F408554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 235 | 309 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_108551_c1|nmdc:mga08y16_108551_c1_646_1350 |
| Length | 234 |
| Sequence | LHDRHGLAADAGKGDTVNGVHDMGGMHGFGKVAPDADERPFHATWEARVLAMQRAIRFARAWNIDMSRDAIERQPPQRYLAASYYERWLMGMETSAVEKGLIDPDEIAAGHALRPGKSVARVMTKDDLGRPFTRGSFSRPPGHEARFKPGDRVRTKNINPATHTRLPRYARGREGLVEAVRGCHVFPDSVVTGHGEDPQWLYTVVFNGRQLWGANADPTLTVSIEAFEPYLEPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 3 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 4 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 7 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 8 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 9 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 10 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 11 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 12 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 13 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 14 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 15 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 75 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 118 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 119 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 140 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 141 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 142 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 143 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 144 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 145 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 146 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 147 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 195 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 223 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 224 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 231 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 232 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 233 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 234 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 235 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.25 |
| Metatranscriptomes | 1.53 |
| Isolates | 5.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 4.91 |
| Rhizoplane | 4.29 |
| Rhizosphere | 80.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1026819 | 3300002774 | Bacteria | 829 |
| 2 | JGI25153J46596_10012635 | 3300003215 | Bacteria | 3623 |
| 3 | rootH2_10146089 | 3300003320 | Bacteria | 1926 |
| 4 | Ga0070683_100001608 | 3300005329 | Bacteria | 17476 |
| 5 | Ga0070683_100015944 | 3300005329 | Bacteria | 6610 |
| 6 | Ga0070680_100056092 | 3300005336 | Bacteria | 3220 |
| 7 | Ga0070680_100069534 | 3300005336 | Bacteria | 2891 |
| 8 | Ga0070680_100134866 | 3300005336 | Bacteria | 2067 |
| 9 | Ga0070680_101041030 | 3300005336 | Bacteria | 707 |
| 10 | Ga0070682_100102011 | 3300005337 | Bacteria | 1896 |
| 11 | Ga0070660_100040560 | 3300005339 | Bacteria | 3544 |
| 12 | Ga0070668_100377450 | 3300005347 | Bacteria | 1206 |
| 13 | Ga0070668_100911472 | 3300005347 | Bacteria | 786 |
| 14 | Ga0070659_100146871 | 3300005366 | Bacteria | 1922 |
| 15 | Ga0070709_10015246 | 3300005434 | Bacteria | 4368 |
| 16 | Ga0070714_100060015 | 3300005435 | Bacteria | 3263 |
| 17 | Ga0070714_100502743 | 3300005435 | Bacteria | 1156 |
| 18 | Ga0070714_100936044 | 3300005435 | Unclassified | 842 |
| 19 | Ga0070713_100022472 | 3300005436 | Bacteria | 4875 |
| 20 | Ga0070713_100063046 | 3300005436 | Bacteria | 3106 |
| 21 | Ga0070710_10019648 | 3300005437 | Bacteria | 3494 |
| 22 | Ga0070708_100013114 | 3300005445 | Bacteria | 6780 |
| 23 | Ga0070708_100354510 | 3300005445 | Bacteria | 1383 |
| 24 | Ga0070662_100028313 | 3300005457 | Bacteria | 3898 |
| 25 | Ga0070681_10017891 | 3300005458 | Bacteria | 7084 |
| 26 | Ga0070681_10053558 | 3300005458 | Bacteria | 4022 |
| 27 | Ga0070681_10225318 | 3300005458 | Bacteria | 1789 |
| 28 | Ga0070681_10283441 | 3300005458 | Bacteria | 1568 |
| 29 | Ga0070698_100952125 | 3300005471 | Bacteria | 805 |
| 30 | Ga0070699_100093645 | 3300005518 | Bacteria | 2629 |
| 31 | Ga0070699_100219116 | 3300005518 | Bacteria | 1696 |
| 32 | Ga0070679_100011783 | 3300005530 | Bacteria | 8337 |
| 33 | Ga0070679_100221158 | 3300005530 | Bacteria | 1854 |
| 34 | Ga0070679_100670366 | 3300005530 | Bacteria | 980 |
| 35 | Ga0070684_100007537 | 3300005535 | Bacteria | 8472 |
| 36 | Ga0068853_100281599 | 3300005539 | Bacteria | 1533 |
| 37 | Ga0070696_100066189 | 3300005546 | Bacteria | 2534 |
| 38 | Ga0070696_100262068 | 3300005546 | Bacteria | 1311 |
| 39 | Ga0070704_100203707 | 3300005549 | Bacteria | 1599 |
| 40 | Ga0068855_100180461 | 3300005563 | Bacteria | 2387 |
| 41 | Ga0068855_101084421 | 3300005563 | Bacteria | 838 |
| 42 | Ga0068855_101102423 | 3300005563 | Bacteria | 830 |
| 43 | Ga0070664_100041947 | 3300005564 | Bacteria | 3863 |
| 44 | Ga0068857_100216143 | 3300005577 | Bacteria | 1750 |
| 45 | Ga0068856_100032045 | 3300005614 | Bacteria | 5144 |
| 46 | Ga0068862_100446355 | 3300005844 | Bacteria | 1218 |
| 47 | Ga0081538_10005426 | 3300005981 | Bacteria | 11450 |
| 48 | Ga0070717_10819573 | 3300006028 | Bacteria | 847 |
| 49 | Ga0075365_10013262 | 3300006038 | Bacteria | 4918 |
| 50 | Ga0075363_100012491 | 3300006048 | Bacteria | 4096 |
| 51 | Ga0070716_100035211 | 3300006173 | Bacteria | 2752 |
| 52 | Ga0075362_10027315 | 3300006177 | Bacteria | 2443 |
| 53 | Ga0075367_10232684 | 3300006178 | Bacteria | 1154 |
| 54 | Ga0075366_10012090 | 3300006195 | Bacteria | 4888 |
| 55 | Ga0075366_10043820 | 3300006195 | Bacteria | 2651 |
| 56 | Ga0075366_10082806 | 3300006195 | Bacteria | 1917 |
| 57 | Ga0075366_10127064 | 3300006195 | Bacteria | 1538 |
| 58 | Ga0075428_100456882 | 3300006844 | Bacteria | 1368 |
| 59 | Ga0075433_10061418 | 3300006852 | Bacteria | 3292 |
| 60 | Ga0075433_10629685 | 3300006852 | Bacteria | 941 |
| 61 | Ga0075434_100008357 | 3300006871 | Bacteria | 9621 |
| 62 | Ga0075434_100068375 | 3300006871 | Bacteria | 3538 |
| 63 | Ga0075434_100095903 | 3300006871 | Bacteria | 2971 |
| 64 | Ga0075435_100118501 | 3300007076 | Bacteria | 2207 |
| 65 | Ga0075435_100284802 | 3300007076 | Bacteria | 1411 |
| 66 | Ga0099794_10140065 | 3300007265 | Bacteria | 1225 |
| 67 | Ga0099794_10169612 | 3300007265 | Bacteria | 1112 |
| 68 | Ga0105240_10638871 | 3300009093 | Bacteria | 1168 |
| 69 | Ga0111539_10012470 | 3300009094 | Bacteria | 10653 |
| 70 | Ga0111539_10043093 | 3300009094 | Bacteria | 5413 |
| 71 | Ga0111539_10138316 | 3300009094 | Bacteria | 2852 |
| 72 | Ga0105241_10270998 | 3300009174 | Bacteria | 1446 |
| 73 | Ga0105242_10250740 | 3300009176 | Bacteria | 1595 |
| 74 | Ga0105248_10248101 | 3300009177 | Unclassified | 2004 |
| 75 | Ga0105248_10879327 | 3300009177 | Bacteria | 1012 |
| 76 | Ga0105238_10367370 | 3300009551 | Bacteria | 1429 |
| 77 | Ga0105238_10484839 | 3300009551 | Bacteria | 1236 |
| 78 | Ga0105249_10160733 | 3300009553 | Bacteria | 2171 |
| 79 | Ga0123341_1000032 | 3300009765 | Bacteria | 62527 |
| 80 | Ga0105239_10181054 | 3300010375 | Bacteria | 2358 |
| 81 | Ga0157371_10256091 | 3300013102 | Bacteria | 1261 |
| 82 | Ga0157370_10201241 | 3300013104 | Bacteria | 1847 |
| 83 | Ga0157369_10010521 | 3300013105 | Bacteria | 10531 |
| 84 | Ga0157369_10017675 | 3300013105 | Bacteria | 8011 |
| 85 | Ga0163162_10639574 | 3300013306 | Bacteria | 1188 |
| 86 | Ga0157372_10522658 | 3300013307 | Bacteria | 1383 |
| 87 | Ga0157375_10292035 | 3300013308 | Bacteria | 1793 |
| 88 | Ga0157375_10420863 | 3300013308 | Bacteria | 1502 |
| 89 | Ga0182008_10008948 | 3300014497 | Bacteria | 5430 |
| 90 | Ga0157379_10025417 | 3300014968 | Bacteria | 5261 |
| 91 | Ga0182007_10015781 | 3300015262 | Bacteria | 2805 |
| 92 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 93 | Ga0206356_10188264 | 3300020070 | Bacteria | 1725 |
| 94 | Ga0206354_10605015 | 3300020081 | Bacteria | 1873 |
| 95 | Ga0206353_10571089 | 3300020082 | Bacteria | 1975 |
| 96 | Ga0213876_10062569 | 3300021384 | Bacteria | 1965 |
| 97 | Ga0213876_10134337 | 3300021384 | Bacteria | 1316 |
| 98 | Ga0224712_10032637 | 3300022467 | Bacteria | 1899 |
| 99 | Ga0224712_10073835 | 3300022467 | Bacteria | 1392 |
| 100 | Ga0207692_10010022 | 3300025898 | Bacteria | 3976 |
| 101 | Ga0207692_10198697 | 3300025898 | Unclassified | 1178 |
| 102 | Ga0207699_10167177 | 3300025906 | Bacteria | 1469 |
| 103 | Ga0207645_10231622 | 3300025907 | Bacteria | 1219 |
| 104 | Ga0207684_10016995 | 3300025910 | Bacteria | 6250 |
| 105 | Ga0207684_10644960 | 3300025910 | Bacteria | 902 |
| 106 | Ga0207707_10000413 | 3300025912 | Bacteria | 44774 |
| 107 | Ga0207695_10345096 | 3300025913 | Bacteria | 1376 |
| 108 | Ga0207660_10046798 | 3300025917 | Bacteria | 3055 |
| 109 | Ga0207660_10147019 | 3300025917 | Bacteria | 1807 |
| 110 | Ga0207662_10514564 | 3300025918 | Bacteria | 825 |
| 111 | Ga0207657_10122597 | 3300025919 | Bacteria | 2138 |
| 112 | Ga0207652_10011754 | 3300025921 | Bacteria | 7066 |
| 113 | Ga0207652_10148643 | 3300025921 | Bacteria | 2097 |
| 114 | Ga0207646_10292998 | 3300025922 | Bacteria | 1470 |
| 115 | Ga0207694_10343681 | 3300025924 | Bacteria | 1234 |
| 116 | Ga0207694_10489469 | 3300025924 | Bacteria | 1029 |
| 117 | Ga0207700_10015504 | 3300025928 | Bacteria | 5030 |
| 118 | Ga0207700_10043098 | 3300025928 | Bacteria | 3313 |
| 119 | Ga0207700_10049400 | 3300025928 | Bacteria | 3129 |
| 120 | Ga0207664_10002993 | 3300025929 | Bacteria | 11226 |
| 121 | Ga0207664_10093993 | 3300025929 | Bacteria | 2464 |
| 122 | Ga0207664_10404872 | 3300025929 | Bacteria | 1214 |
| 123 | Ga0207690_10310574 | 3300025932 | Bacteria | 1236 |
| 124 | Ga0207706_10030364 | 3300025933 | Bacteria | 4821 |
| 125 | Ga0207709_10311070 | 3300025935 | Bacteria | 1175 |
| 126 | Ga0207661_10000177 | 3300025944 | Bacteria | 41089 |
| 127 | Ga0207679_10055630 | 3300025945 | Bacteria | 2918 |
| 128 | Ga0207667_10152549 | 3300025949 | Bacteria | 2378 |
| 129 | Ga0207712_10129893 | 3300025961 | Bacteria | 1918 |
| 130 | Ga0207678_10023718 | 3300026067 | Bacteria | 5366 |
| 131 | Ga0207702_10043097 | 3300026078 | Bacteria | 3788 |
| 132 | Ga0207674_10040678 | 3300026116 | Bacteria | 4814 |
| 133 | Ga0207683_10303009 | 3300026121 | Bacteria | 1462 |
| 134 | Ga0207428_10133019 | 3300027907 | Bacteria | 1902 |
| 135 | Ga0268265_10503757 | 3300028380 | Bacteria | 1141 |
| 136 | Ga0307515_10000291 | 3300028794 | Bacteria | 123206 |
| 137 | Ga0307515_10215205 | 3300028794 | Bacteria | 1754 |
| 138 | Ga0265328_10000986 | 3300031239 | Bacteria | 13075 |
| 139 | Ga0265325_10045164 | 3300031241 | Bacteria | 2290 |
| 140 | Ga0265325_10052799 | 3300031241 | Bacteria | 2086 |
| 141 | Ga0265340_10016673 | 3300031247 | Bacteria | 3802 |
| 142 | Ga0265340_10031039 | 3300031247 | Bacteria | 2674 |
| 143 | Ga0265339_10009983 | 3300031249 | Bacteria | 5924 |
| 144 | Ga0265339_10024316 | 3300031249 | Bacteria | 3492 |
| 145 | Ga0265316_10232559 | 3300031344 | Bacteria | 1357 |
| 146 | Ga0307408_100664339 | 3300031548 | Bacteria | 933 |
| 147 | Ga0265313_10010025 | 3300031595 | Bacteria | 6064 |
| 148 | Ga0265313_10039445 | 3300031595 | Bacteria | 2342 |
| 149 | Ga0265313_10047456 | 3300031595 | Bacteria | 2078 |
| 150 | Ga0265313_10158294 | 3300031595 | Bacteria | 963 |
| 151 | Ga0265314_10054403 | 3300031711 | Bacteria | 2770 |
| 152 | Ga0265342_10015210 | 3300031712 | Bacteria | 5072 |
| 153 | Ga0265342_10067980 | 3300031712 | Bacteria | 2083 |
| 154 | Ga0265342_10091579 | 3300031712 | Bacteria | 1742 |
| 155 | Ga0265342_10222980 | 3300031712 | Bacteria | 1015 |
| 156 | Ga0316583_10181979 | 3300032133 | Bacteria | 731 |
| 157 | Ga0373926_0147937 | 3300035083 | Bacteria | 894 |
| 158 | Ga0373934_0228826 | 3300035086 | Bacteria | 767 |
| 159 | Ga0373936_0116242 | 3300035113 | Bacteria | 1139 |
| 160 | Ga0373945_0062564 | 3300035116 | Bacteria | 1392 |
| 161 | Ga0373957_0009174 | 3300035120 | Bacteria | 3230 |
| 162 | Ga0373924_0067534 | 3300035410 | Bacteria | 1504 |
| 163 | Ga0373931_0350261 | 3300035691 | Bacteria | 924 |
| 164 | Ga0373931_0437627 | 3300035691 | Bacteria | 834 |
| 165 | Ga0373935_0010830 | 3300035692 | Bacteria | 5478 |
| 166 | Ga0373935_0246917 | 3300035692 | Bacteria | 1248 |
| 167 | Ga0373927_0284529 | 3300035695 | Bacteria | 1088 |
| 168 | Ga0373933_0116302 | 3300035724 | Bacteria | 1672 |
| 169 | Ga0373947_0043394 | 3300035725 | Bacteria | 2686 |
| 170 | Ga0373947_0146513 | 3300035725 | Bacteria | 1518 |
| 171 | Ga0373937_0016847 | 3300036401 | Bacteria | 6497 |
| 172 | Ga0373937_0022898 | 3300036401 | Bacteria | 5618 |
| 173 | Ga0373937_0083135 | 3300036401 | Bacteria | 2962 |
| 174 | Ga0373925_0013070 | 3300037068 | Bacteria | 6010 |
| 175 | Ga0373925_0167077 | 3300037068 | Bacteria | 1735 |
| 176 | Ga0373925_0294457 | 3300037068 | Bacteria | 1309 |
| 177 | Ga0395900_0120747 | 3300037418 | Bacteria | 2689 |
| 178 | Ga0395898_0195966 | 3300037466 | Bacteria | 1929 |
| 179 | Ga0436364_1270533 | 3300037853 | Bacteria | 1347 |
| 180 | Ga0436364_1420335 | 3300037853 | Bacteria | 2115 |
| 181 | Ga0436364_1537052 | 3300037853 | Bacteria | 1016 |
| 182 | Ga0436365_0605320 | 3300039437 | Bacteria | 5697 |
| 183 | Ga0436365_1147128 | 3300039437 | Bacteria | 1505 |
| 184 | Ga0436365_1524489 | 3300039437 | Bacteria | 2448 |
| 185 | Ga0436363_0522951 | 3300039450 | Bacteria | 2066 |
| 186 | Ga0436362_0502477 | 3300039453 | Bacteria | 1101 |
| 187 | Ga0439465_0002658 | 3300041413 | Bacteria | 5837 |
| 188 | Ga0451853_1152098 | 3300041512 | Bacteria | 5309 |
| 189 | Ga0439431_0000244 | 3300041997 | Bacteria | 11026 |
| 190 | Ga0439433_0005976 | 3300041999 | Bacteria | 2617 |
| 191 | Ga0439442_002325 | 3300042002 | Bacteria | 3734 |
| 192 | Ga0439445_0001130 | 3300042004 | Bacteria | 5710 |
| 193 | Ga0439432_000895 | 3300042006 | Bacteria | 11191 |
| 194 | Ga0439449_0000162 | 3300042007 | Bacteria | 22807 |
| 195 | Ga0439452_001519 | 3300042010 | Bacteria | 9348 |
| 196 | Ga0439462_0003521 | 3300042015 | Bacteria | 3761 |
| 197 | Ga0439434_0004193 | 3300042435 | Bacteria | 4209 |
| 198 | Ga0451577_0164023 | 3300042876 | Bacteria | 2002 |
| 199 | Ga0453683_0221784 | 3300044673 | Bacteria | 1202 |
| 200 | Ga0466966_0227713 | 3300044684 | Bacteria | 1125 |
| 201 | Ga0466961_0106467 | 3300044693 | Bacteria | 1765 |
| 202 | Ga0466963_0228257 | 3300044694 | Bacteria | 1304 |
| 203 | Ga0466963_0300055 | 3300044694 | Bacteria | 1130 |
| 204 | Ga0466971_0011780 | 3300044719 | Bacteria | 3831 |
| 205 | Ga0466970_0286897 | 3300044765 | Bacteria | 926 |
| 206 | Ga0466957_0143727 | 3300044842 | Bacteria | 1539 |
| 207 | Ga0466957_0810968 | 3300044842 | Bacteria | 665 |
| 208 | Ga0466959_0053628 | 3300045049 | Bacteria | 2947 |
| 209 | Ga0451576_0893213 | 3300045051 | Bacteria | 932 |
| 210 | Ga0466958_0046372 | 3300045836 | Bacteria | 2623 |
| 211 | Ga0466967_0044754 | 3300045976 | Bacteria | 3842 |
| 212 | Ga0466967_0126553 | 3300045976 | Bacteria | 2367 |
| 213 | Ga0466967_0686751 | 3300045976 | Bacteria | 1013 |
| 214 | Ga0495592_0041802 | 3300046454 | Bacteria | 3434 |
| 215 | Ga0495629_0091006 | 3300046459 | Bacteria | 2129 |
| 216 | Ga0495638_0045888 | 3300046460 | Bacteria | 2747 |
| 217 | Ga0495651_0047311 | 3300046462 | Bacteria | 3326 |
| 218 | Ga0495582_0050281 | 3300046473 | Bacteria | 2297 |
| 219 | Ga0495662_0007417 | 3300046476 | Bacteria | 5421 |
| 220 | Ga0495584_0028056 | 3300046491 | Bacteria | 2851 |
| 221 | Ga0495584_0050245 | 3300046491 | Bacteria | 2100 |
| 222 | Ga0495618_0204362 | 3300046514 | Bacteria | 1250 |
| 223 | Ga0495628_0066760 | 3300046516 | Bacteria | 2811 |
| 224 | Ga0495637_0041715 | 3300046520 | Bacteria | 1967 |
| 225 | Ga0495642_0079178 | 3300046528 | Bacteria | 1382 |
| 226 | Ga0495640_0011046 | 3300046533 | Bacteria | 6953 |
| 227 | Ga0495640_0198273 | 3300046533 | Bacteria | 1273 |
| 228 | Ga0495645_0087256 | 3300046543 | Bacteria | 2232 |
| 229 | Ga0495622_0280262 | 3300046557 | Bacteria | 729 |
| 230 | Ga0495634_0128684 | 3300046642 | Bacteria | 1616 |
| 231 | Ga0495657_0238619 | 3300046675 | Bacteria | 1098 |
| 232 | Ga0495599_0115237 | 3300046678 | Bacteria | 1672 |
| 233 | Ga0495623_0016779 | 3300046679 | Bacteria | 4732 |
| 234 | Ga0495646_0028099 | 3300046680 | Bacteria | 3524 |
| 235 | Ga0495613_0387472 | 3300046689 | Bacteria | 955 |
| 236 | Ga0495624_0180477 | 3300046690 | Bacteria | 1287 |
| 237 | Ga0495600_0066789 | 3300046809 | Bacteria | 2351 |
| 238 | Ga0495600_0202023 | 3300046809 | Bacteria | 1276 |
| 239 | Ga0495604_0315279 | 3300047317 | Bacteria | 1046 |
| 240 | Ga0495674_0092416 | 3300047319 | Bacteria | 2583 |
| 241 | Ga0495680_0267247 | 3300047322 | Bacteria | 1208 |
| 242 | Ga0495675_0048710 | 3300047444 | Bacteria | 2695 |
| 243 | Ga0495686_0021343 | 3300047472 | Bacteria | 4303 |
| 244 | Ga0496100_0288082 | 3300048903 | Bacteria | 1226 |
| 245 | Ga0496103_0062306 | 3300048906 | Bacteria | 2321 |
| 246 | Ga0496104_0124981 | 3300048907 | Bacteria | 2470 |
| 247 | Ga0496104_0786859 | 3300048907 | Bacteria | 858 |
| 248 | Ga0496105_0087983 | 3300048908 | Bacteria | 2566 |
| 249 | Ga0496107_0381731 | 3300048910 | Bacteria | 1048 |
| 250 | Ga0496108_0036378 | 3300048911 | Bacteria | 4096 |
| 251 | Ga0496108_0332444 | 3300048911 | Bacteria | 1325 |
| 252 | Ga0496109_0137408 | 3300048912 | Bacteria | 2284 |
| 253 | Ga0496111_0239636 | 3300048914 | Bacteria | 1347 |
| 254 | Ga0496112_0084073 | 3300048915 | Bacteria | 3148 |
| 255 | Ga0496114_0556956 | 3300048917 | Bacteria | 1013 |
| 256 | Ga0496115_0430918 | 3300048918 | Bacteria | 1067 |
| 257 | Ga0496115_0554840 | 3300048918 | Unclassified | 918 |
| 258 | Ga0501033_0139170 | 3300049570 | Bacteria | 1755 |
| 259 | Ga0501034_0000621 | 3300049571 | Bacteria | 55508 |
| 260 | Ga0501036_0111288 | 3300049572 | Bacteria | 2314 |
| 261 | Ga0501036_0379891 | 3300049572 | Bacteria | 1179 |
| 262 | Ga0501036_0549059 | 3300049572 | Bacteria | 960 |
| 263 | Ga0501037_0095236 | 3300049573 | Bacteria | 2152 |
| 264 | Ga0501038_0223595 | 3300049574 | Bacteria | 1501 |
| 265 | Ga0501038_0356431 | 3300049574 | Bacteria | 1138 |
| 266 | Ga0501039_0225174 | 3300049575 | Bacteria | 1474 |
| 267 | Ga0501040_0032935 | 3300049576 | Bacteria | 3508 |
| 268 | Ga0501042_0419440 | 3300049578 | Bacteria | 970 |
| 269 | Ga0501043_0233243 | 3300049579 | Bacteria | 1421 |
| 270 | Ga0501046_0219410 | 3300049580 | Bacteria | 1409 |
| 271 | Ga0501047_0670544 | 3300049581 | Bacteria | 855 |
| 272 | Ga0501048_0244360 | 3300049582 | Bacteria | 1274 |
| 273 | Ga0501067_0095827 | 3300049583 | Bacteria | 1648 |
| 274 | Ga0501068_0009667 | 3300049584 | Bacteria | 5399 |
| 275 | Ga0501068_0106589 | 3300049584 | Bacteria | 1740 |
| 276 | Ga0501069_0046905 | 3300049585 | Bacteria | 2398 |
| 277 | Ga0501069_0324047 | 3300049585 | Bacteria | 906 |
| 278 | Ga0501070_0138920 | 3300049586 | Bacteria | 2006 |
| 279 | Ga0501075_0117704 | 3300049591 | Bacteria | 2020 |
| 280 | Ga0501075_0268740 | 3300049591 | Bacteria | 1300 |
| 281 | Ga0501077_0282097 | 3300049593 | Bacteria | 1057 |
| 282 | Ga0501079_0294289 | 3300049741 | Bacteria | 1270 |
| 283 | Ga0501080_0177834 | 3300049742 | Bacteria | 1960 |
| 284 | Ga0501081_0148887 | 3300049743 | Bacteria | 1681 |
| 285 | Ga0501035_0264764 | 3300049822 | Bacteria | 1456 |
| 286 | Ga0501035_0816229 | 3300049822 | Bacteria | 744 |
| 287 | Ga0501044_0017277 | 3300049823 | Bacteria | 7738 |
| 288 | Ga0501044_0020472 | 3300049823 | Bacteria | 7064 |
| 289 | Ga0501044_0053217 | 3300049823 | Bacteria | 4166 |
| 290 | Ga0501044_0398091 | 3300049823 | Bacteria | 1290 |
| 291 | nmdc:mga0yw44_292837_c1 | 3300050492 | Bacteria | 1090 |
| 292 | nmdc:mga0k408_11282_c1 | 3300050493 | Bacteria | 4860 |
| 293 | nmdc:mga0k408_39302_c1 | 3300050493 | Bacteria | 2717 |
| 294 | nmdc:mga0k408_88940_c1 | 3300050493 | Bacteria | 1813 |
| 295 | nmdc:mga06z11_245606_c1 | 3300050494 | Bacteria | 1052 |
| 296 | nmdc:mga07m45_468321_c1 | 3300050496 | Bacteria | 730 |
| 297 | nmdc:mga08y16_108551_c1 | 3300050511 | Bacteria | 2889 |
| 298 | nmdc:mga08y16_40606_c1 | 3300050511 | Bacteria | 4875 |
| 299 | nmdc:mga08y16_77844_c1 | 3300050511 | Bacteria | 3457 |
| 300 | nmdc:mga0n895_179119_c1 | 3300050512 | Bacteria | 2151 |
| 301 | nmdc:mga0n895_434955_c1 | 3300050512 | Bacteria | 1325 |
| 302 | nmdc:mga0n895_99800_c1 | 3300050512 | Bacteria | 2912 |
| 303 | nmdc:mga0a205_13177_c1 | 3300050515 | Bacteria | 6670 |
| 304 | nmdc:mga0a205_332744_c1 | 3300050515 | Bacteria | 1388 |
| 305 | Ga0495601_0050137 | 3300053077 | Bacteria | 2632 |
| 306 | Ga0495595_0115474 | 3300053084 | Bacteria | 1304 |
| 307 | Ga0500577_0000103 | 3300053142 | Bacteria | 20439 |
| 308 | Ga0500625_160333 | 3300053729 | Bacteria | 828 |
| 309 | Ga0466962_0279731 | 3300061719 | Bacteria | 823 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0324047 | Ga0501069_0324047_348_881 | 176 |
| 2 | 3300049572 | Ga0501036_0549059 | Ga0501036_0549059_44_592 | 182 |
| 3 | 3300049575 | Ga0501039_0225174 | Ga0501039_0225174_32_586 | 183 |
| 4 | 3300050496 | nmdc:mga07m45_468321_c1 | nmdc:mga07m45_468321_c1_150_704 | 183 |
| 5 | 3300035083 | Ga0373926_0147937 | Ga0373926_0147937_22_582 | 185 |
| 6 | 3300037466 | Ga0395898_0195966 | Ga0395898_0195966_19_609 | 195 |
| 7 | 3300044842 | Ga0466957_0810968 | Ga0466957_0810968_10_600 | 195 |
| 8 | 3300046557 | Ga0495622_0280262 | Ga0495622_0280262_14_607 | 195 |
| 9 | 3300048917 | Ga0496114_0556956 | Ga0496114_0556956_14_604 | 195 |
| 10 | 3300049582 | Ga0501048_0244360 | Ga0501048_0244360_25_615 | 195 |
| 11 | 3300005347 | Ga0070668_100911472 | Ga0070668_1009114721 | 206 |
| 12 | 3300046528 | Ga0495642_0079178 | Ga0495642_0079178_239_901 | 207 |
| 13 | 3300037853 | Ga0436364_1420335 | Ga0436364_1420335_1465_2097 | 209 |
| 14 | iso_pu_bacteria | 2881861095 | 2881866829 | 211 |
| 15 | iso_pu_bacteria | 2924784321 | 2924789208 | 211 |
| 16 | 3300007265 | Ga0099794_10169612 | Ga0099794_101696122 | 212 |
| 17 | 3300013306 | Ga0163162_10639574 | Ga0163162_106395742 | 212 |
| 18 | 3300035116 | Ga0373945_0062564 | Ga0373945_0062564_578_1216 | 212 |
| 19 | 3300035691 | Ga0373931_0437627 | Ga0373931_0437627_13_654 | 212 |
| 20 | 3300035724 | Ga0373933_0116302 | Ga0373933_0116302_1023_1661 | 212 |
| 21 | 3300049570 | Ga0501033_0139170 | Ga0501033_0139170_307_948 | 212 |
| 22 | 3300049572 | Ga0501036_0379891 | Ga0501036_0379891_17_655 | 212 |
| 23 | 3300007265 | Ga0099794_10140065 | Ga0099794_101400652 | 213 |
| 24 | iso_pu_bacteria | 2508501128 | 2509151711 | 214 |
| 25 | iso_pu_bacteria | 2510065019 | 2510133874 | 215 |
| 26 | iso_pu_bacteria | 2513237084 | 2513573651 | 215 |
| 27 | iso_pu_bacteria | 2513237093 | 2513629479 | 215 |
| 28 | iso_pu_bacteria | 2513237101 | 2513692210 | 215 |
| 29 | iso_pu_bacteria | 2517093000 | 2517095753 | 215 |
| 30 | iso_pu_bacteria | 2517287029 | 2517407318 | 215 |
| 31 | iso_pu_bacteria | 2724679232 | 2725952641 | 215 |
| 32 | iso_pu_bacteria | 2856356410 | 2856360460 | 215 |
| 33 | iso_pu_bacteria | 2885192300 | 2885192555 | 215 |
| 34 | iso_pu_bacteria | 2936367885 | 2936372125 | 215 |
| 35 | iso_pu_bacteria | 2936375103 | 2936381071 | 215 |
| 36 | iso_pu_bacteria | 8005376324 | 8005380845 | 215 |
| 37 | iso_pu_bacteria | 8005563573 | 8005567908 | 215 |
| 38 | iso_pu_bacteria | 8024479707 | 8024482949 | 215 |
| 39 | 3300005844 | Ga0068862_100446355 | Ga0068862_1004463552 | 216 |
| 40 | 3300006178 | Ga0075367_10232684 | Ga0075367_102326842 | 216 |
| 41 | 3300006195 | Ga0075366_10082806 | Ga0075366_100828063 | 216 |
| 42 | 3300009553 | Ga0105249_10160733 | Ga0105249_101607333 | 216 |
| 43 | 3300025907 | Ga0207645_10231622 | Ga0207645_102316222 | 216 |
| 44 | 3300025935 | Ga0207709_10311070 | Ga0207709_103110702 | 216 |
| 45 | 3300025961 | Ga0207712_10129893 | Ga0207712_101298933 | 216 |
| 46 | 3300028380 | Ga0268265_10503757 | Ga0268265_105037572 | 216 |
| 47 | 3300031548 | Ga0307408_100664339 | Ga0307408_1006643392 | 216 |
| 48 | 3300050494 | nmdc:mga06z11_245606_c1 | nmdc:mga06z11_245606_c1_277_933 | 216 |
| 49 | 3300005445 | Ga0070708_100013114 | Ga0070708_1000131148 | 217 |
| 50 | 3300005445 | Ga0070708_100354510 | Ga0070708_1003545102 | 217 |
| 51 | 3300005518 | Ga0070699_100093645 | Ga0070699_1000936452 | 217 |
| 52 | 3300005518 | Ga0070699_100219116 | Ga0070699_1002191163 | 217 |
| 53 | 3300005546 | Ga0070696_100066189 | Ga0070696_1000661892 | 217 |
| 54 | 3300005549 | Ga0070704_100203707 | Ga0070704_1002037073 | 217 |
| 55 | 3300005614 | Ga0068856_100032045 | Ga0068856_1000320452 | 217 |
| 56 | 3300006195 | Ga0075366_10012090 | Ga0075366_100120905 | 217 |
| 57 | 3300006844 | Ga0075428_100456882 | Ga0075428_1004568822 | 217 |
| 58 | 3300006852 | Ga0075433_10629685 | Ga0075433_106296852 | 217 |
| 59 | 3300007076 | Ga0075435_100284802 | Ga0075435_1002848022 | 217 |
| 60 | 3300009177 | Ga0105248_10248101 | Ga0105248_102481013 | 217 |
| 61 | 3300014497 | Ga0182008_10008948 | Ga0182008_100089485 | 217 |
| 62 | 3300014968 | Ga0157379_10025417 | Ga0157379_100254173 | 217 |
| 63 | 3300015262 | Ga0182007_10015781 | Ga0182007_100157813 | 217 |
| 64 | 3300015683 | Ga0183362_10001 | Ga0183362_100011211 | 217 |
| 65 | 3300025910 | Ga0207684_10016995 | Ga0207684_100169956 | 217 |
| 66 | 3300025910 | Ga0207684_10644960 | Ga0207684_106449602 | 217 |
| 67 | 3300025922 | Ga0207646_10292998 | Ga0207646_102929981 | 217 |
| 68 | 3300026078 | Ga0207702_10043097 | Ga0207702_100430975 | 217 |
| 69 | 3300026121 | Ga0207683_10303009 | Ga0207683_103030092 | 217 |
| 70 | 3300028794 | Ga0307515_10000291 | Ga0307515_1000029175 | 217 |
| 71 | 3300028794 | Ga0307515_10215205 | Ga0307515_102152051 | 217 |
| 72 | 3300031239 | Ga0265328_10000986 | Ga0265328_100009866 | 217 |
| 73 | 3300031712 | Ga0265342_10222980 | Ga0265342_102229802 | 217 |
| 74 | 3300036401 | Ga0373937_0083135 | Ga0373937_0083135_308_967 | 217 |
| 75 | 3300041413 | Ga0439465_0002658 | Ga0439465_0002658_3682_4344 | 217 |
| 76 | 3300041997 | Ga0439431_0000244 | Ga0439431_0000244_333_995 | 217 |
| 77 | 3300041999 | Ga0439433_0005976 | Ga0439433_0005976_288_950 | 217 |
| 78 | 3300042002 | Ga0439442_002325 | Ga0439442_002325_2779_3441 | 217 |
| 79 | 3300042004 | Ga0439445_0001130 | Ga0439445_0001130_1212_1874 | 217 |
| 80 | 3300042006 | Ga0439432_000895 | Ga0439432_000895_6373_7035 | 217 |
| 81 | 3300042007 | Ga0439449_0000162 | Ga0439449_0000162_20631_21293 | 217 |
| 82 | 3300042010 | Ga0439452_001519 | Ga0439452_001519_2918_3580 | 217 |
| 83 | 3300042015 | Ga0439462_0003521 | Ga0439462_0003521_1371_2033 | 217 |
| 84 | 3300042435 | Ga0439434_0004193 | Ga0439434_0004193_414_1076 | 217 |
| 85 | 3300042876 | Ga0451577_0164023 | Ga0451577_0164023_509_1168 | 217 |
| 86 | 3300044673 | Ga0453683_0221784 | Ga0453683_0221784_119_772 | 217 |
| 87 | 3300046809 | Ga0495600_0202023 | Ga0495600_0202023_216_902 | 217 |
| 88 | 3300047472 | Ga0495686_0021343 | Ga0495686_0021343_2828_3499 | 217 |
| 89 | 3300048911 | Ga0496108_0332444 | Ga0496108_0332444_333_995 | 217 |
| 90 | 3300049576 | Ga0501040_0032935 | Ga0501040_0032935_2249_2902 | 217 |
| 91 | 3300049578 | Ga0501042_0419440 | Ga0501042_0419440_213_866 | 217 |
| 92 | 3300049591 | Ga0501075_0117704 | Ga0501075_0117704_852_1505 | 217 |
| 93 | 3300049741 | Ga0501079_0294289 | Ga0501079_0294289_62_715 | 217 |
| 94 | 3300049743 | Ga0501081_0148887 | Ga0501081_0148887_858_1511 | 217 |
| 95 | 3300049823 | Ga0501044_0398091 | Ga0501044_0398091_292_948 | 217 |
| 96 | 3300050493 | nmdc:mga0k408_11282_c1 | nmdc:mga0k408_11282_c1_1343_2005 | 217 |
| 97 | 3300050515 | nmdc:mga0a205_332744_c1 | nmdc:mga0a205_332744_c1_691_1347 | 217 |
| 98 | 3300053729 | Ga0500625_160333 | Ga0500625_160333_18_683 | 217 |
| 99 | 3300005329 | Ga0070683_100001608 | Ga0070683_1000016089 | 218 |
| 100 | 3300005329 | Ga0070683_100015944 | Ga0070683_1000159443 | 218 |
| 101 | 3300005336 | Ga0070680_100056092 | Ga0070680_1000560924 | 218 |
| 102 | 3300005336 | Ga0070680_100069534 | Ga0070680_1000695342 | 218 |
| 103 | 3300005336 | Ga0070680_100134866 | Ga0070680_1001348663 | 218 |
| 104 | 3300005336 | Ga0070680_101041030 | Ga0070680_1010410301 | 218 |
| 105 | 3300005337 | Ga0070682_100102011 | Ga0070682_1001020113 | 218 |
| 106 | 3300005339 | Ga0070660_100040560 | Ga0070660_1000405605 | 218 |
| 107 | 3300005347 | Ga0070668_100377450 | Ga0070668_1003774502 | 218 |
| 108 | 3300005366 | Ga0070659_100146871 | Ga0070659_1001468711 | 218 |
| 109 | 3300005434 | Ga0070709_10015246 | Ga0070709_100152462 | 218 |
| 110 | 3300005435 | Ga0070714_100502743 | Ga0070714_1005027432 | 218 |
| 111 | 3300005436 | Ga0070713_100063046 | Ga0070713_1000630464 | 218 |
| 112 | 3300005437 | Ga0070710_10019648 | Ga0070710_100196483 | 218 |
| 113 | 3300005457 | Ga0070662_100028313 | Ga0070662_1000283132 | 218 |
| 114 | 3300005458 | Ga0070681_10017891 | Ga0070681_100178913 | 218 |
| 115 | 3300005458 | Ga0070681_10053558 | Ga0070681_100535585 | 218 |
| 116 | 3300005458 | Ga0070681_10225318 | Ga0070681_102253182 | 218 |
| 117 | 3300005458 | Ga0070681_10283441 | Ga0070681_102834412 | 218 |
| 118 | 3300005471 | Ga0070698_100952125 | Ga0070698_1009521251 | 218 |
| 119 | 3300005530 | Ga0070679_100011783 | Ga0070679_1000117831 | 218 |
| 120 | 3300005530 | Ga0070679_100221158 | Ga0070679_1002211582 | 218 |
| 121 | 3300005530 | Ga0070679_100670366 | Ga0070679_1006703662 | 218 |
| 122 | 3300005535 | Ga0070684_100007537 | Ga0070684_1000075375 | 218 |
| 123 | 3300005539 | Ga0068853_100281599 | Ga0068853_1002815993 | 218 |
| 124 | 3300005546 | Ga0070696_100262068 | Ga0070696_1002620682 | 218 |
| 125 | 3300005563 | Ga0068855_100180461 | Ga0068855_1001804613 | 218 |
| 126 | 3300005563 | Ga0068855_101084421 | Ga0068855_1010844212 | 218 |
| 127 | 3300005563 | Ga0068855_101102423 | Ga0068855_1011024232 | 218 |
| 128 | 3300005564 | Ga0070664_100041947 | Ga0070664_1000419476 | 218 |
| 129 | 3300005577 | Ga0068857_100216143 | Ga0068857_1002161433 | 218 |
| 130 | 3300005981 | Ga0081538_10005426 | Ga0081538_1000542611 | 218 |
| 131 | 3300006028 | Ga0070717_10819573 | Ga0070717_108195732 | 218 |
| 132 | 3300006038 | Ga0075365_10013262 | Ga0075365_100132625 | 218 |
| 133 | 3300006048 | Ga0075363_100012491 | Ga0075363_1000124912 | 218 |
| 134 | 3300006173 | Ga0070716_100035211 | Ga0070716_1000352114 | 218 |
| 135 | 3300006177 | Ga0075362_10027315 | Ga0075362_100273152 | 218 |
| 136 | 3300006195 | Ga0075366_10043820 | Ga0075366_100438204 | 218 |
| 137 | 3300006852 | Ga0075433_10061418 | Ga0075433_100614184 | 218 |
| 138 | 3300006871 | Ga0075434_100008357 | Ga0075434_1000083573 | 218 |
| 139 | 3300006871 | Ga0075434_100068375 | Ga0075434_1000683752 | 218 |
| 140 | 3300006871 | Ga0075434_100095903 | Ga0075434_1000959033 | 218 |
| 141 | 3300007076 | Ga0075435_100118501 | Ga0075435_1001185013 | 218 |
| 142 | 3300009093 | Ga0105240_10638871 | Ga0105240_106388712 | 218 |
| 143 | 3300009094 | Ga0111539_10012470 | Ga0111539_100124709 | 218 |
| 144 | 3300009094 | Ga0111539_10043093 | Ga0111539_100430934 | 218 |
| 145 | 3300009094 | Ga0111539_10138316 | Ga0111539_101383163 | 218 |
| 146 | 3300009176 | Ga0105242_10250740 | Ga0105242_102507402 | 218 |
| 147 | 3300009177 | Ga0105248_10879327 | Ga0105248_108793272 | 218 |
| 148 | 3300009551 | Ga0105238_10367370 | Ga0105238_103673702 | 218 |
| 149 | 3300009551 | Ga0105238_10484839 | Ga0105238_104848392 | 218 |
| 150 | 3300010375 | Ga0105239_10181054 | Ga0105239_101810542 | 218 |
| 151 | 3300013102 | Ga0157371_10256091 | Ga0157371_102560912 | 218 |
| 152 | 3300013104 | Ga0157370_10201241 | Ga0157370_102012412 | 218 |
| 153 | 3300013105 | Ga0157369_10010521 | Ga0157369_1001052110 | 218 |
| 154 | 3300013105 | Ga0157369_10017675 | Ga0157369_100176755 | 218 |
| 155 | 3300013307 | Ga0157372_10522658 | Ga0157372_105226582 | 218 |
| 156 | 3300013308 | Ga0157375_10292035 | Ga0157375_102920351 | 218 |
| 157 | 3300013308 | Ga0157375_10420863 | Ga0157375_104208632 | 218 |
| 158 | 3300020070 | Ga0206356_10188264 | Ga0206356_101882642 | 218 |
| 159 | 3300020081 | Ga0206354_10605015 | Ga0206354_106050152 | 218 |
| 160 | 3300020082 | Ga0206353_10571089 | Ga0206353_105710892 | 218 |
| 161 | 3300021384 | Ga0213876_10062569 | Ga0213876_100625692 | 218 |
| 162 | 3300021384 | Ga0213876_10134337 | Ga0213876_101343371 | 218 |
| 163 | 3300022467 | Ga0224712_10032637 | Ga0224712_100326372 | 218 |
| 164 | 3300022467 | Ga0224712_10073835 | Ga0224712_100738351 | 218 |
| 165 | 3300025898 | Ga0207692_10010022 | Ga0207692_100100225 | 218 |
| 166 | 3300025906 | Ga0207699_10167177 | Ga0207699_101671772 | 218 |
| 167 | 3300025912 | Ga0207707_10000413 | Ga0207707_100004136 | 218 |
| 168 | 3300025913 | Ga0207695_10345096 | Ga0207695_103450962 | 218 |
| 169 | 3300025917 | Ga0207660_10046798 | Ga0207660_100467984 | 218 |
| 170 | 3300025917 | Ga0207660_10147019 | Ga0207660_101470192 | 218 |
| 171 | 3300025918 | Ga0207662_10514564 | Ga0207662_105145642 | 218 |
| 172 | 3300025919 | Ga0207657_10122597 | Ga0207657_101225972 | 218 |
| 173 | 3300025921 | Ga0207652_10011754 | Ga0207652_100117549 | 218 |
| 174 | 3300025921 | Ga0207652_10148643 | Ga0207652_101486433 | 218 |
| 175 | 3300025924 | Ga0207694_10343681 | Ga0207694_103436812 | 218 |
| 176 | 3300025924 | Ga0207694_10489469 | Ga0207694_104894692 | 218 |
| 177 | 3300025928 | Ga0207700_10043098 | Ga0207700_100430982 | 218 |
| 178 | 3300025928 | Ga0207700_10049400 | Ga0207700_100494004 | 218 |
| 179 | 3300025929 | Ga0207664_10002993 | Ga0207664_1000299310 | 218 |
| 180 | 3300025929 | Ga0207664_10404872 | Ga0207664_104048722 | 218 |
| 181 | 3300025932 | Ga0207690_10310574 | Ga0207690_103105741 | 218 |
| 182 | 3300025933 | Ga0207706_10030364 | Ga0207706_100303645 | 218 |
| 183 | 3300025944 | Ga0207661_10000177 | Ga0207661_100001777 | 218 |
| 184 | 3300025945 | Ga0207679_10055630 | Ga0207679_100556302 | 218 |
| 185 | 3300025949 | Ga0207667_10152549 | Ga0207667_101525493 | 218 |
| 186 | 3300026067 | Ga0207678_10023718 | Ga0207678_100237185 | 218 |
| 187 | 3300026116 | Ga0207674_10040678 | Ga0207674_100406785 | 218 |
| 188 | 3300027907 | Ga0207428_10133019 | Ga0207428_101330192 | 218 |
| 189 | 3300031241 | Ga0265325_10045164 | Ga0265325_100451642 | 218 |
| 190 | 3300031241 | Ga0265325_10052799 | Ga0265325_100527993 | 218 |
| 191 | 3300031247 | Ga0265340_10016673 | Ga0265340_100166733 | 218 |
| 192 | 3300031247 | Ga0265340_10031039 | Ga0265340_100310393 | 218 |
| 193 | 3300031249 | Ga0265339_10009983 | Ga0265339_100099832 | 218 |
| 194 | 3300031249 | Ga0265339_10024316 | Ga0265339_100243163 | 218 |
| 195 | 3300031344 | Ga0265316_10232559 | Ga0265316_102325593 | 218 |
| 196 | 3300031595 | Ga0265313_10010025 | Ga0265313_100100257 | 218 |
| 197 | 3300031595 | Ga0265313_10039445 | Ga0265313_100394452 | 218 |
| 198 | 3300031595 | Ga0265313_10047456 | Ga0265313_100474562 | 218 |
| 199 | 3300031595 | Ga0265313_10158294 | Ga0265313_101582942 | 218 |
| 200 | 3300031711 | Ga0265314_10054403 | Ga0265314_100544033 | 218 |
| 201 | 3300031712 | Ga0265342_10015210 | Ga0265342_100152103 | 218 |
| 202 | 3300031712 | Ga0265342_10067980 | Ga0265342_100679803 | 218 |
| 203 | 3300031712 | Ga0265342_10091579 | Ga0265342_100915792 | 218 |
| 204 | 3300032133 | Ga0316583_10181979 | Ga0316583_101819791 | 218 |
| 205 | 3300035086 | Ga0373934_0228826 | Ga0373934_0228826_12_668 | 218 |
| 206 | 3300035113 | Ga0373936_0116242 | Ga0373936_0116242_163_822 | 218 |
| 207 | 3300035120 | Ga0373957_0009174 | Ga0373957_0009174_2180_2836 | 218 |
| 208 | 3300035410 | Ga0373924_0067534 | Ga0373924_0067534_731_1387 | 218 |
| 209 | 3300035691 | Ga0373931_0350261 | Ga0373931_0350261_58_717 | 218 |
| 210 | 3300035692 | Ga0373935_0010830 | Ga0373935_0010830_4222_4878 | 218 |
| 211 | 3300035692 | Ga0373935_0246917 | Ga0373935_0246917_430_1086 | 218 |
| 212 | 3300035725 | Ga0373947_0043394 | Ga0373947_0043394_45_707 | 218 |
| 213 | 3300035725 | Ga0373947_0146513 | Ga0373947_0146513_705_1361 | 218 |
| 214 | 3300036401 | Ga0373937_0016847 | Ga0373937_0016847_4255_4911 | 218 |
| 215 | 3300036401 | Ga0373937_0022898 | Ga0373937_0022898_3309_3965 | 218 |
| 216 | 3300037068 | Ga0373925_0013070 | Ga0373925_0013070_429_1091 | 218 |
| 217 | 3300037068 | Ga0373925_0167077 | Ga0373925_0167077_1037_1696 | 218 |
| 218 | 3300037068 | Ga0373925_0294457 | Ga0373925_0294457_541_1197 | 218 |
| 219 | 3300037418 | Ga0395900_0120747 | Ga0395900_0120747_1250_1909 | 218 |
| 220 | 3300037853 | Ga0436364_1270533 | Ga0436364_1270533_571_1230 | 218 |
| 221 | 3300037853 | Ga0436364_1537052 | Ga0436364_1537052_246_902 | 218 |
| 222 | 3300039437 | Ga0436365_0605320 | Ga0436365_0605320_2611_3267 | 218 |
| 223 | 3300039437 | Ga0436365_1147128 | Ga0436365_1147128_586_1245 | 218 |
| 224 | 3300039437 | Ga0436365_1524489 | Ga0436365_1524489_217_876 | 218 |
| 225 | 3300039450 | Ga0436363_0522951 | Ga0436363_0522951_704_1363 | 218 |
| 226 | 3300039453 | Ga0436362_0502477 | Ga0436362_0502477_192_851 | 218 |
| 227 | 3300044684 | Ga0466966_0227713 | Ga0466966_0227713_216_875 | 218 |
| 228 | 3300044693 | Ga0466961_0106467 | Ga0466961_0106467_553_1212 | 218 |
| 229 | 3300044694 | Ga0466963_0228257 | Ga0466963_0228257_19_678 | 218 |
| 230 | 3300044694 | Ga0466963_0300055 | Ga0466963_0300055_366_1025 | 218 |
| 231 | 3300044719 | Ga0466971_0011780 | Ga0466971_0011780_136_795 | 218 |
| 232 | 3300044765 | Ga0466970_0286897 | Ga0466970_0286897_38_697 | 218 |
| 233 | 3300044842 | Ga0466957_0143727 | Ga0466957_0143727_287_946 | 218 |
| 234 | 3300045049 | Ga0466959_0053628 | Ga0466959_0053628_756_1415 | 218 |
| 235 | 3300045051 | Ga0451576_0893213 | Ga0451576_0893213_92_751 | 218 |
| 236 | 3300045836 | Ga0466958_0046372 | Ga0466958_0046372_163_822 | 218 |
| 237 | 3300045976 | Ga0466967_0044754 | Ga0466967_0044754_2851_3510 | 218 |
| 238 | 3300045976 | Ga0466967_0126553 | Ga0466967_0126553_895_1554 | 218 |
| 239 | 3300045976 | Ga0466967_0686751 | Ga0466967_0686751_86_742 | 218 |
| 240 | 3300046454 | Ga0495592_0041802 | Ga0495592_0041802_553_1209 | 218 |
| 241 | 3300046459 | Ga0495629_0091006 | Ga0495629_0091006_768_1424 | 218 |
| 242 | 3300046460 | Ga0495638_0045888 | Ga0495638_0045888_1216_1872 | 218 |
| 243 | 3300046462 | Ga0495651_0047311 | Ga0495651_0047311_1239_1895 | 218 |
| 244 | 3300046473 | Ga0495582_0050281 | Ga0495582_0050281_1002_1664 | 218 |
| 245 | 3300046476 | Ga0495662_0007417 | Ga0495662_0007417_693_1349 | 218 |
| 246 | 3300046491 | Ga0495584_0028056 | Ga0495584_0028056_1189_1845 | 218 |
| 247 | 3300046491 | Ga0495584_0050245 | Ga0495584_0050245_1402_2058 | 218 |
| 248 | 3300046514 | Ga0495618_0204362 | Ga0495618_0204362_47_703 | 218 |
| 249 | 3300046516 | Ga0495628_0066760 | Ga0495628_0066760_118_774 | 218 |
| 250 | 3300046520 | Ga0495637_0041715 | Ga0495637_0041715_336_992 | 218 |
| 251 | 3300046533 | Ga0495640_0011046 | Ga0495640_0011046_4392_5048 | 218 |
| 252 | 3300046533 | Ga0495640_0198273 | Ga0495640_0198273_293_949 | 218 |
| 253 | 3300046543 | Ga0495645_0087256 | Ga0495645_0087256_201_857 | 218 |
| 254 | 3300046642 | Ga0495634_0128684 | Ga0495634_0128684_895_1551 | 218 |
| 255 | 3300046675 | Ga0495657_0238619 | Ga0495657_0238619_47_703 | 218 |
| 256 | 3300046678 | Ga0495599_0115237 | Ga0495599_0115237_613_1269 | 218 |
| 257 | 3300046679 | Ga0495623_0016779 | Ga0495623_0016779_3149_3805 | 218 |
| 258 | 3300046680 | Ga0495646_0028099 | Ga0495646_0028099_667_1323 | 218 |
| 259 | 3300046689 | Ga0495613_0387472 | Ga0495613_0387472_167_829 | 218 |
| 260 | 3300046690 | Ga0495624_0180477 | Ga0495624_0180477_544_1200 | 218 |
| 261 | 3300046809 | Ga0495600_0066789 | Ga0495600_0066789_382_1038 | 218 |
| 262 | 3300047317 | Ga0495604_0315279 | Ga0495604_0315279_76_732 | 218 |
| 263 | 3300047319 | Ga0495674_0092416 | Ga0495674_0092416_323_979 | 218 |
| 264 | 3300047322 | Ga0495680_0267247 | Ga0495680_0267247_473_1129 | 218 |
| 265 | 3300047444 | Ga0495675_0048710 | Ga0495675_0048710_1357_2013 | 218 |
| 266 | 3300048903 | Ga0496100_0288082 | Ga0496100_0288082_13_669 | 218 |
| 267 | 3300048906 | Ga0496103_0062306 | Ga0496103_0062306_1531_2187 | 218 |
| 268 | 3300048907 | Ga0496104_0124981 | Ga0496104_0124981_1536_2192 | 218 |
| 269 | 3300048907 | Ga0496104_0786859 | Ga0496104_0786859_135_794 | 218 |
| 270 | 3300048908 | Ga0496105_0087983 | Ga0496105_0087983_275_931 | 218 |
| 271 | 3300048910 | Ga0496107_0381731 | Ga0496107_0381731_132_788 | 218 |
| 272 | 3300048911 | Ga0496108_0036378 | Ga0496108_0036378_3151_3807 | 218 |
| 273 | 3300048912 | Ga0496109_0137408 | Ga0496109_0137408_164_823 | 218 |
| 274 | 3300048914 | Ga0496111_0239636 | Ga0496111_0239636_292_951 | 218 |
| 275 | 3300048915 | Ga0496112_0084073 | Ga0496112_0084073_152_811 | 218 |
| 276 | 3300048918 | Ga0496115_0430918 | Ga0496115_0430918_147_803 | 218 |
| 277 | 3300049571 | Ga0501034_0000621 | Ga0501034_0000621_8665_9339 | 218 |
| 278 | 3300049572 | Ga0501036_0111288 | Ga0501036_0111288_243_902 | 218 |
| 279 | 3300049573 | Ga0501037_0095236 | Ga0501037_0095236_804_1463 | 218 |
| 280 | 3300049574 | Ga0501038_0223595 | Ga0501038_0223595_82_741 | 218 |
| 281 | 3300049574 | Ga0501038_0356431 | Ga0501038_0356431_192_848 | 218 |
| 282 | 3300049579 | Ga0501043_0233243 | Ga0501043_0233243_227_886 | 218 |
| 283 | 3300049580 | Ga0501046_0219410 | Ga0501046_0219410_701_1360 | 218 |
| 284 | 3300049581 | Ga0501047_0670544 | Ga0501047_0670544_85_744 | 218 |
| 285 | 3300049583 | Ga0501067_0095827 | Ga0501067_0095827_410_1069 | 218 |
| 286 | 3300049584 | Ga0501068_0009667 | Ga0501068_0009667_3330_4004 | 218 |
| 287 | 3300049584 | Ga0501068_0106589 | Ga0501068_0106589_249_905 | 218 |
| 288 | 3300049585 | Ga0501069_0046905 | Ga0501069_0046905_1334_1990 | 218 |
| 289 | 3300049586 | Ga0501070_0138920 | Ga0501070_0138920_834_1493 | 218 |
| 290 | 3300049591 | Ga0501075_0268740 | Ga0501075_0268740_626_1282 | 218 |
| 291 | 3300049593 | Ga0501077_0282097 | Ga0501077_0282097_358_1017 | 218 |
| 292 | 3300049742 | Ga0501080_0177834 | Ga0501080_0177834_327_986 | 218 |
| 293 | 3300049822 | Ga0501035_0264764 | Ga0501035_0264764_445_1104 | 218 |
| 294 | 3300049822 | Ga0501035_0816229 | Ga0501035_0816229_50_706 | 218 |
| 295 | 3300049823 | Ga0501044_0017277 | Ga0501044_0017277_692_1351 | 218 |
| 296 | 3300049823 | Ga0501044_0020472 | Ga0501044_0020472_580_1254 | 218 |
| 297 | 3300049823 | Ga0501044_0053217 | Ga0501044_0053217_2982_3641 | 218 |
| 298 | 3300050492 | nmdc:mga0yw44_292837_c1 | nmdc:mga0yw44_292837_c1_248_907 | 218 |
| 299 | 3300050493 | nmdc:mga0k408_39302_c1 | nmdc:mga0k408_39302_c1_1874_2533 | 218 |
| 300 | 3300050511 | nmdc:mga08y16_108551_c1 | nmdc:mga08y16_108551_c1_646_1350 | 218 |
| 301 | 3300050511 | nmdc:mga08y16_40606_c1 | nmdc:mga08y16_40606_c1_1709_2365 | 218 |
| 302 | 3300050511 | nmdc:mga08y16_77844_c1 | nmdc:mga08y16_77844_c1_1271_1927 | 218 |
| 303 | 3300050512 | nmdc:mga0n895_179119_c1 | nmdc:mga0n895_179119_c1_1063_1719 | 218 |
| 304 | 3300050512 | nmdc:mga0n895_434955_c1 | nmdc:mga0n895_434955_c1_178_837 | 218 |
| 305 | 3300050512 | nmdc:mga0n895_99800_c1 | nmdc:mga0n895_99800_c1_1039_1695 | 218 |
| 306 | 3300050515 | nmdc:mga0a205_13177_c1 | nmdc:mga0a205_13177_c1_3110_3766 | 218 |
| 307 | 3300053077 | Ga0495601_0050137 | Ga0495601_0050137_1527_2183 | 218 |
| 308 | 3300053084 | Ga0495595_0115474 | Ga0495595_0115474_205_861 | 218 |
| 309 | 3300053142 | Ga0500577_0000103 | Ga0500577_0000103_13964_14626 | 218 |
| 310 | 3300061719 | Ga0466962_0279731 | Ga0466962_0279731_11_670 | 218 |
| 311 | 3300002774 | JGI25150J39212_1026819 | JGI25150J39212_10268192 | 219 |
| 312 | 3300003215 | JGI25153J46596_10012635 | JGI25153J46596_100126353 | 219 |
| 313 | 3300003320 | rootH2_10146089 | rootH2_101460892 | 219 |
| 314 | 3300005435 | Ga0070714_100060015 | Ga0070714_1000600152 | 219 |
| 315 | 3300005435 | Ga0070714_100936044 | Ga0070714_1009360441 | 219 |
| 316 | 3300005436 | Ga0070713_100022472 | Ga0070713_1000224723 | 219 |
| 317 | 3300006195 | Ga0075366_10127064 | Ga0075366_101270642 | 219 |
| 318 | 3300009174 | Ga0105241_10270998 | Ga0105241_102709982 | 219 |
| 319 | 3300009765 | Ga0123341_1000032 | Ga0123341_100003228 | 219 |
| 320 | 3300025898 | Ga0207692_10198697 | Ga0207692_101986972 | 219 |
| 321 | 3300025928 | Ga0207700_10015504 | Ga0207700_100155043 | 219 |
| 322 | 3300025929 | Ga0207664_10093993 | Ga0207664_100939932 | 219 |
| 323 | 3300035695 | Ga0373927_0284529 | Ga0373927_0284529_321_992 | 219 |
| 324 | 3300041512 | Ga0451853_1152098 | Ga0451853_1152098_577_1236 | 219 |
| 325 | 3300048918 | Ga0496115_0554840 | Ga0496115_0554840_89_751 | 219 |
| 326 | 3300050493 | nmdc:mga0k408_88940_c1 | nmdc:mga0k408_88940_c1_549_1208 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qxe-assembly3.cif.gz_F | crystal structure of co-type nitrile hydratase from pseudomonas putida. | 0.9114 | 1 | 219 |
| 3qyg-assembly4.cif.gz_H | crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. | 0.9108 | 1 | 219 |
| 3qyh-assembly2.cif.gz_D | crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida. | 0.9048 | 1 | 219 |
| 3qz9-assembly4.cif.gz_H | crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. | 0.9037 | 1 | 219 |
| 1v29-assembly1.cif.gz_B-2 | crystal structure of nitrile hydratase from a thermophile bacillus smithii | 0.8605 | 1 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ob3B02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9429 | 123 | 218 | 2.30.30.50 |
| 3hhtB02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9406 | 124 | 219 | 2.30.30.50 |
| 3qxeB02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9325 | 124 | 219 | 2.30.30.50 |
| 3hhtB02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9219 | 124 | 219 | 2.30.30.50 |
| 3qxeB02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9057 | 124 | 219 | 2.30.30.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0JMP0-F1-model_v4 | Nitrile hydratase subunit beta | 0.9544 | 20 | 93 |
|
| AF-A0A527ZDG4-F1-model_v4 | Nitrile hydratase subunit beta | 0.9501 | 153 | 219 |
|
| AF-A0A1Q7BLX7-F1-model_v4 | Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) | 0.9447 | 1 | 219 |
GO:0046914
GO:0080109 |
| AF-A0A7Y0KKE5-F1-model_v4 | Nitrile hydratase subunit beta | 0.9409 | 132 | 219 |
|
| AF-A0A1Q7BLX7-F1-model_v4 | Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) | 0.9406 | 1 | 219 |
GO:0046914
GO:0080109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar