F408676

General Info

Members Datasets Scaffolds Average Seq Length
327 168 327 175

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101044096|Ga0070707_1010440962
Length 179
Sequence MNDTFDTFDLRVGESHIEVHKFRGGAIVAATIVALFLQTSVPVYFQKFAILDLPMLVTIYFGLSRRNPSTGLLLGMAIGLLQDSLSGPTVPLGLYGIAKTVVGYLASSIGARLDTEHPIARFALTVVFFATHQGLLVLTRRLLLAQPQVWFDWRLGIAAAVNAIIAVFLFMLLDRLRKS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 1.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100090212 3300005334 Bacteria 2303
2 Ga0070689_100448570 3300005340 Unclassified 1097
3 Ga0070667_100098963 3300005367 Bacteria 2517
4 Ga0070703_10000732 3300005406 Bacteria 11017
5 Ga0070709_10005849 3300005434 Bacteria 6669
6 Ga0070709_10075402 3300005434 Unclassified 2188
7 Ga0070709_10119207 3300005434 Eukaryota 1786
8 Ga0070709_10121357 3300005434 Bacteria 1772
9 Ga0070709_10478909 3300005434 Unclassified 942
10 Ga0070709_10596860 3300005434 Unclassified 850
11 Ga0070709_11216492 3300005434 Unclassified 606
12 Ga0070714_100118500 3300005435 Unclassified 2352
13 Ga0070714_100219388 3300005435 Unclassified 1747
14 Ga0070713_100003396 3300005436 Bacteria 10518
15 Ga0070713_100056124 3300005436 Bacteria 3276
16 Ga0070713_100123331 3300005436 Unclassified 2275
17 Ga0070713_100482330 3300005436 Unclassified 1168
18 Ga0070713_100900571 3300005436 Unclassified 851
19 Ga0070710_10248109 3300005437 Bacteria 1143
20 Ga0070710_10511251 3300005437 Unclassified 824
21 Ga0070711_100000832 3300005439 Bacteria 16170
22 Ga0070711_100069940 3300005439 Bacteria 2470
23 Ga0070711_100661577 3300005439 Unclassified 877
24 Ga0070705_100004846 3300005440 Bacteria 6546
25 Ga0070705_100107225 3300005440 Bacteria 1777
26 Ga0070705_100347518 3300005440 Unclassified 1080
27 Ga0070708_100000994 3300005445 Bacteria 21636
28 Ga0070708_100230041 3300005445 Bacteria 1739
29 Ga0070708_100320657 3300005445 Unclassified 1460
30 Ga0070708_100692291 3300005445 Bacteria 960
31 Ga0070708_100893081 3300005445 Bacteria 834
32 Ga0070681_10151777 3300005458 Bacteria 2243
33 Ga0070706_100008975 3300005467 Bacteria 9311
34 Ga0070706_100037812 3300005467 Bacteria 4457
35 Ga0070706_100265318 3300005467 Bacteria 1602
36 Ga0070707_100001608 3300005468 Bacteria 21875
37 Ga0070707_100010867 3300005468 Bacteria 8480
38 Ga0070707_100569388 3300005468 Unclassified 1095
39 Ga0070707_100858635 3300005468 Unclassified 872
40 Ga0070707_101044096 3300005468 Bacteria 783
41 Ga0070707_101062404 3300005468 Unclassified 775
42 Ga0070698_100002861 3300005471 Bacteria 19002
43 Ga0070698_100014282 3300005471 Bacteria 8396
44 Ga0070698_100048647 3300005471 Bacteria 4333
45 Ga0070699_100007115 3300005518 Bacteria 9719
46 Ga0070699_100024934 3300005518 Bacteria 5156
47 Ga0070699_100047390 3300005518 Bacteria 3719
48 Ga0070699_100365075 3300005518 Unclassified 1302
49 Ga0070679_100038965 3300005530 Bacteria 4725
50 Ga0070697_100000937 3300005536 Bacteria 21952
51 Ga0070697_100002412 3300005536 Bacteria 14389
52 Ga0070697_100362828 3300005536 Unclassified 1252
53 Ga0068853_101761499 3300005539 Unclassified 600
54 Ga0070686_100378512 3300005544 Unclassified 1071
55 Ga0070695_100014446 3300005545 Bacteria 4761
56 Ga0070695_100135833 3300005545 Unclassified 1700
57 Ga0070695_100775698 3300005545 Bacteria 766
58 Ga0070696_100000611 3300005546 Bacteria 22935
59 Ga0070696_100125578 3300005546 Bacteria 1861
60 Ga0070693_100000041 3300005547 Bacteria 49532
61 Ga0070665_100003517 3300005548 Bacteria 16661
62 Ga0070704_100002019 3300005549 Bacteria 11241
63 Ga0068859_100276362 3300005617 Bacteria 1772
64 Ga0068866_10465823 3300005718 Unclassified 829
65 Ga0068863_100021278 3300005841 Bacteria 6191
66 Ga0068860_100005030 3300005843 Bacteria 13453
67 Ga0070717_10248857 3300006028 Unclassified 1569
68 Ga0070717_10302539 3300006028 Unclassified 1422
69 Ga0070715_10123272 3300006163 Bacteria 1238
70 Ga0070716_100013935 3300006173 Unclassified 4110
71 Ga0070716_100021771 3300006173 Bacteria 3381
72 Ga0070716_100040187 3300006173 Bacteria 2601
73 Ga0070716_100047431 3300006173 Bacteria 2423
74 Ga0070716_100047500 3300006173 Unclassified 2422
75 Ga0070716_100093020 3300006173 Bacteria 1829
76 Ga0070716_100162408 3300006173 Unclassified 1449
77 Ga0070716_100201765 3300006173 Unclassified 1323
78 Ga0070716_100772898 3300006173 Bacteria 741
79 Ga0070716_101039474 3300006173 Unclassified 650
80 Ga0070712_100033489 3300006175 Unclassified 3477
81 Ga0070712_100039499 3300006175 Bacteria 3230
82 Ga0070712_100091768 3300006175 Bacteria 2226
83 Ga0070712_100093735 3300006175 Bacteria 2205
84 Ga0070712_100740086 3300006175 Unclassified 841
85 Ga0097621_100022401 3300006237 Bacteria 4904
86 Ga0068871_100019284 3300006358 Bacteria 5206
87 Ga0075433_10163936 3300006852 Bacteria 1978
88 Ga0075433_11301009 3300006852 Unclassified 630
89 Ga0075434_100005522 3300006871 Bacteria 11513
90 Ga0075434_100166102 3300006871 Bacteria 2227
91 Ga0075434_100211761 3300006871 Bacteria 1958
92 Ga0068865_100610365 3300006881 Unclassified 923
93 Ga0075436_100005997 3300006914 Bacteria 8348
94 Ga0075436_100017972 3300006914 Bacteria 4842
95 Ga0075436_100124614 3300006914 Unclassified 1805
96 Ga0075436_100292841 3300006914 Unclassified 1165
97 Ga0075436_100406617 3300006914 Bacteria 987
98 Ga0097620_100276359 3300006931 Bacteria 1772
99 Ga0075435_100025783 3300007076 Bacteria 4580
100 Ga0075435_100081129 3300007076 Bacteria 2664
101 Ga0075435_100202347 3300007076 Unclassified 1683
102 Ga0075435_101121130 3300007076 Unclassified 688
103 Ga0099794_10001541 3300007265 Bacteria 8116
104 Ga0099794_10009630 3300007265 Bacteria 4073
105 Ga0099794_10013683 3300007265 Bacteria 3538
106 Ga0099794_10020460 3300007265 Bacteria 2995
107 Ga0099794_10024141 3300007265 Bacteria 2788
108 Ga0099794_10030324 3300007265 Bacteria 2525
109 Ga0099794_10052895 3300007265 Unclassified 1958
110 Ga0099794_10078083 3300007265 Bacteria 1630
111 Ga0099794_10134183 3300007265 Unclassified 1251
112 Ga0099794_10151702 3300007265 Bacteria 1176
113 Ga0099794_10160209 3300007265 Unclassified 1144
114 Ga0099794_10218165 3300007265 Bacteria 979
115 Ga0099795_10031922 3300007788 Bacteria 1818
116 Ga0099795_10032623 3300007788 Bacteria 1802
117 Ga0099795_10136608 3300007788 Unclassified 994
118 Ga0105240_10017753 3300009093 Bacteria 9577
119 Ga0105245_10249046 3300009098 Bacteria 1725
120 Ga0105243_10192831 3300009148 Bacteria 1781
121 Ga0105241_10753154 3300009174 Unclassified 893
122 Ga0105242_10393699 3300009176 Bacteria 1291
123 Ga0105237_10065949 3300009545 Bacteria 3615
124 Ga0099796_10011665 3300010159 Bacteria 2458
125 Ga0099796_10075518 3300010159 Unclassified 1226
126 Ga0105239_10123559 3300010375 Bacteria 2876
127 Ga0157370_10779072 3300013104 Unclassified 871
128 Ga0157374_10224340 3300013296 Bacteria 1845
129 Ga0157378_10007348 3300013297 Bacteria 9625
130 Ga0157378_10009550 3300013297 Bacteria 8448
131 Ga0157378_10193808 3300013297 Unclassified 1918
132 Ga0157372_10113626 3300013307 Bacteria 3103
133 Ga0157375_10497889 3300013308 Unclassified 1383
134 Ga0157375_11223235 3300013308 Unclassified 881
135 Ga0157379_10006363 3300014968 Bacteria 10168
136 Ga0157379_11185451 3300014968 Bacteria 734
137 Ga0157376_10000008 3300014969 Bacteria 351192
138 Ga0157376_10000215 3300014969 Bacteria 40000
139 Ga0213876_10010226 3300021384 Bacteria 5039
140 Ga0224572_1005091 3300024225 Unclassified 2329
141 Ga0228598_1000088 3300024227 Bacteria 14716
142 Ga0228598_1003542 3300024227 Bacteria 3357
143 Ga0207653_10000955 3300025885 Bacteria 9547
144 Ga0207699_10095679 3300025906 Unclassified 1873
145 Ga0207699_10120052 3300025906 Eukaryota 1699
146 Ga0207699_10261375 3300025906 Unclassified 1196
147 Ga0207684_10018288 3300025910 Bacteria 5998
148 Ga0207684_10127226 3300025910 Bacteria 2186
149 Ga0207684_10166347 3300025910 Unclassified 1900
150 Ga0207684_10824266 3300025910 Bacteria 783
151 Ga0207707_10122539 3300025912 Bacteria 2274
152 Ga0207671_10237870 3300025914 Unclassified 1430
153 Ga0207693_10020560 3300025915 Bacteria 5249
154 Ga0207693_10043803 3300025915 Bacteria 3519
155 Ga0207693_10095362 3300025915 Bacteria 2332
156 Ga0207693_10259552 3300025915 Unclassified 1363
157 Ga0207693_10265573 3300025915 Unclassified 1345
158 Ga0207693_10333380 3300025915 Bacteria 1188
159 Ga0207693_10366931 3300025915 Unclassified 1126
160 Ga0207663_10022481 3300025916 Unclassified 3605
161 Ga0207663_10047481 3300025916 Bacteria 2651
162 Ga0207660_10361930 3300025917 Unclassified 1164
163 Ga0207652_10049590 3300025921 Bacteria 3595
164 Ga0207646_10000080 3300025922 Bacteria 128981
165 Ga0207646_10005130 3300025922 Bacteria 13887
166 Ga0207646_10554919 3300025922 Bacteria 1033
167 Ga0207687_10245503 3300025927 Bacteria 1421
168 Ga0207700_10002514 3300025928 Bacteria 10519
169 Ga0207700_10008741 3300025928 Bacteria 6290
170 Ga0207700_10010106 3300025928 Bacteria 5933
171 Ga0207700_10232671 3300025928 Unclassified 1567
172 Ga0207664_10303700 3300025929 Unclassified 1405
173 Ga0207664_10390270 3300025929 Bacteria 1237
174 Ga0207704_10565431 3300025938 Unclassified 926
175 Ga0207665_10001225 3300025939 Bacteria 17314
176 Ga0207665_10004114 3300025939 Bacteria 9701
177 Ga0207665_10006098 3300025939 Bacteria 8005
178 Ga0207665_10042636 3300025939 Bacteria 3033
179 Ga0207665_10090631 3300025939 Bacteria 2119
180 Ga0207665_10110553 3300025939 Unclassified 1931
181 Ga0207665_10768936 3300025939 Bacteria 760
182 Ga0207689_10194919 3300025942 Bacteria 1672
183 Ga0207703_10605648 3300026035 Bacteria 1036
184 Ga0207641_10034166 3300026088 Unclassified 4228
185 Ga0209179_1072578 3300027512 Unclassified 755
186 Ga0209588_1001617 3300027671 Bacteria 5925
187 Ga0209588_1006168 3300027671 Bacteria 3470
188 Ga0209588_1009109 3300027671 Bacteria 2959
189 Ga0209588_1037036 3300027671 Bacteria 1570
190 Ga0209588_1092218 3300027671 Bacteria 976
191 Ga0209588_1101997 3300027671 Unclassified 923
192 Ga0209588_1149307 3300027671 Bacteria 741
193 Ga0265354_1000610 3300028016 Bacteria 6019
194 Ga0265354_1002558 3300028016 Bacteria 2225
195 Ga0268266_10000283 3300028379 Bacteria 83686
196 Ga0268265_11401726 3300028380 Unclassified 701
197 Ga0268264_10013901 3300028381 Bacteria 6617
198 Ga0268264_10708314 3300028381 Unclassified 1000
199 Ga0265338_10003786 3300028800 Bacteria 21029
200 Ga0265338_10020685 3300028800 Bacteria 6906
201 Ga0265338_10138667 3300028800 Unclassified 1908
202 Ga0265338_10287658 3300028800 Unclassified 1199
203 Ga0265770_1001894 3300030878 Unclassified 2856
204 Ga0265770_1005999 3300030878 Unclassified 1682
205 Ga0265770_1035984 3300030878 Unclassified 849
206 Ga0265765_1003376 3300030879 Unclassified 1599
207 Ga0265760_10009965 3300031090 Unclassified 2711
208 Ga0265760_10014435 3300031090 Unclassified 2263
209 Ga0265320_10161824 3300031240 Unclassified 1008
210 Ga0265325_10001400 3300031241 Bacteria 17012
211 Ga0265340_10124477 3300031247 Bacteria 1185
212 Ga0265316_10421254 3300031344 Unclassified 960
213 Ga0316212_1002642 3300033547 Unclassified 2562
214 Ga0373926_0000883 3300035083 Bacteria 8586
215 Ga0373934_0002484 3300035086 Bacteria 6780
216 Ga0373923_0236619 3300035111 Unclassified 852
217 Ga0373945_0337144 3300035116 Unclassified 652
218 Ga0373953_0004380 3300035117 Bacteria 4497
219 Ga0373954_0000470 3300035118 Bacteria 15116
220 Ga0373954_0044914 3300035118 Unclassified 2063
221 Ga0373956_0010212 3300035119 Bacteria 3840
222 Ga0373957_0004329 3300035120 Bacteria 4309
223 Ga0373946_0002752 3300035171 Bacteria 6217
224 Ga0373955_0003245 3300035172 Bacteria 7124
225 Ga0373955_0036473 3300035172 Bacteria 2609
226 Ga0373924_0033772 3300035410 Unclassified 2068
227 Ga0373931_0123030 3300035691 Unclassified 1485
228 Ga0373931_0204208 3300035691 Bacteria 1182
229 Ga0373931_0239741 3300035691 Unclassified 1099
230 Ga0373927_0001818 3300035695 Bacteria 15845
231 Ga0373927_0292996 3300035695 Unclassified 1071
232 Ga0373933_0001309 3300035724 Bacteria 14651
233 Ga0373933_0002002 3300035724 Bacteria 11756
234 Ga0373947_0002711 3300035725 Bacteria 10632
235 Ga0373937_0000208 3300036401 Bacteria 56666
236 Ga0373937_0000243 3300036401 Bacteria 53380
237 Ga0373925_0001208 3300037068 Bacteria 22782
238 Ga0373925_0073547 3300037068 Bacteria 2587
239 Ga0373925_0095193 3300037068 Unclassified 2281
240 Ga0436365_0384191 3300039437 Bacteria 5953
241 Ga0436365_1364470 3300039437 Bacteria 1889
242 Ga0436363_1263297 3300039450 Bacteria 645
243 Ga0451577_0178525 3300042876 Bacteria 1914
244 Ga0453683_0005882 3300044673 Bacteria 8483
245 Ga0453683_0055458 3300044673 Bacteria 2480
246 Ga0453683_0569710 3300044673 Unclassified 737
247 Ga0453684_0036921 3300044712 Bacteria 6720
248 Ga0453684_0166110 3300044712 Bacteria 2605
249 Ga0451576_1048466 3300045051 Bacteria 854
250 Ga0495592_0167734 3300046454 Unclassified 1506
251 Ga0495603_0004226 3300046455 Bacteria 8550
252 Ga0495603_0155939 3300046455 Unclassified 1325
253 Ga0495629_0131344 3300046459 Bacteria 1744
254 Ga0495641_0060256 3300046461 Unclassified 1715
255 Ga0495651_0009699 3300046462 Bacteria 7404
256 Ga0495651_0010979 3300046462 Bacteria 6968
257 Ga0495651_0256260 3300046462 Unclassified 1192
258 Ga0495653_0394878 3300046463 Unclassified 880
259 Ga0495580_0000556 3300046472 Bacteria 31567
260 Ga0495580_0030597 3300046472 Bacteria 3897
261 Ga0495580_0074919 3300046472 Bacteria 2362
262 Ga0495580_0354771 3300046472 Bacteria 993
263 Ga0495582_0001950 3300046473 Bacteria 11576
264 Ga0495582_0196837 3300046473 Unclassified 1150
265 Ga0495639_0019378 3300046475 Bacteria 2969
266 Ga0495664_0076574 3300046477 Bacteria 2002
267 Ga0495594_0005359 3300046499 Bacteria 6591
268 Ga0495608_0028126 3300046511 Bacteria 3822
269 Ga0495628_0059199 3300046516 Bacteria 3008
270 Ga0495630_0004035 3300046517 Bacteria 10277
271 Ga0495630_0114841 3300046517 Bacteria 2040
272 Ga0495666_0026660 3300046526 Bacteria 2847
273 Ga0495666_0302746 3300046526 Unclassified 723
274 Ga0495652_0038733 3300046529 Bacteria 4128
275 Ga0495665_0039751 3300046531 Bacteria 2505
276 Ga0495640_0073589 3300046533 Bacteria 2287
277 Ga0495586_0221878 3300046535 Unclassified 1074
278 Ga0495587_0000180 3300046536 Bacteria 46346
279 Ga0495587_0001230 3300046536 Bacteria 16974
280 Ga0495645_0034607 3300046543 Bacteria 3684
281 Ga0495667_0021248 3300046559 Bacteria 4379
282 Ga0495667_0135339 3300046559 Unclassified 1588
283 Ga0495634_0154842 3300046642 Bacteria 1447
284 Ga0495657_0282414 3300046675 Unclassified 993
285 Ga0495623_0029002 3300046679 Bacteria 3562
286 Ga0495623_0197233 3300046679 Unclassified 1159
287 Ga0495647_0002793 3300046681 Bacteria 5536
288 Ga0495658_0052625 3300046683 Bacteria 2310
289 Ga0495613_0016521 3300046689 Bacteria 5495
290 Ga0495624_0033153 3300046690 Bacteria 3346
291 Ga0495624_0303809 3300046690 Bacteria 962
292 Ga0495581_0024197 3300047315 Bacteria 3519
293 Ga0495604_0044949 3300047317 Bacteria 3448
294 Ga0495604_0434506 3300047317 Bacteria 860
295 Ga0495674_0038587 3300047319 Bacteria 4286
296 Ga0495674_0095016 3300047319 Bacteria 2542
297 Ga0495674_0142117 3300047319 Bacteria 2017
298 Ga0495674_0543272 3300047319 Bacteria 926
299 Ga0495676_0012015 3300047321 Bacteria 7810
300 Ga0495675_0000240 3300047444 Bacteria 39699
301 Ga0495684_0009402 3300047471 Bacteria 7547
302 Ga0495593_0536157 3300047673 Unclassified 587
303 Ga0495602_0001957 3300048088 Bacteria 20657
304 Ga0495614_0020987 3300048089 Bacteria 2824
305 Ga0495614_0028470 3300048089 Bacteria 2407
306 Ga0496100_0433186 3300048903 Unclassified 1006
307 Ga0496101_0132217 3300048904 Bacteria 1895
308 Ga0496102_0103081 3300048905 Bacteria 2653
309 Ga0496106_0600582 3300048909 Unclassified 881
310 Ga0496112_0187775 3300048915 Bacteria 2030
311 Ga0496114_0002595 3300048917 Bacteria 13796
312 Ga0496115_0004564 3300048918 Bacteria 10022
313 nmdc:mga0n895_385535_c1 3300050512 Bacteria 1418
314 nmdc:mga0n895_489629_c1 3300050512 Unclassified 1240
315 nmdc:mga0n895_96153_c1 3300050512 Bacteria 2967
316 nmdc:mga0rr50_19931_c1 3300050513 Bacteria 4540
317 nmdc:mga0rr50_331150_c1 3300050513 Bacteria 1278
318 nmdc:mga0rr50_64767_c1 3300050513 Bacteria 2766
319 nmdc:mga0rr50_979145_c1 3300050513 Unclassified 721
320 nmdc:mga0rr50_986674_c1 3300050513 Unclassified 718
321 nmdc:mga08x19_123668_c1 3300050514 Bacteria 1736
322 nmdc:mga08x19_1261_c1 3300050514 Bacteria 15707
323 nmdc:mga08x19_36762_c1 3300050514 Bacteria 3103
324 nmdc:mga08x19_87898_c1 3300050514 Bacteria 2048
325 nmdc:mga0a205_151315_c1 3300050515 Unclassified 2220
326 Ga0495601_0059742 3300053077 Bacteria 2418
327 Ga0495619_0076031 3300053085 Unclassified 2254

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0052625 Ga0495658_0052625_35_478 147
2 3300050513 nmdc:mga0rr50_979145_c1 nmdc:mga0rr50_979145_c1_235_678 147
3 3300035111 Ga0373923_0236619 Ga0373923_0236619_387_836 148
4 3300006871 Ga0075434_100166102 Ga0075434_1001661022 158
5 3300050512 nmdc:mga0n895_385535_c1 nmdc:mga0n895_385535_c1_564_1088 158
6 3300047319 Ga0495674_0543272 Ga0495674_0543272_98_622 159
7 3300030878 Ga0265770_1005999 Ga0265770_10059992 165
8 3300031090 Ga0265760_10014435 Ga0265760_100144352 165
9 3300028016 Ga0265354_1000610 Ga0265354_10006104 169
10 3300030878 Ga0265770_1001894 Ga0265770_10018944 169
11 3300030879 Ga0265765_1003376 Ga0265765_10033762 169
12 3300031090 Ga0265760_10009965 Ga0265760_100099652 169
13 3300033547 Ga0316212_1002642 Ga0316212_10026421 169
14 3300007265 Ga0099794_10078083 Ga0099794_100780832 170
15 3300005434 Ga0070709_10596860 Ga0070709_105968602 172
16 3300005445 Ga0070708_100692291 Ga0070708_1006922911 172
17 3300005467 Ga0070706_100008975 Ga0070706_1000089755 172
18 3300005468 Ga0070707_100001608 Ga0070707_10000160810 172
19 3300005468 Ga0070707_100858635 Ga0070707_1008586351 172
20 3300005468 Ga0070707_101062404 Ga0070707_1010624041 172
21 3300005471 Ga0070698_100014282 Ga0070698_1000142824 172
22 3300006175 Ga0070712_100740086 Ga0070712_1007400861 172
23 3300024225 Ga0224572_1005091 Ga0224572_10050912 172
24 3300024227 Ga0228598_1000088 Ga0228598_10000887 172
25 3300025906 Ga0207699_10261375 Ga0207699_102613751 172
26 3300025910 Ga0207684_10018288 Ga0207684_100182882 172
27 3300025915 Ga0207693_10259552 Ga0207693_102595522 172
28 3300025922 Ga0207646_10000080 Ga0207646_10000080102 172
29 3300025922 Ga0207646_10554919 Ga0207646_105549191 172
30 3300031344 Ga0265316_10421254 Ga0265316_104212541 172
31 3300042876 Ga0451577_0178525 Ga0451577_0178525_312_839 172
32 3300044673 Ga0453683_0005882 Ga0453683_0005882_6017_6541 172
33 3300044673 Ga0453683_0055458 Ga0453683_0055458_304_831 172
34 3300044673 Ga0453683_0569710 Ga0453683_0569710_160_687 172
35 3300044712 Ga0453684_0036921 Ga0453684_0036921_459_983 172
36 3300044712 Ga0453684_0166110 Ga0453684_0166110_1586_2113 172
37 3300045051 Ga0451576_1048466 Ga0451576_1048466_66_590 172
38 3300007265 Ga0099794_10218165 Ga0099794_102181651 173
39 3300027671 Ga0209588_1149307 Ga0209588_11493071 173
40 3300005434 Ga0070709_10119207 Ga0070709_101192072 174
41 3300005434 Ga0070709_10121357 Ga0070709_101213572 174
42 3300005434 Ga0070709_11216492 Ga0070709_112164921 174
43 3300005435 Ga0070714_100118500 Ga0070714_1001185002 174
44 3300005436 Ga0070713_100003396 Ga0070713_1000033967 174
45 3300005436 Ga0070713_100056124 Ga0070713_1000561242 174
46 3300005436 Ga0070713_100482330 Ga0070713_1004823301 174
47 3300005437 Ga0070710_10248109 Ga0070710_102481092 174
48 3300005439 Ga0070711_100069940 Ga0070711_1000699402 174
49 3300005440 Ga0070705_100347518 Ga0070705_1003475182 174
50 3300005445 Ga0070708_100230041 Ga0070708_1002300412 174
51 3300005445 Ga0070708_100320657 Ga0070708_1003206572 174
52 3300005467 Ga0070706_100265318 Ga0070706_1002653183 174
53 3300005468 Ga0070707_100010867 Ga0070707_1000108673 174
54 3300005468 Ga0070707_100569388 Ga0070707_1005693881 174
55 3300005471 Ga0070698_100048647 Ga0070698_1000486474 174
56 3300005518 Ga0070699_100024934 Ga0070699_1000249342 174
57 3300005536 Ga0070697_100002412 Ga0070697_1000024126 174
58 3300005536 Ga0070697_100362828 Ga0070697_1003628282 174
59 3300005539 Ga0068853_101761499 Ga0068853_1017614991 174
60 3300005548 Ga0070665_100003517 Ga0070665_1000035176 174
61 3300005617 Ga0068859_100276362 Ga0068859_1002763622 174
62 3300005718 Ga0068866_10465823 Ga0068866_104658232 174
63 3300005841 Ga0068863_100021278 Ga0068863_1000212786 174
64 3300006028 Ga0070717_10302539 Ga0070717_103025391 174
65 3300006163 Ga0070715_10123272 Ga0070715_101232722 174
66 3300006173 Ga0070716_100013935 Ga0070716_1000139353 174
67 3300006173 Ga0070716_100021771 Ga0070716_1000217713 174
68 3300006173 Ga0070716_100047431 Ga0070716_1000474312 174
69 3300006173 Ga0070716_101039474 Ga0070716_1010394741 174
70 3300006175 Ga0070712_100039499 Ga0070712_1000394992 174
71 3300006175 Ga0070712_100091768 Ga0070712_1000917683 174
72 3300006175 Ga0070712_100093735 Ga0070712_1000937352 174
73 3300006237 Ga0097621_100022401 Ga0097621_1000224014 174
74 3300006358 Ga0068871_100019284 Ga0068871_1000192845 174
75 3300006852 Ga0075433_10163936 Ga0075433_101639362 174
76 3300006871 Ga0075434_100005522 Ga0075434_1000055222 174
77 3300006871 Ga0075434_100211761 Ga0075434_1002117612 174
78 3300006881 Ga0068865_100610365 Ga0068865_1006103652 174
79 3300006914 Ga0075436_100406617 Ga0075436_1004066172 174
80 3300006931 Ga0097620_100276359 Ga0097620_1002763592 174
81 3300007076 Ga0075435_100025783 Ga0075435_1000257834 174
82 3300007076 Ga0075435_100081129 Ga0075435_1000811293 174
83 3300007265 Ga0099794_10151702 Ga0099794_101517022 174
84 3300007788 Ga0099795_10032623 Ga0099795_100326232 174
85 3300009148 Ga0105243_10192831 Ga0105243_101928313 174
86 3300009176 Ga0105242_10393699 Ga0105242_103936992 174
87 3300010159 Ga0099796_10011665 Ga0099796_100116652 174
88 3300013296 Ga0157374_10224340 Ga0157374_102243403 174
89 3300013297 Ga0157378_10009550 Ga0157378_100095507 174
90 3300013297 Ga0157378_10193808 Ga0157378_101938082 174
91 3300013308 Ga0157375_10497889 Ga0157375_104978892 174
92 3300014968 Ga0157379_10006363 Ga0157379_100063632 174
93 3300014968 Ga0157379_11185451 Ga0157379_111854511 174
94 3300014969 Ga0157376_10000008 Ga0157376_10000008201 174
95 3300014969 Ga0157376_10000215 Ga0157376_1000021536 174
96 3300025906 Ga0207699_10120052 Ga0207699_101200522 174
97 3300025910 Ga0207684_10127226 Ga0207684_101272263 174
98 3300025910 Ga0207684_10824266 Ga0207684_108242662 174
99 3300025915 Ga0207693_10020560 Ga0207693_100205604 174
100 3300025915 Ga0207693_10265573 Ga0207693_102655733 174
101 3300025915 Ga0207693_10333380 Ga0207693_103333802 174
102 3300025916 Ga0207663_10022481 Ga0207663_100224812 174
103 3300025922 Ga0207646_10005130 Ga0207646_100051307 174
104 3300025928 Ga0207700_10002514 Ga0207700_100025147 174
105 3300025928 Ga0207700_10008741 Ga0207700_100087413 174
106 3300025929 Ga0207664_10390270 Ga0207664_103902702 174
107 3300025938 Ga0207704_10565431 Ga0207704_105654311 174
108 3300025939 Ga0207665_10004114 Ga0207665_100041142 174
109 3300025939 Ga0207665_10006098 Ga0207665_100060985 174
110 3300025939 Ga0207665_10042636 Ga0207665_100426362 174
111 3300025939 Ga0207665_10090631 Ga0207665_100906312 174
112 3300026035 Ga0207703_10605648 Ga0207703_106056482 174
113 3300026088 Ga0207641_10034166 Ga0207641_100341661 174
114 3300027671 Ga0209588_1092218 Ga0209588_10922182 174
115 3300028379 Ga0268266_10000283 Ga0268266_1000028332 174
116 3300028381 Ga0268264_10708314 Ga0268264_107083141 174
117 3300035116 Ga0373945_0337144 Ga0373945_0337144_67_591 174
118 3300035691 Ga0373931_0123030 Ga0373931_0123030_759_1283 174
119 3300035691 Ga0373931_0204208 Ga0373931_0204208_183_707 174
120 3300035691 Ga0373931_0239741 Ga0373931_0239741_60_584 174
121 3300037068 Ga0373925_0095193 Ga0373925_0095193_137_661 174
122 3300046455 Ga0495603_0004226 Ga0495603_0004226_2424_2948 174
123 3300046455 Ga0495603_0155939 Ga0495603_0155939_135_659 174
124 3300046459 Ga0495629_0131344 Ga0495629_0131344_137_661 174
125 3300046461 Ga0495641_0060256 Ga0495641_0060256_1081_1605 174
126 3300046472 Ga0495580_0000556 Ga0495580_0000556_24597_25121 174
127 3300046472 Ga0495580_0074919 Ga0495580_0074919_514_1038 174
128 3300046473 Ga0495582_0001950 Ga0495582_0001950_6280_6804 174
129 3300046473 Ga0495582_0196837 Ga0495582_0196837_393_917 174
130 3300046475 Ga0495639_0019378 Ga0495639_0019378_1338_1862 174
131 3300046499 Ga0495594_0005359 Ga0495594_0005359_3338_3862 174
132 3300046517 Ga0495630_0114841 Ga0495630_0114841_65_589 174
133 3300046526 Ga0495666_0026660 Ga0495666_0026660_1338_1862 174
134 3300046533 Ga0495640_0073589 Ga0495640_0073589_999_1523 174
135 3300046535 Ga0495586_0221878 Ga0495586_0221878_486_1010 174
136 3300046642 Ga0495634_0154842 Ga0495634_0154842_898_1422 174
137 3300046681 Ga0495647_0002793 Ga0495647_0002793_4839_5363 174
138 3300046689 Ga0495613_0016521 Ga0495613_0016521_382_906 174
139 3300046690 Ga0495624_0033153 Ga0495624_0033153_1760_2284 174
140 3300047315 Ga0495581_0024197 Ga0495581_0024197_1197_1721 174
141 3300047319 Ga0495674_0038587 Ga0495674_0038587_2534_3058 174
142 3300047321 Ga0495676_0012015 Ga0495676_0012015_3435_3959 174
143 3300047673 Ga0495593_0536157 Ga0495593_0536157_39_563 174
144 3300048089 Ga0495614_0020987 Ga0495614_0020987_387_911 174
145 3300048089 Ga0495614_0028470 Ga0495614_0028470_1227_1751 174
146 3300048903 Ga0496100_0433186 Ga0496100_0433186_170_694 174
147 3300048904 Ga0496101_0132217 Ga0496101_0132217_1127_1651 174
148 3300048917 Ga0496114_0002595 Ga0496114_0002595_10906_11430 174
149 3300048918 Ga0496115_0004564 Ga0496115_0004564_6352_6876 174
150 3300050512 nmdc:mga0n895_489629_c1 nmdc:mga0n895_489629_c1_645_1169 174
151 3300050512 nmdc:mga0n895_96153_c1 nmdc:mga0n895_96153_c1_2338_2862 174
152 3300050513 nmdc:mga0rr50_19931_c1 nmdc:mga0rr50_19931_c1_2217_2741 174
153 3300050513 nmdc:mga0rr50_331150_c1 nmdc:mga0rr50_331150_c1_15_539 174
154 3300050513 nmdc:mga0rr50_64767_c1 nmdc:mga0rr50_64767_c1_1636_2160 174
155 3300050514 nmdc:mga08x19_36762_c1 nmdc:mga08x19_36762_c1_2213_2737 174
156 3300050515 nmdc:mga0a205_151315_c1 nmdc:mga0a205_151315_c1_241_765 174
157 3300053085 Ga0495619_0076031 Ga0495619_0076031_599_1123 174
158 3300005434 Ga0070709_10005849 Ga0070709_100058494 175
159 3300005436 Ga0070713_100123331 Ga0070713_1001233311 175
160 3300006028 Ga0070717_10248857 Ga0070717_102488572 175
161 3300006173 Ga0070716_100040187 Ga0070716_1000401872 175
162 3300006173 Ga0070716_100047500 Ga0070716_1000475002 175
163 3300006914 Ga0075436_100005997 Ga0075436_1000059973 175
164 3300006914 Ga0075436_100017972 Ga0075436_1000179722 175
165 3300007076 Ga0075435_100202347 Ga0075435_1002023472 175
166 3300007265 Ga0099794_10001541 Ga0099794_100015411 175
167 3300007265 Ga0099794_10013683 Ga0099794_100136832 175
168 3300007265 Ga0099794_10020460 Ga0099794_100204603 175
169 3300007265 Ga0099794_10024141 Ga0099794_100241413 175
170 3300007265 Ga0099794_10052895 Ga0099794_100528952 175
171 3300007788 Ga0099795_10031922 Ga0099795_100319222 175
172 3300009093 Ga0105240_10017753 Ga0105240_100177535 175
173 3300013104 Ga0157370_10779072 Ga0157370_107790721 175
174 3300024227 Ga0228598_1003542 Ga0228598_10035422 175
175 3300025928 Ga0207700_10232671 Ga0207700_102326712 175
176 3300025939 Ga0207665_10001225 Ga0207665_1000122512 175
177 3300027671 Ga0209588_1001617 Ga0209588_10016175 175
178 3300027671 Ga0209588_1006168 Ga0209588_10061683 175
179 3300027671 Ga0209588_1037036 Ga0209588_10370361 175
180 3300028016 Ga0265354_1002558 Ga0265354_10025583 175
181 3300028800 Ga0265338_10003786 Ga0265338_100037864 175
182 3300028800 Ga0265338_10020685 Ga0265338_100206854 175
183 3300030878 Ga0265770_1035984 Ga0265770_10359841 175
184 3300031240 Ga0265320_10161824 Ga0265320_101618241 175
185 3300031241 Ga0265325_10001400 Ga0265325_1000140010 175
186 3300035724 Ga0373933_0002002 Ga0373933_0002002_195_737 175
187 3300036401 Ga0373937_0000208 Ga0373937_0000208_6923_7465 175
188 3300046462 Ga0495651_0009699 Ga0495651_0009699_4956_5498 175
189 3300046463 Ga0495653_0394878 Ga0495653_0394878_103_645 175
190 3300046529 Ga0495652_0038733 Ga0495652_0038733_3055_3597 175
191 3300046536 Ga0495587_0000180 Ga0495587_0000180_1190_1732 175
192 3300046559 Ga0495667_0135339 Ga0495667_0135339_584_1126 175
193 3300046675 Ga0495657_0282414 Ga0495657_0282414_320_862 175
194 3300046679 Ga0495623_0029002 Ga0495623_0029002_2532_3074 175
195 3300047317 Ga0495604_0044949 Ga0495604_0044949_797_1339 175
196 3300047444 Ga0495675_0000240 Ga0495675_0000240_15143_15685 175
197 3300048088 Ga0495602_0001957 Ga0495602_0001957_4554_5096 175
198 3300050514 nmdc:mga08x19_1261_c1 nmdc:mga08x19_1261_c1_3959_4489 175
199 3300050514 nmdc:mga08x19_87898_c1 nmdc:mga08x19_87898_c1_144_671 175
200 3300005334 Ga0068869_100090212 Ga0068869_1000902122 176
201 3300005340 Ga0070689_100448570 Ga0070689_1004485701 176
202 3300005367 Ga0070667_100098963 Ga0070667_1000989632 176
203 3300005406 Ga0070703_10000732 Ga0070703_100007328 176
204 3300005434 Ga0070709_10075402 Ga0070709_100754022 176
205 3300005434 Ga0070709_10478909 Ga0070709_104789092 176
206 3300005435 Ga0070714_100219388 Ga0070714_1002193882 176
207 3300005436 Ga0070713_100900571 Ga0070713_1009005711 176
208 3300005437 Ga0070710_10511251 Ga0070710_105112511 176
209 3300005439 Ga0070711_100000832 Ga0070711_1000008329 176
210 3300005439 Ga0070711_100661577 Ga0070711_1006615771 176
211 3300005440 Ga0070705_100004846 Ga0070705_1000048464 176
212 3300005440 Ga0070705_100107225 Ga0070705_1001072251 176
213 3300005445 Ga0070708_100000994 Ga0070708_1000009944 176
214 3300005445 Ga0070708_100893081 Ga0070708_1008930811 176
215 3300005458 Ga0070681_10151777 Ga0070681_101517773 176
216 3300005467 Ga0070706_100037812 Ga0070706_1000378125 176
217 3300005468 Ga0070707_101044096 Ga0070707_1010440962 176
218 3300005471 Ga0070698_100002861 Ga0070698_1000028618 176
219 3300005518 Ga0070699_100007115 Ga0070699_1000071153 176
220 3300005518 Ga0070699_100047390 Ga0070699_1000473903 176
221 3300005518 Ga0070699_100365075 Ga0070699_1003650752 176
222 3300005530 Ga0070679_100038965 Ga0070679_1000389655 176
223 3300005536 Ga0070697_100000937 Ga0070697_1000009378 176
224 3300005544 Ga0070686_100378512 Ga0070686_1003785121 176
225 3300005545 Ga0070695_100014446 Ga0070695_1000144462 176
226 3300005545 Ga0070695_100135833 Ga0070695_1001358332 176
227 3300005545 Ga0070695_100775698 Ga0070695_1007756981 176
228 3300005546 Ga0070696_100000611 Ga0070696_10000061117 176
229 3300005546 Ga0070696_100125578 Ga0070696_1001255782 176
230 3300005547 Ga0070693_100000041 Ga0070693_10000004122 176
231 3300005549 Ga0070704_100002019 Ga0070704_1000020193 176
232 3300005843 Ga0068860_100005030 Ga0068860_1000050304 176
233 3300006173 Ga0070716_100093020 Ga0070716_1000930202 176
234 3300006173 Ga0070716_100162408 Ga0070716_1001624082 176
235 3300006173 Ga0070716_100201765 Ga0070716_1002017652 176
236 3300006173 Ga0070716_100772898 Ga0070716_1007728982 176
237 3300006175 Ga0070712_100033489 Ga0070712_1000334893 176
238 3300006852 Ga0075433_11301009 Ga0075433_113010091 176
239 3300006914 Ga0075436_100124614 Ga0075436_1001246142 176
240 3300006914 Ga0075436_100292841 Ga0075436_1002928412 176
241 3300007076 Ga0075435_101121130 Ga0075435_1011211301 176
242 3300007265 Ga0099794_10009630 Ga0099794_100096302 176
243 3300007265 Ga0099794_10030324 Ga0099794_100303242 176
244 3300007265 Ga0099794_10134183 Ga0099794_101341832 176
245 3300007265 Ga0099794_10160209 Ga0099794_101602092 176
246 3300007788 Ga0099795_10136608 Ga0099795_101366082 176
247 3300009098 Ga0105245_10249046 Ga0105245_102490462 176
248 3300009174 Ga0105241_10753154 Ga0105241_107531542 176
249 3300009545 Ga0105237_10065949 Ga0105237_100659492 176
250 3300010159 Ga0099796_10075518 Ga0099796_100755182 176
251 3300010375 Ga0105239_10123559 Ga0105239_101235592 176
252 3300013297 Ga0157378_10007348 Ga0157378_100073485 176
253 3300013307 Ga0157372_10113626 Ga0157372_101136262 176
254 3300013308 Ga0157375_11223235 Ga0157375_112232352 176
255 3300021384 Ga0213876_10010226 Ga0213876_100102263 176
256 3300025885 Ga0207653_10000955 Ga0207653_100009555 176
257 3300025906 Ga0207699_10095679 Ga0207699_100956792 176
258 3300025910 Ga0207684_10166347 Ga0207684_101663472 176
259 3300025912 Ga0207707_10122539 Ga0207707_101225392 176
260 3300025914 Ga0207671_10237870 Ga0207671_102378702 176
261 3300025915 Ga0207693_10043803 Ga0207693_100438033 176
262 3300025915 Ga0207693_10095362 Ga0207693_100953622 176
263 3300025915 Ga0207693_10366931 Ga0207693_103669312 176
264 3300025916 Ga0207663_10047481 Ga0207663_100474813 176
265 3300025917 Ga0207660_10361930 Ga0207660_103619302 176
266 3300025921 Ga0207652_10049590 Ga0207652_100495902 176
267 3300025927 Ga0207687_10245503 Ga0207687_102455032 176
268 3300025928 Ga0207700_10010106 Ga0207700_100101064 176
269 3300025929 Ga0207664_10303700 Ga0207664_103037002 176
270 3300025939 Ga0207665_10110553 Ga0207665_101105532 176
271 3300025939 Ga0207665_10768936 Ga0207665_107689362 176
272 3300025942 Ga0207689_10194919 Ga0207689_101949192 176
273 3300027512 Ga0209179_1072578 Ga0209179_10725781 176
274 3300027671 Ga0209588_1009109 Ga0209588_10091092 176
275 3300027671 Ga0209588_1101997 Ga0209588_11019972 176
276 3300028380 Ga0268265_11401726 Ga0268265_114017262 176
277 3300028381 Ga0268264_10013901 Ga0268264_100139016 176
278 3300028800 Ga0265338_10138667 Ga0265338_101386672 176
279 3300028800 Ga0265338_10287658 Ga0265338_102876582 176
280 3300031247 Ga0265340_10124477 Ga0265340_101244772 176
281 3300035083 Ga0373926_0000883 Ga0373926_0000883_8013_8546 176
282 3300035086 Ga0373934_0002484 Ga0373934_0002484_161_694 176
283 3300035117 Ga0373953_0004380 Ga0373953_0004380_3243_3776 176
284 3300035118 Ga0373954_0000470 Ga0373954_0000470_13559_14092 176
285 3300035118 Ga0373954_0044914 Ga0373954_0044914_1004_1537 176
286 3300035119 Ga0373956_0010212 Ga0373956_0010212_3113_3646 176
287 3300035120 Ga0373957_0004329 Ga0373957_0004329_1324_1857 176
288 3300035171 Ga0373946_0002752 Ga0373946_0002752_4247_4780 176
289 3300035172 Ga0373955_0003245 Ga0373955_0003245_5936_6469 176
290 3300035172 Ga0373955_0036473 Ga0373955_0036473_178_711 176
291 3300035410 Ga0373924_0033772 Ga0373924_0033772_115_648 176
292 3300035695 Ga0373927_0001818 Ga0373927_0001818_1411_1944 176
293 3300035695 Ga0373927_0292996 Ga0373927_0292996_205_738 176
294 3300035724 Ga0373933_0001309 Ga0373933_0001309_3763_4296 176
295 3300035725 Ga0373947_0002711 Ga0373947_0002711_5680_6213 176
296 3300036401 Ga0373937_0000243 Ga0373937_0000243_24982_25515 176
297 3300037068 Ga0373925_0001208 Ga0373925_0001208_12905_13438 176
298 3300037068 Ga0373925_0073547 Ga0373925_0073547_546_1079 176
299 3300039437 Ga0436365_0384191 Ga0436365_0384191_2793_3323 176
300 3300039437 Ga0436365_1364470 Ga0436365_1364470_1311_1841 176
301 3300039450 Ga0436363_1263297 Ga0436363_1263297_91_624 176
302 3300046454 Ga0495592_0167734 Ga0495592_0167734_493_1026 176
303 3300046462 Ga0495651_0010979 Ga0495651_0010979_3002_3535 176
304 3300046462 Ga0495651_0256260 Ga0495651_0256260_385_918 176
305 3300046472 Ga0495580_0030597 Ga0495580_0030597_800_1333 176
306 3300046472 Ga0495580_0354771 Ga0495580_0354771_94_627 176
307 3300046477 Ga0495664_0076574 Ga0495664_0076574_1260_1790 176
308 3300046511 Ga0495608_0028126 Ga0495608_0028126_807_1340 176
309 3300046516 Ga0495628_0059199 Ga0495628_0059199_2140_2673 176
310 3300046517 Ga0495630_0004035 Ga0495630_0004035_1885_2418 176
311 3300046526 Ga0495666_0302746 Ga0495666_0302746_88_621 176
312 3300046531 Ga0495665_0039751 Ga0495665_0039751_1861_2394 176
313 3300046536 Ga0495587_0001230 Ga0495587_0001230_5795_6328 176
314 3300046543 Ga0495645_0034607 Ga0495645_0034607_102_632 176
315 3300046559 Ga0495667_0021248 Ga0495667_0021248_200_733 176
316 3300046679 Ga0495623_0197233 Ga0495623_0197233_187_720 176
317 3300046690 Ga0495624_0303809 Ga0495624_0303809_139_672 176
318 3300047317 Ga0495604_0434506 Ga0495604_0434506_201_734 176
319 3300047319 Ga0495674_0095016 Ga0495674_0095016_1093_1626 176
320 3300047319 Ga0495674_0142117 Ga0495674_0142117_1261_1791 176
321 3300047471 Ga0495684_0009402 Ga0495684_0009402_3476_4009 176
322 3300048905 Ga0496102_0103081 Ga0496102_0103081_1978_2508 176
323 3300048909 Ga0496106_0600582 Ga0496106_0600582_94_624 176
324 3300048915 Ga0496112_0187775 Ga0496112_0187775_973_1503 176
325 3300050513 nmdc:mga0rr50_986674_c1 nmdc:mga0rr50_986674_c1_113_643 176
326 3300050514 nmdc:mga08x19_123668_c1 nmdc:mga08x19_123668_c1_605_1138 176
327 3300053077 Ga0495601_0059742 Ga0495601_0059742_366_896 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

22

176

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z7f-assembly1.cif.gz_B crystal structure of folt bound with folic acid 0.6485 22 166
6zg3-assembly2.cif.gz_C the structure of ecf pant transporter in a complex with a nanobody 0.6454 25 172
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.609 18 173
4z7f-assembly1.cif.gz_B crystal structure of folt bound with folic acid 0.5753 22 166
7nnt-assembly1.cif.gz_C cryo-em structure of the folate-specific ecf transporter complex in ddm micelles 0.5689 18 173
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7944 22 172 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7567 22 172 1.10.1760.20
af_Q2G061_16_177_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6936 23 173 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6573 23 172 1.10.1760.20
4z7fB00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6485 22 166 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A372IPK5-F1-model_v4 Rod shape-determining protein MreD 0.9684 18 176 GO:0005886
GO:0008360
AF-A0A2V9S3V1-F1-model_v4 Rod shape-determining protein MreD 0.9635 20 173 GO:0005886
GO:0008360
AF-A0A2V7X5A2-F1-model_v4 Rod shape-determining protein MreD 0.9619 44 172 GO:0005886
GO:0008360
AF-A0A2V9RL04-F1-model_v4 Rod shape-determining protein MreD 0.942 23 173 GO:0005886
GO:0008360
AF-A0A2V9S3V1-F1-model_v4 Rod shape-determining protein MreD 0.9333 20 173 GO:0005886
GO:0008360

Feature Viewer

pLDDT pTM Quality
87.83 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map