F408554

General Info

Members Datasets Scaffolds Average Seq Length
326 235 309 218

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_108551_c1|nmdc:mga08y16_108551_c1_646_1350
Length 234
Sequence LHDRHGLAADAGKGDTVNGVHDMGGMHGFGKVAPDADERPFHATWEARVLAMQRAIRFARAWNIDMSRDAIERQPPQRYLAASYYERWLMGMETSAVEKGLIDPDEIAAGHALRPGKSVARVMTKDDLGRPFTRGSFSRPPGHEARFKPGDRVRTKNINPATHTRLPRYARGREGLVEAVRGCHVFPDSVVTGHGEDPQWLYTVVFNGRQLWGANADPTLTVSIEAFEPYLEPA

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
4 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
7 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
8 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
9 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
10 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
11 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
12 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
13 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
14 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
231 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
234 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
235 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 1.53
Isolates 5.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 4.91
Rhizoplane 4.29
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1026819 3300002774 Bacteria 829
2 JGI25153J46596_10012635 3300003215 Bacteria 3623
3 rootH2_10146089 3300003320 Bacteria 1926
4 Ga0070683_100001608 3300005329 Bacteria 17476
5 Ga0070683_100015944 3300005329 Bacteria 6610
6 Ga0070680_100056092 3300005336 Bacteria 3220
7 Ga0070680_100069534 3300005336 Bacteria 2891
8 Ga0070680_100134866 3300005336 Bacteria 2067
9 Ga0070680_101041030 3300005336 Bacteria 707
10 Ga0070682_100102011 3300005337 Bacteria 1896
11 Ga0070660_100040560 3300005339 Bacteria 3544
12 Ga0070668_100377450 3300005347 Bacteria 1206
13 Ga0070668_100911472 3300005347 Bacteria 786
14 Ga0070659_100146871 3300005366 Bacteria 1922
15 Ga0070709_10015246 3300005434 Bacteria 4368
16 Ga0070714_100060015 3300005435 Bacteria 3263
17 Ga0070714_100502743 3300005435 Bacteria 1156
18 Ga0070714_100936044 3300005435 Unclassified 842
19 Ga0070713_100022472 3300005436 Bacteria 4875
20 Ga0070713_100063046 3300005436 Bacteria 3106
21 Ga0070710_10019648 3300005437 Bacteria 3494
22 Ga0070708_100013114 3300005445 Bacteria 6780
23 Ga0070708_100354510 3300005445 Bacteria 1383
24 Ga0070662_100028313 3300005457 Bacteria 3898
25 Ga0070681_10017891 3300005458 Bacteria 7084
26 Ga0070681_10053558 3300005458 Bacteria 4022
27 Ga0070681_10225318 3300005458 Bacteria 1789
28 Ga0070681_10283441 3300005458 Bacteria 1568
29 Ga0070698_100952125 3300005471 Bacteria 805
30 Ga0070699_100093645 3300005518 Bacteria 2629
31 Ga0070699_100219116 3300005518 Bacteria 1696
32 Ga0070679_100011783 3300005530 Bacteria 8337
33 Ga0070679_100221158 3300005530 Bacteria 1854
34 Ga0070679_100670366 3300005530 Bacteria 980
35 Ga0070684_100007537 3300005535 Bacteria 8472
36 Ga0068853_100281599 3300005539 Bacteria 1533
37 Ga0070696_100066189 3300005546 Bacteria 2534
38 Ga0070696_100262068 3300005546 Bacteria 1311
39 Ga0070704_100203707 3300005549 Bacteria 1599
40 Ga0068855_100180461 3300005563 Bacteria 2387
41 Ga0068855_101084421 3300005563 Bacteria 838
42 Ga0068855_101102423 3300005563 Bacteria 830
43 Ga0070664_100041947 3300005564 Bacteria 3863
44 Ga0068857_100216143 3300005577 Bacteria 1750
45 Ga0068856_100032045 3300005614 Bacteria 5144
46 Ga0068862_100446355 3300005844 Bacteria 1218
47 Ga0081538_10005426 3300005981 Bacteria 11450
48 Ga0070717_10819573 3300006028 Bacteria 847
49 Ga0075365_10013262 3300006038 Bacteria 4918
50 Ga0075363_100012491 3300006048 Bacteria 4096
51 Ga0070716_100035211 3300006173 Bacteria 2752
52 Ga0075362_10027315 3300006177 Bacteria 2443
53 Ga0075367_10232684 3300006178 Bacteria 1154
54 Ga0075366_10012090 3300006195 Bacteria 4888
55 Ga0075366_10043820 3300006195 Bacteria 2651
56 Ga0075366_10082806 3300006195 Bacteria 1917
57 Ga0075366_10127064 3300006195 Bacteria 1538
58 Ga0075428_100456882 3300006844 Bacteria 1368
59 Ga0075433_10061418 3300006852 Bacteria 3292
60 Ga0075433_10629685 3300006852 Bacteria 941
61 Ga0075434_100008357 3300006871 Bacteria 9621
62 Ga0075434_100068375 3300006871 Bacteria 3538
63 Ga0075434_100095903 3300006871 Bacteria 2971
64 Ga0075435_100118501 3300007076 Bacteria 2207
65 Ga0075435_100284802 3300007076 Bacteria 1411
66 Ga0099794_10140065 3300007265 Bacteria 1225
67 Ga0099794_10169612 3300007265 Bacteria 1112
68 Ga0105240_10638871 3300009093 Bacteria 1168
69 Ga0111539_10012470 3300009094 Bacteria 10653
70 Ga0111539_10043093 3300009094 Bacteria 5413
71 Ga0111539_10138316 3300009094 Bacteria 2852
72 Ga0105241_10270998 3300009174 Bacteria 1446
73 Ga0105242_10250740 3300009176 Bacteria 1595
74 Ga0105248_10248101 3300009177 Unclassified 2004
75 Ga0105248_10879327 3300009177 Bacteria 1012
76 Ga0105238_10367370 3300009551 Bacteria 1429
77 Ga0105238_10484839 3300009551 Bacteria 1236
78 Ga0105249_10160733 3300009553 Bacteria 2171
79 Ga0123341_1000032 3300009765 Bacteria 62527
80 Ga0105239_10181054 3300010375 Bacteria 2358
81 Ga0157371_10256091 3300013102 Bacteria 1261
82 Ga0157370_10201241 3300013104 Bacteria 1847
83 Ga0157369_10010521 3300013105 Bacteria 10531
84 Ga0157369_10017675 3300013105 Bacteria 8011
85 Ga0163162_10639574 3300013306 Bacteria 1188
86 Ga0157372_10522658 3300013307 Bacteria 1383
87 Ga0157375_10292035 3300013308 Bacteria 1793
88 Ga0157375_10420863 3300013308 Bacteria 1502
89 Ga0182008_10008948 3300014497 Bacteria 5430
90 Ga0157379_10025417 3300014968 Bacteria 5261
91 Ga0182007_10015781 3300015262 Bacteria 2805
92 Ga0183362_10001 3300015683 Bacteria 2046624
93 Ga0206356_10188264 3300020070 Bacteria 1725
94 Ga0206354_10605015 3300020081 Bacteria 1873
95 Ga0206353_10571089 3300020082 Bacteria 1975
96 Ga0213876_10062569 3300021384 Bacteria 1965
97 Ga0213876_10134337 3300021384 Bacteria 1316
98 Ga0224712_10032637 3300022467 Bacteria 1899
99 Ga0224712_10073835 3300022467 Bacteria 1392
100 Ga0207692_10010022 3300025898 Bacteria 3976
101 Ga0207692_10198697 3300025898 Unclassified 1178
102 Ga0207699_10167177 3300025906 Bacteria 1469
103 Ga0207645_10231622 3300025907 Bacteria 1219
104 Ga0207684_10016995 3300025910 Bacteria 6250
105 Ga0207684_10644960 3300025910 Bacteria 902
106 Ga0207707_10000413 3300025912 Bacteria 44774
107 Ga0207695_10345096 3300025913 Bacteria 1376
108 Ga0207660_10046798 3300025917 Bacteria 3055
109 Ga0207660_10147019 3300025917 Bacteria 1807
110 Ga0207662_10514564 3300025918 Bacteria 825
111 Ga0207657_10122597 3300025919 Bacteria 2138
112 Ga0207652_10011754 3300025921 Bacteria 7066
113 Ga0207652_10148643 3300025921 Bacteria 2097
114 Ga0207646_10292998 3300025922 Bacteria 1470
115 Ga0207694_10343681 3300025924 Bacteria 1234
116 Ga0207694_10489469 3300025924 Bacteria 1029
117 Ga0207700_10015504 3300025928 Bacteria 5030
118 Ga0207700_10043098 3300025928 Bacteria 3313
119 Ga0207700_10049400 3300025928 Bacteria 3129
120 Ga0207664_10002993 3300025929 Bacteria 11226
121 Ga0207664_10093993 3300025929 Bacteria 2464
122 Ga0207664_10404872 3300025929 Bacteria 1214
123 Ga0207690_10310574 3300025932 Bacteria 1236
124 Ga0207706_10030364 3300025933 Bacteria 4821
125 Ga0207709_10311070 3300025935 Bacteria 1175
126 Ga0207661_10000177 3300025944 Bacteria 41089
127 Ga0207679_10055630 3300025945 Bacteria 2918
128 Ga0207667_10152549 3300025949 Bacteria 2378
129 Ga0207712_10129893 3300025961 Bacteria 1918
130 Ga0207678_10023718 3300026067 Bacteria 5366
131 Ga0207702_10043097 3300026078 Bacteria 3788
132 Ga0207674_10040678 3300026116 Bacteria 4814
133 Ga0207683_10303009 3300026121 Bacteria 1462
134 Ga0207428_10133019 3300027907 Bacteria 1902
135 Ga0268265_10503757 3300028380 Bacteria 1141
136 Ga0307515_10000291 3300028794 Bacteria 123206
137 Ga0307515_10215205 3300028794 Bacteria 1754
138 Ga0265328_10000986 3300031239 Bacteria 13075
139 Ga0265325_10045164 3300031241 Bacteria 2290
140 Ga0265325_10052799 3300031241 Bacteria 2086
141 Ga0265340_10016673 3300031247 Bacteria 3802
142 Ga0265340_10031039 3300031247 Bacteria 2674
143 Ga0265339_10009983 3300031249 Bacteria 5924
144 Ga0265339_10024316 3300031249 Bacteria 3492
145 Ga0265316_10232559 3300031344 Bacteria 1357
146 Ga0307408_100664339 3300031548 Bacteria 933
147 Ga0265313_10010025 3300031595 Bacteria 6064
148 Ga0265313_10039445 3300031595 Bacteria 2342
149 Ga0265313_10047456 3300031595 Bacteria 2078
150 Ga0265313_10158294 3300031595 Bacteria 963
151 Ga0265314_10054403 3300031711 Bacteria 2770
152 Ga0265342_10015210 3300031712 Bacteria 5072
153 Ga0265342_10067980 3300031712 Bacteria 2083
154 Ga0265342_10091579 3300031712 Bacteria 1742
155 Ga0265342_10222980 3300031712 Bacteria 1015
156 Ga0316583_10181979 3300032133 Bacteria 731
157 Ga0373926_0147937 3300035083 Bacteria 894
158 Ga0373934_0228826 3300035086 Bacteria 767
159 Ga0373936_0116242 3300035113 Bacteria 1139
160 Ga0373945_0062564 3300035116 Bacteria 1392
161 Ga0373957_0009174 3300035120 Bacteria 3230
162 Ga0373924_0067534 3300035410 Bacteria 1504
163 Ga0373931_0350261 3300035691 Bacteria 924
164 Ga0373931_0437627 3300035691 Bacteria 834
165 Ga0373935_0010830 3300035692 Bacteria 5478
166 Ga0373935_0246917 3300035692 Bacteria 1248
167 Ga0373927_0284529 3300035695 Bacteria 1088
168 Ga0373933_0116302 3300035724 Bacteria 1672
169 Ga0373947_0043394 3300035725 Bacteria 2686
170 Ga0373947_0146513 3300035725 Bacteria 1518
171 Ga0373937_0016847 3300036401 Bacteria 6497
172 Ga0373937_0022898 3300036401 Bacteria 5618
173 Ga0373937_0083135 3300036401 Bacteria 2962
174 Ga0373925_0013070 3300037068 Bacteria 6010
175 Ga0373925_0167077 3300037068 Bacteria 1735
176 Ga0373925_0294457 3300037068 Bacteria 1309
177 Ga0395900_0120747 3300037418 Bacteria 2689
178 Ga0395898_0195966 3300037466 Bacteria 1929
179 Ga0436364_1270533 3300037853 Bacteria 1347
180 Ga0436364_1420335 3300037853 Bacteria 2115
181 Ga0436364_1537052 3300037853 Bacteria 1016
182 Ga0436365_0605320 3300039437 Bacteria 5697
183 Ga0436365_1147128 3300039437 Bacteria 1505
184 Ga0436365_1524489 3300039437 Bacteria 2448
185 Ga0436363_0522951 3300039450 Bacteria 2066
186 Ga0436362_0502477 3300039453 Bacteria 1101
187 Ga0439465_0002658 3300041413 Bacteria 5837
188 Ga0451853_1152098 3300041512 Bacteria 5309
189 Ga0439431_0000244 3300041997 Bacteria 11026
190 Ga0439433_0005976 3300041999 Bacteria 2617
191 Ga0439442_002325 3300042002 Bacteria 3734
192 Ga0439445_0001130 3300042004 Bacteria 5710
193 Ga0439432_000895 3300042006 Bacteria 11191
194 Ga0439449_0000162 3300042007 Bacteria 22807
195 Ga0439452_001519 3300042010 Bacteria 9348
196 Ga0439462_0003521 3300042015 Bacteria 3761
197 Ga0439434_0004193 3300042435 Bacteria 4209
198 Ga0451577_0164023 3300042876 Bacteria 2002
199 Ga0453683_0221784 3300044673 Bacteria 1202
200 Ga0466966_0227713 3300044684 Bacteria 1125
201 Ga0466961_0106467 3300044693 Bacteria 1765
202 Ga0466963_0228257 3300044694 Bacteria 1304
203 Ga0466963_0300055 3300044694 Bacteria 1130
204 Ga0466971_0011780 3300044719 Bacteria 3831
205 Ga0466970_0286897 3300044765 Bacteria 926
206 Ga0466957_0143727 3300044842 Bacteria 1539
207 Ga0466957_0810968 3300044842 Bacteria 665
208 Ga0466959_0053628 3300045049 Bacteria 2947
209 Ga0451576_0893213 3300045051 Bacteria 932
210 Ga0466958_0046372 3300045836 Bacteria 2623
211 Ga0466967_0044754 3300045976 Bacteria 3842
212 Ga0466967_0126553 3300045976 Bacteria 2367
213 Ga0466967_0686751 3300045976 Bacteria 1013
214 Ga0495592_0041802 3300046454 Bacteria 3434
215 Ga0495629_0091006 3300046459 Bacteria 2129
216 Ga0495638_0045888 3300046460 Bacteria 2747
217 Ga0495651_0047311 3300046462 Bacteria 3326
218 Ga0495582_0050281 3300046473 Bacteria 2297
219 Ga0495662_0007417 3300046476 Bacteria 5421
220 Ga0495584_0028056 3300046491 Bacteria 2851
221 Ga0495584_0050245 3300046491 Bacteria 2100
222 Ga0495618_0204362 3300046514 Bacteria 1250
223 Ga0495628_0066760 3300046516 Bacteria 2811
224 Ga0495637_0041715 3300046520 Bacteria 1967
225 Ga0495642_0079178 3300046528 Bacteria 1382
226 Ga0495640_0011046 3300046533 Bacteria 6953
227 Ga0495640_0198273 3300046533 Bacteria 1273
228 Ga0495645_0087256 3300046543 Bacteria 2232
229 Ga0495622_0280262 3300046557 Bacteria 729
230 Ga0495634_0128684 3300046642 Bacteria 1616
231 Ga0495657_0238619 3300046675 Bacteria 1098
232 Ga0495599_0115237 3300046678 Bacteria 1672
233 Ga0495623_0016779 3300046679 Bacteria 4732
234 Ga0495646_0028099 3300046680 Bacteria 3524
235 Ga0495613_0387472 3300046689 Bacteria 955
236 Ga0495624_0180477 3300046690 Bacteria 1287
237 Ga0495600_0066789 3300046809 Bacteria 2351
238 Ga0495600_0202023 3300046809 Bacteria 1276
239 Ga0495604_0315279 3300047317 Bacteria 1046
240 Ga0495674_0092416 3300047319 Bacteria 2583
241 Ga0495680_0267247 3300047322 Bacteria 1208
242 Ga0495675_0048710 3300047444 Bacteria 2695
243 Ga0495686_0021343 3300047472 Bacteria 4303
244 Ga0496100_0288082 3300048903 Bacteria 1226
245 Ga0496103_0062306 3300048906 Bacteria 2321
246 Ga0496104_0124981 3300048907 Bacteria 2470
247 Ga0496104_0786859 3300048907 Bacteria 858
248 Ga0496105_0087983 3300048908 Bacteria 2566
249 Ga0496107_0381731 3300048910 Bacteria 1048
250 Ga0496108_0036378 3300048911 Bacteria 4096
251 Ga0496108_0332444 3300048911 Bacteria 1325
252 Ga0496109_0137408 3300048912 Bacteria 2284
253 Ga0496111_0239636 3300048914 Bacteria 1347
254 Ga0496112_0084073 3300048915 Bacteria 3148
255 Ga0496114_0556956 3300048917 Bacteria 1013
256 Ga0496115_0430918 3300048918 Bacteria 1067
257 Ga0496115_0554840 3300048918 Unclassified 918
258 Ga0501033_0139170 3300049570 Bacteria 1755
259 Ga0501034_0000621 3300049571 Bacteria 55508
260 Ga0501036_0111288 3300049572 Bacteria 2314
261 Ga0501036_0379891 3300049572 Bacteria 1179
262 Ga0501036_0549059 3300049572 Bacteria 960
263 Ga0501037_0095236 3300049573 Bacteria 2152
264 Ga0501038_0223595 3300049574 Bacteria 1501
265 Ga0501038_0356431 3300049574 Bacteria 1138
266 Ga0501039_0225174 3300049575 Bacteria 1474
267 Ga0501040_0032935 3300049576 Bacteria 3508
268 Ga0501042_0419440 3300049578 Bacteria 970
269 Ga0501043_0233243 3300049579 Bacteria 1421
270 Ga0501046_0219410 3300049580 Bacteria 1409
271 Ga0501047_0670544 3300049581 Bacteria 855
272 Ga0501048_0244360 3300049582 Bacteria 1274
273 Ga0501067_0095827 3300049583 Bacteria 1648
274 Ga0501068_0009667 3300049584 Bacteria 5399
275 Ga0501068_0106589 3300049584 Bacteria 1740
276 Ga0501069_0046905 3300049585 Bacteria 2398
277 Ga0501069_0324047 3300049585 Bacteria 906
278 Ga0501070_0138920 3300049586 Bacteria 2006
279 Ga0501075_0117704 3300049591 Bacteria 2020
280 Ga0501075_0268740 3300049591 Bacteria 1300
281 Ga0501077_0282097 3300049593 Bacteria 1057
282 Ga0501079_0294289 3300049741 Bacteria 1270
283 Ga0501080_0177834 3300049742 Bacteria 1960
284 Ga0501081_0148887 3300049743 Bacteria 1681
285 Ga0501035_0264764 3300049822 Bacteria 1456
286 Ga0501035_0816229 3300049822 Bacteria 744
287 Ga0501044_0017277 3300049823 Bacteria 7738
288 Ga0501044_0020472 3300049823 Bacteria 7064
289 Ga0501044_0053217 3300049823 Bacteria 4166
290 Ga0501044_0398091 3300049823 Bacteria 1290
291 nmdc:mga0yw44_292837_c1 3300050492 Bacteria 1090
292 nmdc:mga0k408_11282_c1 3300050493 Bacteria 4860
293 nmdc:mga0k408_39302_c1 3300050493 Bacteria 2717
294 nmdc:mga0k408_88940_c1 3300050493 Bacteria 1813
295 nmdc:mga06z11_245606_c1 3300050494 Bacteria 1052
296 nmdc:mga07m45_468321_c1 3300050496 Bacteria 730
297 nmdc:mga08y16_108551_c1 3300050511 Bacteria 2889
298 nmdc:mga08y16_40606_c1 3300050511 Bacteria 4875
299 nmdc:mga08y16_77844_c1 3300050511 Bacteria 3457
300 nmdc:mga0n895_179119_c1 3300050512 Bacteria 2151
301 nmdc:mga0n895_434955_c1 3300050512 Bacteria 1325
302 nmdc:mga0n895_99800_c1 3300050512 Bacteria 2912
303 nmdc:mga0a205_13177_c1 3300050515 Bacteria 6670
304 nmdc:mga0a205_332744_c1 3300050515 Bacteria 1388
305 Ga0495601_0050137 3300053077 Bacteria 2632
306 Ga0495595_0115474 3300053084 Bacteria 1304
307 Ga0500577_0000103 3300053142 Bacteria 20439
308 Ga0500625_160333 3300053729 Bacteria 828
309 Ga0466962_0279731 3300061719 Bacteria 823

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0324047 Ga0501069_0324047_348_881 176
2 3300049572 Ga0501036_0549059 Ga0501036_0549059_44_592 182
3 3300049575 Ga0501039_0225174 Ga0501039_0225174_32_586 183
4 3300050496 nmdc:mga07m45_468321_c1 nmdc:mga07m45_468321_c1_150_704 183
5 3300035083 Ga0373926_0147937 Ga0373926_0147937_22_582 185
6 3300037466 Ga0395898_0195966 Ga0395898_0195966_19_609 195
7 3300044842 Ga0466957_0810968 Ga0466957_0810968_10_600 195
8 3300046557 Ga0495622_0280262 Ga0495622_0280262_14_607 195
9 3300048917 Ga0496114_0556956 Ga0496114_0556956_14_604 195
10 3300049582 Ga0501048_0244360 Ga0501048_0244360_25_615 195
11 3300005347 Ga0070668_100911472 Ga0070668_1009114721 206
12 3300046528 Ga0495642_0079178 Ga0495642_0079178_239_901 207
13 3300037853 Ga0436364_1420335 Ga0436364_1420335_1465_2097 209
14 iso_pu_bacteria 2881861095 2881866829 211
15 iso_pu_bacteria 2924784321 2924789208 211
16 3300007265 Ga0099794_10169612 Ga0099794_101696122 212
17 3300013306 Ga0163162_10639574 Ga0163162_106395742 212
18 3300035116 Ga0373945_0062564 Ga0373945_0062564_578_1216 212
19 3300035691 Ga0373931_0437627 Ga0373931_0437627_13_654 212
20 3300035724 Ga0373933_0116302 Ga0373933_0116302_1023_1661 212
21 3300049570 Ga0501033_0139170 Ga0501033_0139170_307_948 212
22 3300049572 Ga0501036_0379891 Ga0501036_0379891_17_655 212
23 3300007265 Ga0099794_10140065 Ga0099794_101400652 213
24 iso_pu_bacteria 2508501128 2509151711 214
25 iso_pu_bacteria 2510065019 2510133874 215
26 iso_pu_bacteria 2513237084 2513573651 215
27 iso_pu_bacteria 2513237093 2513629479 215
28 iso_pu_bacteria 2513237101 2513692210 215
29 iso_pu_bacteria 2517093000 2517095753 215
30 iso_pu_bacteria 2517287029 2517407318 215
31 iso_pu_bacteria 2724679232 2725952641 215
32 iso_pu_bacteria 2856356410 2856360460 215
33 iso_pu_bacteria 2885192300 2885192555 215
34 iso_pu_bacteria 2936367885 2936372125 215
35 iso_pu_bacteria 2936375103 2936381071 215
36 iso_pu_bacteria 8005376324 8005380845 215
37 iso_pu_bacteria 8005563573 8005567908 215
38 iso_pu_bacteria 8024479707 8024482949 215
39 3300005844 Ga0068862_100446355 Ga0068862_1004463552 216
40 3300006178 Ga0075367_10232684 Ga0075367_102326842 216
41 3300006195 Ga0075366_10082806 Ga0075366_100828063 216
42 3300009553 Ga0105249_10160733 Ga0105249_101607333 216
43 3300025907 Ga0207645_10231622 Ga0207645_102316222 216
44 3300025935 Ga0207709_10311070 Ga0207709_103110702 216
45 3300025961 Ga0207712_10129893 Ga0207712_101298933 216
46 3300028380 Ga0268265_10503757 Ga0268265_105037572 216
47 3300031548 Ga0307408_100664339 Ga0307408_1006643392 216
48 3300050494 nmdc:mga06z11_245606_c1 nmdc:mga06z11_245606_c1_277_933 216
49 3300005445 Ga0070708_100013114 Ga0070708_1000131148 217
50 3300005445 Ga0070708_100354510 Ga0070708_1003545102 217
51 3300005518 Ga0070699_100093645 Ga0070699_1000936452 217
52 3300005518 Ga0070699_100219116 Ga0070699_1002191163 217
53 3300005546 Ga0070696_100066189 Ga0070696_1000661892 217
54 3300005549 Ga0070704_100203707 Ga0070704_1002037073 217
55 3300005614 Ga0068856_100032045 Ga0068856_1000320452 217
56 3300006195 Ga0075366_10012090 Ga0075366_100120905 217
57 3300006844 Ga0075428_100456882 Ga0075428_1004568822 217
58 3300006852 Ga0075433_10629685 Ga0075433_106296852 217
59 3300007076 Ga0075435_100284802 Ga0075435_1002848022 217
60 3300009177 Ga0105248_10248101 Ga0105248_102481013 217
61 3300014497 Ga0182008_10008948 Ga0182008_100089485 217
62 3300014968 Ga0157379_10025417 Ga0157379_100254173 217
63 3300015262 Ga0182007_10015781 Ga0182007_100157813 217
64 3300015683 Ga0183362_10001 Ga0183362_100011211 217
65 3300025910 Ga0207684_10016995 Ga0207684_100169956 217
66 3300025910 Ga0207684_10644960 Ga0207684_106449602 217
67 3300025922 Ga0207646_10292998 Ga0207646_102929981 217
68 3300026078 Ga0207702_10043097 Ga0207702_100430975 217
69 3300026121 Ga0207683_10303009 Ga0207683_103030092 217
70 3300028794 Ga0307515_10000291 Ga0307515_1000029175 217
71 3300028794 Ga0307515_10215205 Ga0307515_102152051 217
72 3300031239 Ga0265328_10000986 Ga0265328_100009866 217
73 3300031712 Ga0265342_10222980 Ga0265342_102229802 217
74 3300036401 Ga0373937_0083135 Ga0373937_0083135_308_967 217
75 3300041413 Ga0439465_0002658 Ga0439465_0002658_3682_4344 217
76 3300041997 Ga0439431_0000244 Ga0439431_0000244_333_995 217
77 3300041999 Ga0439433_0005976 Ga0439433_0005976_288_950 217
78 3300042002 Ga0439442_002325 Ga0439442_002325_2779_3441 217
79 3300042004 Ga0439445_0001130 Ga0439445_0001130_1212_1874 217
80 3300042006 Ga0439432_000895 Ga0439432_000895_6373_7035 217
81 3300042007 Ga0439449_0000162 Ga0439449_0000162_20631_21293 217
82 3300042010 Ga0439452_001519 Ga0439452_001519_2918_3580 217
83 3300042015 Ga0439462_0003521 Ga0439462_0003521_1371_2033 217
84 3300042435 Ga0439434_0004193 Ga0439434_0004193_414_1076 217
85 3300042876 Ga0451577_0164023 Ga0451577_0164023_509_1168 217
86 3300044673 Ga0453683_0221784 Ga0453683_0221784_119_772 217
87 3300046809 Ga0495600_0202023 Ga0495600_0202023_216_902 217
88 3300047472 Ga0495686_0021343 Ga0495686_0021343_2828_3499 217
89 3300048911 Ga0496108_0332444 Ga0496108_0332444_333_995 217
90 3300049576 Ga0501040_0032935 Ga0501040_0032935_2249_2902 217
91 3300049578 Ga0501042_0419440 Ga0501042_0419440_213_866 217
92 3300049591 Ga0501075_0117704 Ga0501075_0117704_852_1505 217
93 3300049741 Ga0501079_0294289 Ga0501079_0294289_62_715 217
94 3300049743 Ga0501081_0148887 Ga0501081_0148887_858_1511 217
95 3300049823 Ga0501044_0398091 Ga0501044_0398091_292_948 217
96 3300050493 nmdc:mga0k408_11282_c1 nmdc:mga0k408_11282_c1_1343_2005 217
97 3300050515 nmdc:mga0a205_332744_c1 nmdc:mga0a205_332744_c1_691_1347 217
98 3300053729 Ga0500625_160333 Ga0500625_160333_18_683 217
99 3300005329 Ga0070683_100001608 Ga0070683_1000016089 218
100 3300005329 Ga0070683_100015944 Ga0070683_1000159443 218
101 3300005336 Ga0070680_100056092 Ga0070680_1000560924 218
102 3300005336 Ga0070680_100069534 Ga0070680_1000695342 218
103 3300005336 Ga0070680_100134866 Ga0070680_1001348663 218
104 3300005336 Ga0070680_101041030 Ga0070680_1010410301 218
105 3300005337 Ga0070682_100102011 Ga0070682_1001020113 218
106 3300005339 Ga0070660_100040560 Ga0070660_1000405605 218
107 3300005347 Ga0070668_100377450 Ga0070668_1003774502 218
108 3300005366 Ga0070659_100146871 Ga0070659_1001468711 218
109 3300005434 Ga0070709_10015246 Ga0070709_100152462 218
110 3300005435 Ga0070714_100502743 Ga0070714_1005027432 218
111 3300005436 Ga0070713_100063046 Ga0070713_1000630464 218
112 3300005437 Ga0070710_10019648 Ga0070710_100196483 218
113 3300005457 Ga0070662_100028313 Ga0070662_1000283132 218
114 3300005458 Ga0070681_10017891 Ga0070681_100178913 218
115 3300005458 Ga0070681_10053558 Ga0070681_100535585 218
116 3300005458 Ga0070681_10225318 Ga0070681_102253182 218
117 3300005458 Ga0070681_10283441 Ga0070681_102834412 218
118 3300005471 Ga0070698_100952125 Ga0070698_1009521251 218
119 3300005530 Ga0070679_100011783 Ga0070679_1000117831 218
120 3300005530 Ga0070679_100221158 Ga0070679_1002211582 218
121 3300005530 Ga0070679_100670366 Ga0070679_1006703662 218
122 3300005535 Ga0070684_100007537 Ga0070684_1000075375 218
123 3300005539 Ga0068853_100281599 Ga0068853_1002815993 218
124 3300005546 Ga0070696_100262068 Ga0070696_1002620682 218
125 3300005563 Ga0068855_100180461 Ga0068855_1001804613 218
126 3300005563 Ga0068855_101084421 Ga0068855_1010844212 218
127 3300005563 Ga0068855_101102423 Ga0068855_1011024232 218
128 3300005564 Ga0070664_100041947 Ga0070664_1000419476 218
129 3300005577 Ga0068857_100216143 Ga0068857_1002161433 218
130 3300005981 Ga0081538_10005426 Ga0081538_1000542611 218
131 3300006028 Ga0070717_10819573 Ga0070717_108195732 218
132 3300006038 Ga0075365_10013262 Ga0075365_100132625 218
133 3300006048 Ga0075363_100012491 Ga0075363_1000124912 218
134 3300006173 Ga0070716_100035211 Ga0070716_1000352114 218
135 3300006177 Ga0075362_10027315 Ga0075362_100273152 218
136 3300006195 Ga0075366_10043820 Ga0075366_100438204 218
137 3300006852 Ga0075433_10061418 Ga0075433_100614184 218
138 3300006871 Ga0075434_100008357 Ga0075434_1000083573 218
139 3300006871 Ga0075434_100068375 Ga0075434_1000683752 218
140 3300006871 Ga0075434_100095903 Ga0075434_1000959033 218
141 3300007076 Ga0075435_100118501 Ga0075435_1001185013 218
142 3300009093 Ga0105240_10638871 Ga0105240_106388712 218
143 3300009094 Ga0111539_10012470 Ga0111539_100124709 218
144 3300009094 Ga0111539_10043093 Ga0111539_100430934 218
145 3300009094 Ga0111539_10138316 Ga0111539_101383163 218
146 3300009176 Ga0105242_10250740 Ga0105242_102507402 218
147 3300009177 Ga0105248_10879327 Ga0105248_108793272 218
148 3300009551 Ga0105238_10367370 Ga0105238_103673702 218
149 3300009551 Ga0105238_10484839 Ga0105238_104848392 218
150 3300010375 Ga0105239_10181054 Ga0105239_101810542 218
151 3300013102 Ga0157371_10256091 Ga0157371_102560912 218
152 3300013104 Ga0157370_10201241 Ga0157370_102012412 218
153 3300013105 Ga0157369_10010521 Ga0157369_1001052110 218
154 3300013105 Ga0157369_10017675 Ga0157369_100176755 218
155 3300013307 Ga0157372_10522658 Ga0157372_105226582 218
156 3300013308 Ga0157375_10292035 Ga0157375_102920351 218
157 3300013308 Ga0157375_10420863 Ga0157375_104208632 218
158 3300020070 Ga0206356_10188264 Ga0206356_101882642 218
159 3300020081 Ga0206354_10605015 Ga0206354_106050152 218
160 3300020082 Ga0206353_10571089 Ga0206353_105710892 218
161 3300021384 Ga0213876_10062569 Ga0213876_100625692 218
162 3300021384 Ga0213876_10134337 Ga0213876_101343371 218
163 3300022467 Ga0224712_10032637 Ga0224712_100326372 218
164 3300022467 Ga0224712_10073835 Ga0224712_100738351 218
165 3300025898 Ga0207692_10010022 Ga0207692_100100225 218
166 3300025906 Ga0207699_10167177 Ga0207699_101671772 218
167 3300025912 Ga0207707_10000413 Ga0207707_100004136 218
168 3300025913 Ga0207695_10345096 Ga0207695_103450962 218
169 3300025917 Ga0207660_10046798 Ga0207660_100467984 218
170 3300025917 Ga0207660_10147019 Ga0207660_101470192 218
171 3300025918 Ga0207662_10514564 Ga0207662_105145642 218
172 3300025919 Ga0207657_10122597 Ga0207657_101225972 218
173 3300025921 Ga0207652_10011754 Ga0207652_100117549 218
174 3300025921 Ga0207652_10148643 Ga0207652_101486433 218
175 3300025924 Ga0207694_10343681 Ga0207694_103436812 218
176 3300025924 Ga0207694_10489469 Ga0207694_104894692 218
177 3300025928 Ga0207700_10043098 Ga0207700_100430982 218
178 3300025928 Ga0207700_10049400 Ga0207700_100494004 218
179 3300025929 Ga0207664_10002993 Ga0207664_1000299310 218
180 3300025929 Ga0207664_10404872 Ga0207664_104048722 218
181 3300025932 Ga0207690_10310574 Ga0207690_103105741 218
182 3300025933 Ga0207706_10030364 Ga0207706_100303645 218
183 3300025944 Ga0207661_10000177 Ga0207661_100001777 218
184 3300025945 Ga0207679_10055630 Ga0207679_100556302 218
185 3300025949 Ga0207667_10152549 Ga0207667_101525493 218
186 3300026067 Ga0207678_10023718 Ga0207678_100237185 218
187 3300026116 Ga0207674_10040678 Ga0207674_100406785 218
188 3300027907 Ga0207428_10133019 Ga0207428_101330192 218
189 3300031241 Ga0265325_10045164 Ga0265325_100451642 218
190 3300031241 Ga0265325_10052799 Ga0265325_100527993 218
191 3300031247 Ga0265340_10016673 Ga0265340_100166733 218
192 3300031247 Ga0265340_10031039 Ga0265340_100310393 218
193 3300031249 Ga0265339_10009983 Ga0265339_100099832 218
194 3300031249 Ga0265339_10024316 Ga0265339_100243163 218
195 3300031344 Ga0265316_10232559 Ga0265316_102325593 218
196 3300031595 Ga0265313_10010025 Ga0265313_100100257 218
197 3300031595 Ga0265313_10039445 Ga0265313_100394452 218
198 3300031595 Ga0265313_10047456 Ga0265313_100474562 218
199 3300031595 Ga0265313_10158294 Ga0265313_101582942 218
200 3300031711 Ga0265314_10054403 Ga0265314_100544033 218
201 3300031712 Ga0265342_10015210 Ga0265342_100152103 218
202 3300031712 Ga0265342_10067980 Ga0265342_100679803 218
203 3300031712 Ga0265342_10091579 Ga0265342_100915792 218
204 3300032133 Ga0316583_10181979 Ga0316583_101819791 218
205 3300035086 Ga0373934_0228826 Ga0373934_0228826_12_668 218
206 3300035113 Ga0373936_0116242 Ga0373936_0116242_163_822 218
207 3300035120 Ga0373957_0009174 Ga0373957_0009174_2180_2836 218
208 3300035410 Ga0373924_0067534 Ga0373924_0067534_731_1387 218
209 3300035691 Ga0373931_0350261 Ga0373931_0350261_58_717 218
210 3300035692 Ga0373935_0010830 Ga0373935_0010830_4222_4878 218
211 3300035692 Ga0373935_0246917 Ga0373935_0246917_430_1086 218
212 3300035725 Ga0373947_0043394 Ga0373947_0043394_45_707 218
213 3300035725 Ga0373947_0146513 Ga0373947_0146513_705_1361 218
214 3300036401 Ga0373937_0016847 Ga0373937_0016847_4255_4911 218
215 3300036401 Ga0373937_0022898 Ga0373937_0022898_3309_3965 218
216 3300037068 Ga0373925_0013070 Ga0373925_0013070_429_1091 218
217 3300037068 Ga0373925_0167077 Ga0373925_0167077_1037_1696 218
218 3300037068 Ga0373925_0294457 Ga0373925_0294457_541_1197 218
219 3300037418 Ga0395900_0120747 Ga0395900_0120747_1250_1909 218
220 3300037853 Ga0436364_1270533 Ga0436364_1270533_571_1230 218
221 3300037853 Ga0436364_1537052 Ga0436364_1537052_246_902 218
222 3300039437 Ga0436365_0605320 Ga0436365_0605320_2611_3267 218
223 3300039437 Ga0436365_1147128 Ga0436365_1147128_586_1245 218
224 3300039437 Ga0436365_1524489 Ga0436365_1524489_217_876 218
225 3300039450 Ga0436363_0522951 Ga0436363_0522951_704_1363 218
226 3300039453 Ga0436362_0502477 Ga0436362_0502477_192_851 218
227 3300044684 Ga0466966_0227713 Ga0466966_0227713_216_875 218
228 3300044693 Ga0466961_0106467 Ga0466961_0106467_553_1212 218
229 3300044694 Ga0466963_0228257 Ga0466963_0228257_19_678 218
230 3300044694 Ga0466963_0300055 Ga0466963_0300055_366_1025 218
231 3300044719 Ga0466971_0011780 Ga0466971_0011780_136_795 218
232 3300044765 Ga0466970_0286897 Ga0466970_0286897_38_697 218
233 3300044842 Ga0466957_0143727 Ga0466957_0143727_287_946 218
234 3300045049 Ga0466959_0053628 Ga0466959_0053628_756_1415 218
235 3300045051 Ga0451576_0893213 Ga0451576_0893213_92_751 218
236 3300045836 Ga0466958_0046372 Ga0466958_0046372_163_822 218
237 3300045976 Ga0466967_0044754 Ga0466967_0044754_2851_3510 218
238 3300045976 Ga0466967_0126553 Ga0466967_0126553_895_1554 218
239 3300045976 Ga0466967_0686751 Ga0466967_0686751_86_742 218
240 3300046454 Ga0495592_0041802 Ga0495592_0041802_553_1209 218
241 3300046459 Ga0495629_0091006 Ga0495629_0091006_768_1424 218
242 3300046460 Ga0495638_0045888 Ga0495638_0045888_1216_1872 218
243 3300046462 Ga0495651_0047311 Ga0495651_0047311_1239_1895 218
244 3300046473 Ga0495582_0050281 Ga0495582_0050281_1002_1664 218
245 3300046476 Ga0495662_0007417 Ga0495662_0007417_693_1349 218
246 3300046491 Ga0495584_0028056 Ga0495584_0028056_1189_1845 218
247 3300046491 Ga0495584_0050245 Ga0495584_0050245_1402_2058 218
248 3300046514 Ga0495618_0204362 Ga0495618_0204362_47_703 218
249 3300046516 Ga0495628_0066760 Ga0495628_0066760_118_774 218
250 3300046520 Ga0495637_0041715 Ga0495637_0041715_336_992 218
251 3300046533 Ga0495640_0011046 Ga0495640_0011046_4392_5048 218
252 3300046533 Ga0495640_0198273 Ga0495640_0198273_293_949 218
253 3300046543 Ga0495645_0087256 Ga0495645_0087256_201_857 218
254 3300046642 Ga0495634_0128684 Ga0495634_0128684_895_1551 218
255 3300046675 Ga0495657_0238619 Ga0495657_0238619_47_703 218
256 3300046678 Ga0495599_0115237 Ga0495599_0115237_613_1269 218
257 3300046679 Ga0495623_0016779 Ga0495623_0016779_3149_3805 218
258 3300046680 Ga0495646_0028099 Ga0495646_0028099_667_1323 218
259 3300046689 Ga0495613_0387472 Ga0495613_0387472_167_829 218
260 3300046690 Ga0495624_0180477 Ga0495624_0180477_544_1200 218
261 3300046809 Ga0495600_0066789 Ga0495600_0066789_382_1038 218
262 3300047317 Ga0495604_0315279 Ga0495604_0315279_76_732 218
263 3300047319 Ga0495674_0092416 Ga0495674_0092416_323_979 218
264 3300047322 Ga0495680_0267247 Ga0495680_0267247_473_1129 218
265 3300047444 Ga0495675_0048710 Ga0495675_0048710_1357_2013 218
266 3300048903 Ga0496100_0288082 Ga0496100_0288082_13_669 218
267 3300048906 Ga0496103_0062306 Ga0496103_0062306_1531_2187 218
268 3300048907 Ga0496104_0124981 Ga0496104_0124981_1536_2192 218
269 3300048907 Ga0496104_0786859 Ga0496104_0786859_135_794 218
270 3300048908 Ga0496105_0087983 Ga0496105_0087983_275_931 218
271 3300048910 Ga0496107_0381731 Ga0496107_0381731_132_788 218
272 3300048911 Ga0496108_0036378 Ga0496108_0036378_3151_3807 218
273 3300048912 Ga0496109_0137408 Ga0496109_0137408_164_823 218
274 3300048914 Ga0496111_0239636 Ga0496111_0239636_292_951 218
275 3300048915 Ga0496112_0084073 Ga0496112_0084073_152_811 218
276 3300048918 Ga0496115_0430918 Ga0496115_0430918_147_803 218
277 3300049571 Ga0501034_0000621 Ga0501034_0000621_8665_9339 218
278 3300049572 Ga0501036_0111288 Ga0501036_0111288_243_902 218
279 3300049573 Ga0501037_0095236 Ga0501037_0095236_804_1463 218
280 3300049574 Ga0501038_0223595 Ga0501038_0223595_82_741 218
281 3300049574 Ga0501038_0356431 Ga0501038_0356431_192_848 218
282 3300049579 Ga0501043_0233243 Ga0501043_0233243_227_886 218
283 3300049580 Ga0501046_0219410 Ga0501046_0219410_701_1360 218
284 3300049581 Ga0501047_0670544 Ga0501047_0670544_85_744 218
285 3300049583 Ga0501067_0095827 Ga0501067_0095827_410_1069 218
286 3300049584 Ga0501068_0009667 Ga0501068_0009667_3330_4004 218
287 3300049584 Ga0501068_0106589 Ga0501068_0106589_249_905 218
288 3300049585 Ga0501069_0046905 Ga0501069_0046905_1334_1990 218
289 3300049586 Ga0501070_0138920 Ga0501070_0138920_834_1493 218
290 3300049591 Ga0501075_0268740 Ga0501075_0268740_626_1282 218
291 3300049593 Ga0501077_0282097 Ga0501077_0282097_358_1017 218
292 3300049742 Ga0501080_0177834 Ga0501080_0177834_327_986 218
293 3300049822 Ga0501035_0264764 Ga0501035_0264764_445_1104 218
294 3300049822 Ga0501035_0816229 Ga0501035_0816229_50_706 218
295 3300049823 Ga0501044_0017277 Ga0501044_0017277_692_1351 218
296 3300049823 Ga0501044_0020472 Ga0501044_0020472_580_1254 218
297 3300049823 Ga0501044_0053217 Ga0501044_0053217_2982_3641 218
298 3300050492 nmdc:mga0yw44_292837_c1 nmdc:mga0yw44_292837_c1_248_907 218
299 3300050493 nmdc:mga0k408_39302_c1 nmdc:mga0k408_39302_c1_1874_2533 218
300 3300050511 nmdc:mga08y16_108551_c1 nmdc:mga08y16_108551_c1_646_1350 218
301 3300050511 nmdc:mga08y16_40606_c1 nmdc:mga08y16_40606_c1_1709_2365 218
302 3300050511 nmdc:mga08y16_77844_c1 nmdc:mga08y16_77844_c1_1271_1927 218
303 3300050512 nmdc:mga0n895_179119_c1 nmdc:mga0n895_179119_c1_1063_1719 218
304 3300050512 nmdc:mga0n895_434955_c1 nmdc:mga0n895_434955_c1_178_837 218
305 3300050512 nmdc:mga0n895_99800_c1 nmdc:mga0n895_99800_c1_1039_1695 218
306 3300050515 nmdc:mga0a205_13177_c1 nmdc:mga0a205_13177_c1_3110_3766 218
307 3300053077 Ga0495601_0050137 Ga0495601_0050137_1527_2183 218
308 3300053084 Ga0495595_0115474 Ga0495595_0115474_205_861 218
309 3300053142 Ga0500577_0000103 Ga0500577_0000103_13964_14626 218
310 3300061719 Ga0466962_0279731 Ga0466962_0279731_11_670 218
311 3300002774 JGI25150J39212_1026819 JGI25150J39212_10268192 219
312 3300003215 JGI25153J46596_10012635 JGI25153J46596_100126353 219
313 3300003320 rootH2_10146089 rootH2_101460892 219
314 3300005435 Ga0070714_100060015 Ga0070714_1000600152 219
315 3300005435 Ga0070714_100936044 Ga0070714_1009360441 219
316 3300005436 Ga0070713_100022472 Ga0070713_1000224723 219
317 3300006195 Ga0075366_10127064 Ga0075366_101270642 219
318 3300009174 Ga0105241_10270998 Ga0105241_102709982 219
319 3300009765 Ga0123341_1000032 Ga0123341_100003228 219
320 3300025898 Ga0207692_10198697 Ga0207692_101986972 219
321 3300025928 Ga0207700_10015504 Ga0207700_100155043 219
322 3300025929 Ga0207664_10093993 Ga0207664_100939932 219
323 3300035695 Ga0373927_0284529 Ga0373927_0284529_321_992 219
324 3300041512 Ga0451853_1152098 Ga0451853_1152098_577_1236 219
325 3300048918 Ga0496115_0554840 Ga0496115_0554840_89_751 219
326 3300050493 nmdc:mga0k408_88940_c1 nmdc:mga0k408_88940_c1_549_1208 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

136

233

0.97

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

17

130

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.9114 1 219
3qyg-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. 0.9108 1 219
3qyh-assembly2.cif.gz_D crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida. 0.9048 1 219
3qz9-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. 0.9037 1 219
1v29-assembly1.cif.gz_B-2 crystal structure of nitrile hydratase from a thermophile bacillus smithii 0.8605 1 219
ID Description Score Start End Superfamily
4ob3B02 Mainly Beta;Roll;SH3 type barrels.; 0.9429 123 218 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9406 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9325 124 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9219 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9057 124 219 2.30.30.50
ID Description Score Start End GO Terms
AF-A0A7W0JMP0-F1-model_v4 Nitrile hydratase subunit beta 0.9544 20 93
AF-A0A527ZDG4-F1-model_v4 Nitrile hydratase subunit beta 0.9501 153 219
AF-A0A1Q7BLX7-F1-model_v4 Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) 0.9447 1 219 GO:0046914
GO:0080109
AF-A0A7Y0KKE5-F1-model_v4 Nitrile hydratase subunit beta 0.9409 132 219
AF-A0A1Q7BLX7-F1-model_v4 Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) 0.9406 1 219 GO:0046914
GO:0080109

Feature Viewer

pLDDT pTM Quality
88.95 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map