3300035171 | Bacteria | 6217 |
| 224 | Ga0373955_0003245 | 3300035172 | Bacteria | 7124 |
| 225 | Ga0373955_0036473 | 3300035172 | Bacteria | 2609 |
| 226 | Ga0373924_0033772 | 3300035410 | Unclassified | 2068 |
| 227 | Ga0373931_0123030 | 3300035691 | Unclassified | 1485 |
| 228 | Ga0373931_0204208 | 3300035691 | Bacteria | 1182 |
| 229 | Ga0373931_0239741 | 3300035691 | Unclassified | 1099 |
| 230 | Ga0373927_0001818 | 3300035695 | Bacteria | 15845 |
| 231 | Ga0373927_0292996 | 3300035695 | Unclassified | 1071 |
| 232 | Ga0373933_0001309 | 3300035724 | Bacteria | 14651 |
| 233 | Ga0373933_0002002 | 3300035724 | Bacteria | 11756 |
| 234 | Ga0373947_0002711 | 3300035725 | Bacteria | 10632 |
| 235 | Ga0373937_0000208 | 3300036401 | Bacteria | 56666 |
| 236 | Ga0373937_0000243 | 3300036401 | Bacteria | 53380 |
| 237 | Ga0373925_0001208 | 3300037068 | Bacteria | 22782 |
| 238 | Ga0373925_0073547 | 3300037068 | Bacteria | 2587 |
| 239 | Ga0373925_0095193 | 3300037068 | Unclassified | 2281 |
| 240 | Ga0436365_0384191 | 3300039437 | Bacteria | 5953 |
| 241 | Ga0436365_1364470 | 3300039437 | Bacteria | 1889 |
| 242 | Ga0436363_1263297 | 3300039450 | Bacteria | 645 |
| 243 | Ga0451577_0178525 | 3300042876 | Bacteria | 1914 |
| 244 | Ga0453683_0005882 | 3300044673 | Bacteria | 8483 |
| 245 | Ga0453683_0055458 | 3300044673 | Bacteria | 2480 |
| 246 | Ga0453683_0569710 | 3300044673 | Unclassified | 737 |
| 247 | Ga0453684_0036921 | 3300044712 | Bacteria | 6720 |
| 248 | Ga0453684_0166110 | 3300044712 | Bacteria | 2605 |
| 249 | Ga0451576_1048466 | 3300045051 | Bacteria | 854 |
| 250 | Ga0495592_0167734 | 3300046454 | Unclassified | 1506 |
| 251 | Ga0495603_0004226 | 3300046455 | Bacteria | 8550 |
| 252 | Ga0495603_0155939 | 3300046455 | Unclassified | 1325 |
| 253 | Ga0495629_0131344 | 3300046459 | Bacteria | 1744 |
| 254 | Ga0495641_0060256 | 3300046461 | Unclassified | 1715 |
| 255 | Ga0495651_0009699 | 3300046462 | Bacteria | 7404 |
| 256 | Ga0495651_0010979 | 3300046462 | Bacteria | 6968 |
| 257 | Ga0495651_0256260 | 3300046462 | Unclassified | 1192 |
| 258 | Ga0495653_0394878 | 3300046463 | Unclassified | 880 |
| 259 | Ga0495580_0000556 | 3300046472 | Bacteria | 31567 |
| 260 | Ga0495580_0030597 | 3300046472 | Bacteria | 3897 |
| 261 | Ga0495580_0074919 | 3300046472 | Bacteria | 2362 |
| 262 | Ga0495580_0354771 | 3300046472 | Bacteria | 993 |
| 263 | Ga0495582_0001950 | 3300046473 | Bacteria | 11576 |
| 264 | Ga0495582_0196837 | 3300046473 | Unclassified | 1150 |
| 265 | Ga0495639_0019378 | 3300046475 | Bacteria | 2969 |
| 266 | Ga0495664_0076574 | 3300046477 | Bacteria | 2002 |
| 267 | Ga0495594_0005359 | 3300046499 | Bacteria | 6591 |
| 268 | Ga0495608_0028126 | 3300046511 | Bacteria | 3822 |
| 269 | Ga0495628_0059199 | 3300046516 | Bacteria | 3008 |
| 270 | Ga0495630_0004035 | 3300046517 | Bacteria | 10277 |
| 271 | Ga0495630_0114841 | 3300046517 | Bacteria | 2040 |
| 272 | Ga0495666_0026660 | 3300046526 | Bacteria | 2847 |
| 273 | Ga0495666_0302746 | 3300046526 | Unclassified | 723 |
| 274 | Ga0495652_0038733 | 3300046529 | Bacteria | 4128 |
| 275 | Ga0495665_0039751 | 3300046531 | Bacteria | 2505 |
| 276 | Ga0495640_0073589 | 3300046533 | Bacteria | 2287 |
| 277 | Ga0495586_0221878 | 3300046535 | Unclassified | 1074 |
| 278 | Ga0495587_0000180 | 3300046536 | Bacteria | 46346 |
| 279 | Ga0495587_0001230 | 3300046536 | Bacteria | 16974 |
| 280 | Ga0495645_0034607 | 3300046543 | Bacteria | 3684 |
| 281 | Ga0495667_0021248 | 3300046559 | Bacteria | 4379 |
| 282 | Ga0495667_0135339 | 3300046559 | Unclassified | 1588 |
| 283 | Ga0495634_0154842 | 3300046642 | Bacteria | 1447 |
| 284 | Ga0495657_0282414 | 3300046675 | Unclassified | 993 |
| 285 | Ga0495623_0029002 | 3300046679 | Bacteria | 3562 |
| 286 | Ga0495623_0197233 | 3300046679 | Unclassified | 1159 |
| 287 | Ga0495647_0002793 | 3300046681 | Bacteria | 5536 |
| 288 | Ga0495658_0052625 | 3300046683 | Bacteria | 2310 |
| 289 | Ga0495613_0016521 | 3300046689 | Bacteria | 5495 |
| 290 | Ga0495624_0033153 | 3300046690 | Bacteria | 3346 |
| 291 | Ga0495624_0303809 | 3300046690 | Bacteria | 962 |
| 292 | Ga0495581_0024197 | 3300047315 | Bacteria | 3519 |
| 293 | Ga0495604_0044949 | 3300047317 | Bacteria | 3448 |
| 294 | Ga0495604_0434506 | 3300047317 | Bacteria | 860 |
| 295 | Ga0495674_0038587 | 3300047319 | Bacteria | 4286 |
| 296 | Ga0495674_0095016 | 3300047319 | Bacteria | 2542 |
| 297 | Ga0495674_0142117 | 3300047319 | Bacteria | 2017 |
| 298 | Ga0495674_0543272 | 3300047319 | Bacteria | 926 |
| 299 | Ga0495676_0012015 | 3300047321 | Bacteria | 7810 |
| 300 | Ga0495675_0000240 | 3300047444 | Bacteria | 39699 |
| 301 | Ga0495684_0009402 | 3300047471 | Bacteria | 7547 |
| 302 | Ga0495593_0536157 | 3300047673 | Unclassified | 587 |
| 303 | Ga0495602_0001957 | 3300048088 | Bacteria | 20657 |
| 304 | Ga0495614_0020987 | 3300048089 | Bacteria | 2824 |
| 305 | Ga0495614_0028470 | 3300048089 | Bacteria | 2407 |
| 306 | Ga0496100_0433186 | 3300048903 | Unclassified | 1006 |
| 307 | Ga0496101_0132217 | 3300048904 | Bacteria | 1895 |
| 308 | Ga0496102_0103081 | 3300048905 | Bacteria | 2653 |
| 309 | Ga0496106_0600582 | 3300048909 | Unclassified | 881 |
| 310 | Ga0496112_0187775 | 3300048915 | Bacteria | 2030 |
| 311 | Ga0496114_0002595 | 3300048917 | Bacteria | 13796 |
| 312 | Ga0496115_0004564 | 3300048918 | Bacteria | 10022 |
| 313 | nmdc:mga0n895_385535_c1 | 3300050512 | Bacteria | 1418 |
| 314 | nmdc:mga0n895_489629_c1 | 3300050512 | Unclassified | 1240 |
| 315 | nmdc:mga0n895_96153_c1 | 3300050512 | Bacteria | 2967 |
| 316 | nmdc:mga0rr50_19931_c1 | 3300050513 | Bacteria | 4540 |
| 317 | nmdc:mga0rr50_331150_c1 | 3300050513 | Bacteria | 1278 |
| 318 | nmdc:mga0rr50_64767_c1 | 3300050513 | Bacteria | 2766 |
| 319 | nmdc:mga0rr50_979145_c1 | 3300050513 | Unclassified | 721 |
| 320 | nmdc:mga0rr50_986674_c1 | 3300050513 | Unclassified | 718 |
| 321 | nmdc:mga08x19_123668_c1 | 3300050514 | Bacteria | 1736 |
| 322 | nmdc:mga08x19_1261_c1 | 3300050514 | Bacteria | 15707 |
| 323 | nmdc:mga08x19_36762_c1 | 3300050514 | Bacteria | 3103 |
| 324 | nmdc:mga08x19_87898_c1 | 3300050514 | Bacteria | 2048 |
| 325 | nmdc:mga0a205_151315_c1 | 3300050515 | Unclassified | 2220 |
| 326 | Ga0495601_0059742 | 3300053077 | Bacteria | 2418 |
| 327 | Ga0495619_0076031 | 3300053085 | Unclassified | 2254 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0052625 | Ga0495658_0052625_35_478 | 147 |
| 2 | 3300050513 | nmdc:mga0rr50_979145_c1 | nmdc:mga0rr50_979145_c1_235_678 | 147 |
| 3 | 3300035111 | Ga0373923_0236619 | Ga0373923_0236619_387_836 | 148 |
| 4 | 3300006871 | Ga0075434_100166102 | Ga0075434_1001661022 | 158 |
| 5 | 3300050512 | nmdc:mga0n895_385535_c1 | nmdc:mga0n895_385535_c1_564_1088 | 158 |
| 6 | 3300047319 | Ga0495674_0543272 | Ga0495674_0543272_98_622 | 159 |
| 7 | 3300030878 | Ga0265770_1005999 | Ga0265770_10059992 | 165 |
| 8 | 3300031090 | Ga0265760_10014435 | Ga0265760_100144352 | 165 |
| 9 | 3300028016 | Ga0265354_1000610 | Ga0265354_10006104 | 169 |
| 10 | 3300030878 | Ga0265770_1001894 | Ga0265770_10018944 | 169 |
| 11 | 3300030879 | Ga0265765_1003376 | Ga0265765_10033762 | 169 |
| 12 | 3300031090 | Ga0265760_10009965 | Ga0265760_100099652 | 169 |
| 13 | 3300033547 | Ga0316212_1002642 | Ga0316212_10026421 | 169 |
| 14 | 3300007265 | Ga0099794_10078083 | Ga0099794_100780832 | 170 |
| 15 | 3300005434 | Ga0070709_10596860 | Ga0070709_105968602 | 172 |
| 16 | 3300005445 | Ga0070708_100692291 | Ga0070708_1006922911 | 172 |
| 17 | 3300005467 | Ga0070706_100008975 | Ga0070706_1000089755 | 172 |
| 18 | 3300005468 | Ga0070707_100001608 | Ga0070707_10000160810 | 172 |
| 19 | 3300005468 | Ga0070707_100858635 | Ga0070707_1008586351 | 172 |
| 20 | 3300005468 | Ga0070707_101062404 | Ga0070707_1010624041 | 172 |
| 21 | 3300005471 | Ga0070698_100014282 | Ga0070698_1000142824 | 172 |
| 22 | 3300006175 | Ga0070712_100740086 | Ga0070712_1007400861 | 172 |
| 23 | 3300024225 | Ga0224572_1005091 | Ga0224572_10050912 | 172 |
| 24 | 3300024227 | Ga0228598_1000088 | Ga0228598_10000887 | 172 |
| 25 | 3300025906 | Ga0207699_10261375 | Ga0207699_102613751 | 172 |
| 26 | 3300025910 | Ga0207684_10018288 | Ga0207684_100182882 | 172 |
| 27 | 3300025915 | Ga0207693_10259552 | Ga0207693_102595522 | 172 |
| 28 | 3300025922 | Ga0207646_10000080 | Ga0207646_10000080102 | 172 |
| 29 | 3300025922 | Ga0207646_10554919 | Ga0207646_105549191 | 172 |
| 30 | 3300031344 | Ga0265316_10421254 | Ga0265316_104212541 | 172 |
| 31 | 3300042876 | Ga0451577_0178525 | Ga0451577_0178525_312_839 | 172 |
| 32 | 3300044673 | Ga0453683_0005882 | Ga0453683_0005882_6017_6541 | 172 |
| 33 | 3300044673 | Ga0453683_0055458 | Ga0453683_0055458_304_831 | 172 |
| 34 | 3300044673 | Ga0453683_0569710 | Ga0453683_0569710_160_687 | 172 |
| 35 | 3300044712 | Ga0453684_0036921 | Ga0453684_0036921_459_983 | 172 |
| 36 | 3300044712 | Ga0453684_0166110 | Ga0453684_0166110_1586_2113 | 172 |
| 37 | 3300045051 | Ga0451576_1048466 | Ga0451576_1048466_66_590 | 172 |
| 38 | 3300007265 | Ga0099794_10218165 | Ga0099794_102181651 | 173 |
| 39 | 3300027671 | Ga0209588_1149307 | Ga0209588_11493071 | 173 |
| 40 | 3300005434 | Ga0070709_10119207 | Ga0070709_101192072 | 174 |
| 41 | 3300005434 | Ga0070709_10121357 | Ga0070709_101213572 | 174 |
| 42 | 3300005434 | Ga0070709_11216492 | Ga0070709_112164921 | 174 |
| 43 | 3300005435 | Ga0070714_100118500 | Ga0070714_1001185002 | 174 |
| 44 | 3300005436 | Ga0070713_100003396 | Ga0070713_1000033967 | 174 |
| 45 | 3300005436 | Ga0070713_100056124 | Ga0070713_1000561242 | 174 |
| 46 | 3300005436 | Ga0070713_100482330 | Ga0070713_1004823301 | 174 |
| 47 | 3300005437 | Ga0070710_10248109 | Ga0070710_102481092 | 174 |
| 48 | 3300005439 | Ga0070711_100069940 | Ga0070711_1000699402 | 174 |
| 49 | 3300005440 | Ga0070705_100347518 | Ga0070705_1003475182 | 174 |
| 50 | 3300005445 | Ga0070708_100230041 | Ga0070708_1002300412 | 174 |
| 51 | 3300005445 | Ga0070708_100320657 | Ga0070708_1003206572 | 174 |
| 52 | 3300005467 | Ga0070706_100265318 | Ga0070706_1002653183 | 174 |
| 53 | 3300005468 | Ga0070707_100010867 | Ga0070707_1000108673 | 174 |
| 54 | 3300005468 | Ga0070707_100569388 | Ga0070707_1005693881 | 174 |
| 55 | 3300005471 | Ga0070698_100048647 | Ga0070698_1000486474 | 174 |
| 56 | 3300005518 | Ga0070699_100024934 | Ga0070699_1000249342 | 174 |
| 57 | 3300005536 | Ga0070697_100002412 | Ga0070697_1000024126 | 174 |
| 58 | 3300005536 | Ga0070697_100362828 | Ga0070697_1003628282 | 174 |
| 59 | 3300005539 | Ga0068853_101761499 | Ga0068853_1017614991 | 174 |
| 60 | 3300005548 | Ga0070665_100003517 | Ga0070665_1000035176 | 174 |
| 61 | 3300005617 | Ga0068859_100276362 | Ga0068859_1002763622 | 174 |
| 62 | 3300005718 | Ga0068866_10465823 | Ga0068866_104658232 | 174 |
| 63 | 3300005841 | Ga0068863_100021278 | Ga0068863_1000212786 | 174 |
| 64 | 3300006028 | Ga0070717_10302539 | Ga0070717_103025391 | 174 |
| 65 | 3300006163 | Ga0070715_10123272 | Ga0070715_101232722 | 174 |
| 66 | 3300006173 | Ga0070716_100013935 | Ga0070716_1000139353 | 174 |
| 67 | 3300006173 | Ga0070716_100021771 | Ga0070716_1000217713 | 174 |
| 68 | 3300006173 | Ga0070716_100047431 | Ga0070716_1000474312 | 174 |
| 69 | 3300006173 | Ga0070716_101039474 | Ga0070716_1010394741 | 174 |
| 70 | 3300006175 | Ga0070712_100039499 | Ga0070712_1000394992 | 174 |
| 71 | 3300006175 | Ga0070712_100091768 | Ga0070712_1000917683 | 174 |
| 72 | 3300006175 | Ga0070712_100093735 | Ga0070712_1000937352 | 174 |
| 73 | 3300006237 | Ga0097621_100022401 | Ga0097621_1000224014 | 174 |
| 74 | 3300006358 | Ga0068871_100019284 | Ga0068871_1000192845 | 174 |
| 75 | 3300006852 | Ga0075433_10163936 | Ga0075433_101639362 | 174 |
| 76 | 3300006871 | Ga0075434_100005522 | Ga0075434_1000055222 | 174 |
| 77 | 3300006871 | Ga0075434_100211761 | Ga0075434_1002117612 | 174 |
| 78 | 3300006881 | Ga0068865_100610365 | Ga0068865_1006103652 | 174 |
| 79 | 3300006914 | Ga0075436_100406617 | Ga0075436_1004066172 | 174 |
| 80 | 3300006931 | Ga0097620_100276359 | Ga0097620_1002763592 | 174 |
| 81 | 3300007076 | Ga0075435_100025783 | Ga0075435_1000257834 | 174 |
| 82 | 3300007076 | Ga0075435_100081129 | Ga0075435_1000811293 | 174 |
| 83 | 3300007265 | Ga0099794_10151702 | Ga0099794_101517022 | 174 |
| 84 | 3300007788 | Ga0099795_10032623 | Ga0099795_100326232 | 174 |
| 85 | 3300009148 | Ga0105243_10192831 | Ga0105243_101928313 | 174 |
| 86 | 3300009176 | Ga0105242_10393699 | Ga0105242_103936992 | 174 |
| 87 | 3300010159 | Ga0099796_10011665 | Ga0099796_100116652 | 174 |
| 88 | 3300013296 | Ga0157374_10224340 | Ga0157374_102243403 | 174 |
| 89 | 3300013297 | Ga0157378_10009550 | Ga0157378_100095507 | 174 |
| 90 | 3300013297 | Ga0157378_10193808 | Ga0157378_101938082 | 174 |
| 91 | 3300013308 | Ga0157375_10497889 | Ga0157375_104978892 | 174 |
| 92 | 3300014968 | Ga0157379_10006363 | Ga0157379_100063632 | 174 |
| 93 | 3300014968 | Ga0157379_11185451 | Ga0157379_111854511 | 174 |
| 94 | 3300014969 | Ga0157376_10000008 | Ga0157376_10000008201 | 174 |
| 95 | 3300014969 | Ga0157376_10000215 | Ga0157376_1000021536 | 174 |
| 96 | 3300025906 | Ga0207699_10120052 | Ga0207699_101200522 | 174 |
| 97 | 3300025910 | Ga0207684_10127226 | Ga0207684_101272263 | 174 |
| 98 | 3300025910 | Ga0207684_10824266 | Ga0207684_108242662 | 174 |
| 99 | 3300025915 | Ga0207693_10020560 | Ga0207693_100205604 | 174 |
| 100 | 3300025915 | Ga0207693_10265573 | Ga0207693_102655733 | 174 |
| 101 | 3300025915 | Ga0207693_10333380 | Ga0207693_103333802 | 174 |
| 102 | 3300025916 | Ga0207663_10022481 | Ga0207663_100224812 | 174 |
| 103 | 3300025922 | Ga0207646_10005130 | Ga0207646_100051307 | 174 |
| 104 | 3300025928 | Ga0207700_10002514 | Ga0207700_100025147 | 174 |
| 105 | 3300025928 | Ga0207700_10008741 | Ga0207700_100087413 | 174 |
| 106 | 3300025929 | Ga0207664_10390270 | Ga0207664_103902702 | 174 |
| 107 | 3300025938 | Ga0207704_10565431 | Ga0207704_105654311 | 174 |
| 108 | 3300025939 | Ga0207665_10004114 | Ga0207665_100041142 | 174 |
| 109 | 3300025939 | Ga0207665_10006098 | Ga0207665_100060985 | 174 |
| 110 | 3300025939 | Ga0207665_10042636 | Ga0207665_100426362 | 174 |
| 111 | 3300025939 | Ga0207665_10090631 | Ga0207665_100906312 | 174 |
| 112 | 3300026035 | Ga0207703_10605648 | Ga0207703_106056482 | 174 |
| 113 | 3300026088 | Ga0207641_10034166 | Ga0207641_100341661 | 174 |
| 114 | 3300027671 | Ga0209588_1092218 | Ga0209588_10922182 | 174 |
| 115 | 3300028379 | Ga0268266_10000283 | Ga0268266_1000028332 | 174 |
| 116 | 3300028381 | Ga0268264_10708314 | Ga0268264_107083141 | 174 |
| 117 | 3300035116 | Ga0373945_0337144 | Ga0373945_0337144_67_591 | 174 |
| 118 | 3300035691 | Ga0373931_0123030 | Ga0373931_0123030_759_1283 | 174 |
| 119 | 3300035691 | Ga0373931_0204208 | Ga0373931_0204208_183_707 | 174 |
| 120 | 3300035691 | Ga0373931_0239741 | Ga0373931_0239741_60_584 | 174 |
| 121 | 3300037068 | Ga0373925_0095193 | Ga0373925_0095193_137_661 | 174 |
| 122 | 3300046455 | Ga0495603_0004226 | Ga0495603_0004226_2424_2948 | 174 |
| 123 | 3300046455 | Ga0495603_0155939 | Ga0495603_0155939_135_659 | 174 |
| 124 | 3300046459 | Ga0495629_0131344 | Ga0495629_0131344_137_661 | 174 |
| 125 | 3300046461 | Ga0495641_0060256 | Ga0495641_0060256_1081_1605 | 174 |
| 126 | 3300046472 | Ga0495580_0000556 | Ga0495580_0000556_24597_25121 | 174 |
| 127 | 3300046472 | Ga0495580_0074919 | Ga0495580_0074919_514_1038 | 174 |
| 128 | 3300046473 | Ga0495582_0001950 | Ga0495582_0001950_6280_6804 | 174 |
| 129 | 3300046473 | Ga0495582_0196837 | Ga0495582_0196837_393_917 | 174 |
| 130 | 3300046475 | Ga0495639_0019378 | Ga0495639_0019378_1338_1862 | 174 |
| 131 | 3300046499 | Ga0495594_0005359 | Ga0495594_0005359_3338_3862 | 174 |
| 132 | 3300046517 | Ga0495630_0114841 | Ga0495630_0114841_65_589 | 174 |
| 133 | 3300046526 | Ga0495666_0026660 | Ga0495666_0026660_1338_1862 | 174 |
| 134 | 3300046533 | Ga0495640_0073589 | Ga0495640_0073589_999_1523 | 174 |
| 135 | 3300046535 | Ga0495586_0221878 | Ga0495586_0221878_486_1010 | 174 |
| 136 | 3300046642 | Ga0495634_0154842 | Ga0495634_0154842_898_1422 | 174 |
| 137 | 3300046681 | Ga0495647_0002793 | Ga0495647_0002793_4839_5363 | 174 |
| 138 | 3300046689 | Ga0495613_0016521 | Ga0495613_0016521_382_906 | 174 |
| 139 | 3300046690 | Ga0495624_0033153 | Ga0495624_0033153_1760_2284 | 174 |
| 140 | 3300047315 | Ga0495581_0024197 | Ga0495581_0024197_1197_1721 | 174 |
| 141 | 3300047319 | Ga0495674_0038587 | Ga0495674_0038587_2534_3058 | 174 |
| 142 | 3300047321 | Ga0495676_0012015 | Ga0495676_0012015_3435_3959 | 174 |
| 143 | 3300047673 | Ga0495593_0536157 | Ga0495593_0536157_39_563 | 174 |
| 144 | 3300048089 | Ga0495614_0020987 | Ga0495614_0020987_387_911 | 174 |
| 145 | 3300048089 | Ga0495614_0028470 | Ga0495614_0028470_1227_1751 | 174 |
| 146 | 3300048903 | Ga0496100_0433186 | Ga0496100_0433186_170_694 | 174 |
| 147 | 3300048904 | Ga0496101_0132217 | Ga0496101_0132217_1127_1651 | 174 |
| 148 | 3300048917 | Ga0496114_0002595 | Ga0496114_0002595_10906_11430 | 174 |
| 149 | 3300048918 | Ga0496115_0004564 | Ga0496115_0004564_6352_6876 | 174 |
| 150 | 3300050512 | nmdc:mga0n895_489629_c1 | nmdc:mga0n895_489629_c1_645_1169 | 174 |
| 151 | 3300050512 | nmdc:mga0n895_96153_c1 | nmdc:mga0n895_96153_c1_2338_2862 | 174 |
| 152 | 3300050513 | nmdc:mga0rr50_19931_c1 | nmdc:mga0rr50_19931_c1_2217_2741 | 174 |
| 153 | 3300050513 | nmdc:mga0rr50_331150_c1 | nmdc:mga0rr50_331150_c1_15_539 | 174 |
| 154 | 3300050513 | nmdc:mga0rr50_64767_c1 | nmdc:mga0rr50_64767_c1_1636_2160 | 174 |
| 155 | 3300050514 | nmdc:mga08x19_36762_c1 | nmdc:mga08x19_36762_c1_2213_2737 | 174 |
| 156 | 3300050515 | nmdc:mga0a205_151315_c1 | nmdc:mga0a205_151315_c1_241_765 | 174 |
| 157 | 3300053085 | Ga0495619_0076031 | Ga0495619_0076031_599_1123 | 174 |
| 158 | 3300005434 | Ga0070709_10005849 | Ga0070709_100058494 | 175 |
| 159 | 3300005436 | Ga0070713_100123331 | Ga0070713_1001233311 | 175 |
| 160 | 3300006028 | Ga0070717_10248857 | Ga0070717_102488572 | 175 |
| 161 | 3300006173 | Ga0070716_100040187 | Ga0070716_1000401872 | 175 |
| 162 | 3300006173 | Ga0070716_100047500 | Ga0070716_1000475002 | 175 |
| 163 | 3300006914 | Ga0075436_100005997 | Ga0075436_1000059973 | 175 |
| 164 | 3300006914 | Ga0075436_100017972 | Ga0075436_1000179722 | 175 |
| 165 | 3300007076 | Ga0075435_100202347 | Ga0075435_1002023472 | 175 |
| 166 | 3300007265 | Ga0099794_10001541 | Ga0099794_100015411 | 175 |
| 167 | 3300007265 | Ga0099794_10013683 | Ga0099794_100136832 | 175 |
| 168 | 3300007265 | Ga0099794_10020460 | Ga0099794_100204603 | 175 |
| 169 | 3300007265 | Ga0099794_10024141 | Ga0099794_100241413 | 175 |
| 170 | 3300007265 | Ga0099794_10052895 | Ga0099794_100528952 | 175 |
| 171 | 3300007788 | Ga0099795_10031922 | Ga0099795_100319222 | 175 |
| 172 | 3300009093 | Ga0105240_10017753 | Ga0105240_100177535 | 175 |
| 173 | 3300013104 | Ga0157370_10779072 | Ga0157370_107790721 | 175 |
| 174 | 3300024227 | Ga0228598_1003542 | Ga0228598_10035422 | 175 |
| 175 | 3300025928 | Ga0207700_10232671 | Ga0207700_102326712 | 175 |
| 176 | 3300025939 | Ga0207665_10001225 | Ga0207665_1000122512 | 175 |
| 177 | 3300027671 | Ga0209588_1001617 | Ga0209588_10016175 | 175 |
| 178 | 3300027671 | Ga0209588_1006168 | Ga0209588_10061683 | 175 |
| 179 | 3300027671 | Ga0209588_1037036 | Ga0209588_10370361 | 175 |
| 180 | 3300028016 | Ga0265354_1002558 | Ga0265354_10025583 | 175 |
| 181 | 3300028800 | Ga0265338_10003786 | Ga0265338_100037864 | 175 |
| 182 | 3300028800 | Ga0265338_10020685 | Ga0265338_100206854 | 175 |
| 183 | 3300030878 | Ga0265770_1035984 | Ga0265770_10359841 | 175 |
| 184 | 3300031240 | Ga0265320_10161824 | Ga0265320_101618241 | 175 |
| 185 | 3300031241 | Ga0265325_10001400 | Ga0265325_1000140010 | 175 |
| 186 | 3300035724 | Ga0373933_0002002 | Ga0373933_0002002_195_737 | 175 |
| 187 | 3300036401 | Ga0373937_0000208 | Ga0373937_0000208_6923_7465 | 175 |
| 188 | 3300046462 | Ga0495651_0009699 | Ga0495651_0009699_4956_5498 | 175 |
| 189 | 3300046463 | Ga0495653_0394878 | Ga0495653_0394878_103_645 | 175 |
| 190 | 3300046529 | Ga0495652_0038733 | Ga0495652_0038733_3055_3597 | 175 |
| 191 | 3300046536 | Ga0495587_0000180 | Ga0495587_0000180_1190_1732 | 175 |
| 192 | 3300046559 | Ga0495667_0135339 | Ga0495667_0135339_584_1126 | 175 |
| 193 | 3300046675 | Ga0495657_0282414 | Ga0495657_0282414_320_862 | 175 |
| 194 | 3300046679 | Ga0495623_0029002 | Ga0495623_0029002_2532_3074 | 175 |
| 195 | 3300047317 | Ga0495604_0044949 | Ga0495604_0044949_797_1339 | 175 |
| 196 | 3300047444 | Ga0495675_0000240 | Ga0495675_0000240_15143_15685 | 175 |
| 197 | 3300048088 | Ga0495602_0001957 | Ga0495602_0001957_4554_5096 | 175 |
| 198 | 3300050514 | nmdc:mga08x19_1261_c1 | nmdc:mga08x19_1261_c1_3959_4489 | 175 |
| 199 | 3300050514 | nmdc:mga08x19_87898_c1 | nmdc:mga08x19_87898_c1_144_671 | 175 |
| 200 | 3300005334 | Ga0068869_100090212 | Ga0068869_1000902122 | 176 |
| 201 | 3300005340 | Ga0070689_100448570 | Ga0070689_1004485701 | 176 |
| 202 | 3300005367 | Ga0070667_100098963 | Ga0070667_1000989632 | 176 |
| 203 | 3300005406 | Ga0070703_10000732 | Ga0070703_100007328 | 176 |
| 204 | 3300005434 | Ga0070709_10075402 | Ga0070709_100754022 | 176 |
| 205 | 3300005434 | Ga0070709_10478909 | Ga0070709_104789092 | 176 |
| 206 | 3300005435 | Ga0070714_100219388 | Ga0070714_1002193882 | 176 |
| 207 | 3300005436 | Ga0070713_100900571 | Ga0070713_1009005711 | 176 |
| 208 | 3300005437 | Ga0070710_10511251 | Ga0070710_105112511 | 176 |
| 209 | 3300005439 | Ga0070711_100000832 | Ga0070711_1000008329 | 176 |
| 210 | 3300005439 | Ga0070711_100661577 | Ga0070711_1006615771 | 176 |
| 211 | 3300005440 | Ga0070705_100004846 | Ga0070705_1000048464 | 176 |
| 212 | 3300005440 | Ga0070705_100107225 | Ga0070705_1001072251 | 176 |
| 213 | 3300005445 | Ga0070708_100000994 | Ga0070708_1000009944 | 176 |
| 214 | 3300005445 | Ga0070708_100893081 | Ga0070708_1008930811 | 176 |
| 215 | 3300005458 | Ga0070681_10151777 | Ga0070681_101517773 | 176 |
| 216 | 3300005467 | Ga0070706_100037812 | Ga0070706_1000378125 | 176 |
| 217 | 3300005468 | Ga0070707_101044096 | Ga0070707_1010440962 | 176 |
| 218 | 3300005471 | Ga0070698_100002861 | Ga0070698_1000028618 | 176 |
| 219 | 3300005518 | Ga0070699_100007115 | Ga0070699_1000071153 | 176 |
| 220 | 3300005518 | Ga0070699_100047390 | Ga0070699_1000473903 | 176 |
| 221 | 3300005518 | Ga0070699_100365075 | Ga0070699_1003650752 | 176 |
| 222 | 3300005530 | Ga0070679_100038965 | Ga0070679_1000389655 | 176 |
| 223 | 3300005536 | Ga0070697_100000937 | Ga0070697_1000009378 | 176 |
| 224 | 3300005544 | Ga0070686_100378512 | Ga0070686_1003785121 | 176 |
| 225 | 3300005545 | Ga0070695_100014446 | Ga0070695_1000144462 | 176 |
| 226 | 3300005545 | Ga0070695_100135833 | Ga0070695_1001358332 | 176 |
| 227 | 3300005545 | Ga0070695_100775698 | Ga0070695_1007756981 | 176 |
| 228 | 3300005546 | Ga0070696_100000611 | Ga0070696_10000061117 | 176 |
| 229 | 3300005546 | Ga0070696_100125578 | Ga0070696_1001255782 | 176 |
| 230 | 3300005547 | Ga0070693_100000041 | Ga0070693_10000004122 | 176 |
| 231 | 3300005549 | Ga0070704_100002019 | Ga0070704_1000020193 | 176 |
| 232 | 3300005843 | Ga0068860_100005030 | Ga0068860_1000050304 | 176 |
| 233 | 3300006173 | Ga0070716_100093020 | Ga0070716_1000930202 | 176 |
| 234 | 3300006173 | Ga0070716_100162408 | Ga0070716_1001624082 | 176 |
| 235 | 3300006173 | Ga0070716_100201765 | Ga0070716_1002017652 | 176 |
| 236 | 3300006173 | Ga0070716_100772898 | Ga0070716_1007728982 | 176 |
| 237 | 3300006175 | Ga0070712_100033489 | Ga0070712_1000334893 | 176 |
| 238 | 3300006852 | Ga0075433_11301009 | Ga0075433_113010091 | 176 |
| 239 | 3300006914 | Ga0075436_100124614 | Ga0075436_1001246142 | 176 |
| 240 | 3300006914 | Ga0075436_100292841 | Ga0075436_1002928412 | 176 |
| 241 | 3300007076 | Ga0075435_101121130 | Ga0075435_1011211301 | 176 |
| 242 | 3300007265 | Ga0099794_10009630 | Ga0099794_100096302 | 176 |
| 243 | 3300007265 | Ga0099794_10030324 | Ga0099794_100303242 | 176 |
| 244 | 3300007265 | Ga0099794_10134183 | Ga0099794_101341832 | 176 |
| 245 | 3300007265 | Ga0099794_10160209 | Ga0099794_101602092 | 176 |
| 246 | 3300007788 | Ga0099795_10136608 | Ga0099795_101366082 | 176 |
| 247 | 3300009098 | Ga0105245_10249046 | Ga0105245_102490462 | 176 |
| 248 | 3300009174 | Ga0105241_10753154 | Ga0105241_107531542 | 176 |
| 249 | 3300009545 | Ga0105237_10065949 | Ga0105237_100659492 | 176 |
| 250 | 3300010159 | Ga0099796_10075518 | Ga0099796_100755182 | 176 |
| 251 | 3300010375 | Ga0105239_10123559 | Ga0105239_101235592 | 176 |
| 252 | 3300013297 | Ga0157378_10007348 | Ga0157378_100073485 | 176 |
| 253 | 3300013307 | Ga0157372_10113626 | Ga0157372_101136262 | 176 |
| 254 | 3300013308 | Ga0157375_11223235 | Ga0157375_112232352 | 176 |
| 255 | 3300021384 | Ga0213876_10010226 | Ga0213876_100102263 | 176 |
| 256 | 3300025885 | Ga0207653_10000955 | Ga0207653_100009555 | 176 |
| 257 | 3300025906 | Ga0207699_10095679 | Ga0207699_100956792 | 176 |
| 258 | 3300025910 | Ga0207684_10166347 | Ga0207684_101663472 | 176 |
| 259 | 3300025912 | Ga0207707_10122539 | Ga0207707_101225392 | 176 |
| 260 | 3300025914 | Ga0207671_10237870 | Ga0207671_102378702 | 176 |
| 261 | 3300025915 | Ga0207693_10043803 | Ga0207693_100438033 | 176 |
| 262 | 3300025915 | Ga0207693_10095362 | Ga0207693_100953622 | 176 |
| 263 | 3300025915 | Ga0207693_10366931 | Ga0207693_103669312 | 176 |
| 264 | 3300025916 | Ga0207663_10047481 | Ga0207663_100474813 | 176 |
| 265 | 3300025917 | Ga0207660_10361930 | Ga0207660_103619302 | 176 |
| 266 | 3300025921 | Ga0207652_10049590 | Ga0207652_100495902 | 176 |
| 267 | 3300025927 | Ga0207687_10245503 | Ga0207687_102455032 | 176 |
| 268 | 3300025928 | Ga0207700_10010106 | Ga0207700_100101064 | 176 |
| 269 | 3300025929 | Ga0207664_10303700 | Ga0207664_103037002 | 176 |
| 270 | 3300025939 | Ga0207665_10110553 | Ga0207665_101105532 | 176 |
| 271 | 3300025939 | Ga0207665_10768936 | Ga0207665_107689362 | 176 |
| 272 | 3300025942 | Ga0207689_10194919 | Ga0207689_101949192 | 176 |
| 273 | 3300027512 | Ga0209179_1072578 | Ga0209179_10725781 | 176 |
| 274 | 3300027671 | Ga0209588_1009109 | Ga0209588_10091092 | 176 |
| 275 | 3300027671 | Ga0209588_1101997 | Ga0209588_11019972 | 176 |
| 276 | 3300028380 | Ga0268265_11401726 | Ga0268265_114017262 | 176 |
| 277 | 3300028381 | Ga0268264_10013901 | Ga0268264_100139016 | 176 |
| 278 | 3300028800 | Ga0265338_10138667 | Ga0265338_101386672 | 176 |
| 279 | 3300028800 | Ga0265338_10287658 | Ga0265338_102876582 | 176 |
| 280 | 3300031247 | Ga0265340_10124477 | Ga0265340_101244772 | 176 |
| 281 | 3300035083 | Ga0373926_0000883 | Ga0373926_0000883_8013_8546 | 176 |
| 282 | 3300035086 | Ga0373934_0002484 | Ga0373934_0002484_161_694 | 176 |
| 283 | 3300035117 | Ga0373953_0004380 | Ga0373953_0004380_3243_3776 | 176 |
| 284 | 3300035118 | Ga0373954_0000470 | Ga0373954_0000470_13559_14092 | 176 |
| 285 | 3300035118 | Ga0373954_0044914 | Ga0373954_0044914_1004_1537 | 176 |
| 286 | 3300035119 | Ga0373956_0010212 | Ga0373956_0010212_3113_3646 | 176 |
| 287 | 3300035120 | Ga0373957_0004329 | Ga0373957_0004329_1324_1857 | 176 |
| 288 | 3300035171 | Ga0373946_0002752 | Ga0373946_0002752_4247_4780 | 176 |
| 289 | 3300035172 | Ga0373955_0003245 | Ga0373955_0003245_5936_6469 | 176 |
| 290 | 3300035172 | Ga0373955_0036473 | Ga0373955_0036473_178_711 | 176 |
| 291 | 3300035410 | Ga0373924_0033772 | Ga0373924_0033772_115_648 | 176 |
| 292 | 3300035695 | Ga0373927_0001818 | Ga0373927_0001818_1411_1944 | 176 |
| 293 | 3300035695 | Ga0373927_0292996 | Ga0373927_0292996_205_738 | 176 |
| 294 | 3300035724 | Ga0373933_0001309 | Ga0373933_0001309_3763_4296 | 176 |
| 295 | 3300035725 | Ga0373947_0002711 | Ga0373947_0002711_5680_6213 | 176 |
| 296 | 3300036401 | Ga0373937_0000243 | Ga0373937_0000243_24982_25515 | 176 |
| 297 | 3300037068 | Ga0373925_0001208 | Ga0373925_0001208_12905_13438 | 176 |
| 298 | 3300037068 | Ga0373925_0073547 | Ga0373925_0073547_546_1079 | 176 |
| 299 | 3300039437 | Ga0436365_0384191 | Ga0436365_0384191_2793_3323 | 176 |
| 300 | 3300039437 | Ga0436365_1364470 | Ga0436365_1364470_1311_1841 | 176 |
| 301 | 3300039450 | Ga0436363_1263297 | Ga0436363_1263297_91_624 | 176 |
| 302 | 3300046454 | Ga0495592_0167734 | Ga0495592_0167734_493_1026 | 176 |
| 303 | 3300046462 | Ga0495651_0010979 | Ga0495651_0010979_3002_3535 | 176 |
| 304 | 3300046462 | Ga0495651_0256260 | Ga0495651_0256260_385_918 | 176 |
| 305 | 3300046472 | Ga0495580_0030597 | Ga0495580_0030597_800_1333 | 176 |
| 306 | 3300046472 | Ga0495580_0354771 | Ga0495580_0354771_94_627 | 176 |
| 307 | 3300046477 | Ga0495664_0076574 | Ga0495664_0076574_1260_1790 | 176 |
| 308 | 3300046511 | Ga0495608_0028126 | Ga0495608_0028126_807_1340 | 176 |
| 309 | 3300046516 | Ga0495628_0059199 | Ga0495628_0059199_2140_2673 | 176 |
| 310 | 3300046517 | Ga0495630_0004035 | Ga0495630_0004035_1885_2418 | 176 |
| 311 | 3300046526 | Ga0495666_0302746 | Ga0495666_0302746_88_621 | 176 |
| 312 | 3300046531 | Ga0495665_0039751 | Ga0495665_0039751_1861_2394 | 176 |
| 313 | 3300046536 | Ga0495587_0001230 | Ga0495587_0001230_5795_6328 | 176 |
| 314 | 3300046543 | Ga0495645_0034607 | Ga0495645_0034607_102_632 | 176 |
| 315 | 3300046559 | Ga0495667_0021248 | Ga0495667_0021248_200_733 | 176 |
| 316 | 3300046679 | Ga0495623_0197233 | Ga0495623_0197233_187_720 | 176 |
| 317 | 3300046690 | Ga0495624_0303809 | Ga0495624_0303809_139_672 | 176 |
| 318 | 3300047317 | Ga0495604_0434506 | Ga0495604_0434506_201_734 | 176 |
| 319 | 3300047319 | Ga0495674_0095016 | Ga0495674_0095016_1093_1626 | 176 |
| 320 | 3300047319 | Ga0495674_0142117 | Ga0495674_0142117_1261_1791 | 176 |
| 321 | 3300047471 | Ga0495684_0009402 | Ga0495684_0009402_3476_4009 | 176 |
| 322 | 3300048905 | Ga0496102_0103081 | Ga0496102_0103081_1978_2508 | 176 |
| 323 | 3300048909 | Ga0496106_0600582 | Ga0496106_0600582_94_624 | 176 |
| 324 | 3300048915 | Ga0496112_0187775 | Ga0496112_0187775_973_1503 | 176 |
| 325 | 3300050513 | nmdc:mga0rr50_986674_c1 | nmdc:mga0rr50_986674_c1_113_643 | 176 |
| 326 | 3300050514 | nmdc:mga08x19_123668_c1 | nmdc:mga08x19_123668_c1_605_1138 | 176 |
| 327 | 3300053077 | Ga0495601_0059742 | Ga0495601_0059742_366_896 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z7f-assembly1.cif.gz_B | crystal structure of folt bound with folic acid | 0.6485 | 22 | 166 |
| 6zg3-assembly2.cif.gz_C | the structure of ecf pant transporter in a complex with a nanobody | 0.6454 | 25 | 172 |
| 7nnt-assembly1.cif.gz_C | cryo-em structure of the folate-specific ecf transporter complex in ddm micelles | 0.609 | 18 | 173 |
| 4z7f-assembly1.cif.gz_B | crystal structure of folt bound with folic acid | 0.5753 | 22 | 166 |
| 7nnt-assembly1.cif.gz_C | cryo-em structure of the folate-specific ecf transporter complex in ddm micelles | 0.5689 | 18 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABH4_4_155_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7944 | 22 | 172 | 1.10.1760.20 |
| af_P0ABH4_4_155_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7567 | 22 | 172 | 1.10.1760.20 |
| af_Q2G061_16_177_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6936 | 23 | 173 | 1.10.1760.20 |
| af_Q2FXS7_1_165_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6573 | 23 | 172 | 1.10.1760.20 |
| 4z7fB00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6485 | 22 | 166 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A372IPK5-F1-model_v4 | Rod shape-determining protein MreD | 0.9684 | 18 | 176 |
GO:0005886
GO:0008360 |
| AF-A0A2V9S3V1-F1-model_v4 | Rod shape-determining protein MreD | 0.9635 | 20 | 173 |
GO:0005886
GO:0008360 |
| AF-A0A2V7X5A2-F1-model_v4 | Rod shape-determining protein MreD | 0.9619 | 44 | 172 |
GO:0005886
GO:0008360 |
| AF-A0A2V9RL04-F1-model_v4 | Rod shape-determining protein MreD | 0.942 | 23 | 173 |
GO:0005886
GO:0008360 |
| AF-A0A2V9S3V1-F1-model_v4 | Rod shape-determining protein MreD | 0.9333 | 20 | 173 |
GO:0005886
GO:0008360 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar