F408543

General Info

Members Datasets Scaffolds Average Seq Length
326 165 652 156

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_95293_c1|nmdc:mga00v17_95293_c1_197_649
Length 150
Sequence LFSEQDESWMQRALQLAQQAAANNEVPVGAVLVLNDTMIGEGSNCPIGHCDPSAHAEMIALREGAKKINNYRLPGSILYVTLEPCLMCIGALIHARVKRVIFGAFDPKVGGVETALSIESKFNHRIIYSGGLLTEQCGALLQDFFKKRRS

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
113 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0.31
Rhizoplane 1.23
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_95293_c1 3300050491 Bacteria 1873
2 SwRhRL2b_contig_1332398 2162886007 Bacteria 1140
3 Ga0065704_10462243 3300005289 Bacteria 696
4 Ga0065715_10204829 3300005293 Bacteria 1342
5 Ga0065707_10000981 3300005295 Bacteria 8969
6 Ga0070690_101218302 3300005330 Bacteria 601
7 Ga0070670_100000011 3300005331 Bacteria 263074
8 Ga0068869_100409929 3300005334 Bacteria 1116
9 Ga0070666_10009326 3300005335 Bacteria 6114
10 Ga0070689_100631960 3300005340 Bacteria 930
11 Ga0070692_10013948 3300005345 Bacteria 3758
12 Ga0070692_10028847 3300005345 Bacteria 2762
13 Ga0070668_100345897 3300005347 Bacteria 1257
14 Ga0070669_100010224 3300005353 Bacteria 6666
15 Ga0070669_100018002 3300005353 Bacteria 5047
16 Ga0070669_100666015 3300005353 Bacteria 877
17 Ga0070675_100036038 3300005354 Bacteria 4024
18 Ga0070675_100131318 3300005354 Bacteria 2134
19 Ga0070671_100000026 3300005355 Bacteria 120482
20 Ga0070671_100572084 3300005355 Bacteria 975
21 Ga0070674_100854032 3300005356 Bacteria 790
22 Ga0070673_100030166 3300005364 Bacteria 4053
23 Ga0070673_100070393 3300005364 Bacteria 2807
24 Ga0070673_100163965 3300005364 Bacteria 1892
25 Ga0070688_100017386 3300005365 Bacteria 4126
26 Ga0070688_100051698 3300005365 Bacteria 2564
27 Ga0070688_100216739 3300005365 Bacteria 1347
28 Ga0070688_100276374 3300005365 Bacteria 1205
29 Ga0070688_100754368 3300005365 Bacteria 758
30 Ga0070667_100000092 3300005367 Bacteria 111329
31 Ga0070701_10001436 3300005438 Bacteria 8812
32 Ga0070701_10194870 3300005438 Bacteria 1194
33 Ga0070701_10240558 3300005438 Bacteria 1088
34 Ga0070700_100012741 3300005441 Bacteria 4705
35 Ga0070700_100107395 3300005441 Bacteria 1850
36 Ga0070694_100042021 3300005444 Bacteria 3052
37 Ga0070663_101372475 3300005455 Bacteria 625
38 Ga0070685_10000035 3300005466 Bacteria 81433
39 Ga0070707_100548226 3300005468 Bacteria 1118
40 Ga0070698_100203767 3300005471 Bacteria 1913
41 Ga0070697_100309426 3300005536 Bacteria 1359
42 Ga0070672_100050337 3300005543 Bacteria 3243
43 Ga0070695_101401793 3300005545 Bacteria 579
44 Ga0070696_101163353 3300005546 Bacteria 650
45 Ga0070665_100039674 3300005548 Bacteria 4734
46 Ga0070704_100000699 3300005549 Bacteria 16329
47 Ga0070704_100035622 3300005549 Bacteria 3384
48 Ga0070664_100294793 3300005564 Bacteria 1465
49 Ga0068857_100019297 3300005577 Bacteria 5985
50 Ga0068852_100394155 3300005616 Bacteria 1361
51 Ga0068859_100008287 3300005617 Bacteria 10537
52 Ga0068859_100072197 3300005617 Unclassified 3488
53 Ga0068864_100000020 3300005618 Bacteria 263460
54 Ga0068864_100043255 3300005618 Bacteria 3856
55 Ga0068864_100582128 3300005618 Bacteria 1084
56 Ga0068864_100782143 3300005618 Bacteria 937
57 Ga0068866_10579388 3300005718 Unclassified 754
58 Ga0068861_100005109 3300005719 Bacteria 8847
59 Ga0068870_10010612 3300005840 Bacteria 4238
60 Ga0068870_10018080 3300005840 Bacteria 3398
61 Ga0068858_100039522 3300005842 Bacteria 4374
62 Ga0068858_100059201 3300005842 Bacteria 3540
63 Ga0068860_100002884 3300005843 Bacteria 17828
64 Ga0068860_100384674 3300005843 Bacteria 1385
65 Ga0068860_101112923 3300005843 Bacteria 809
66 Ga0068862_100002645 3300005844 Bacteria 15767
67 Ga0068862_100087702 3300005844 Unclassified 2706
68 Ga0068862_101719694 3300005844 Unclassified 636
69 Ga0070717_10364078 3300006028 Bacteria 1295
70 Ga0075364_10666364 3300006051 Bacteria 710
71 Ga0068871_100449640 3300006358 Bacteria 1154
72 Ga0075428_100119322 3300006844 Bacteria 2872
73 Ga0075428_100219947 3300006844 Bacteria 2051
74 Ga0075428_101559633 3300006844 Unclassified 691
75 Ga0075430_100305098 3300006846 Bacteria 1317
76 Ga0075431_100000722 3300006847 Bacteria 28493
77 Ga0075431_100001230 3300006847 Bacteria 23214
78 Ga0075431_100046729 3300006847 Bacteria 4464
79 Ga0075431_100316789 3300006847 Bacteria 1573
80 Ga0075431_101276664 3300006847 Bacteria 696
81 Ga0075433_10001985 3300006852 Bacteria 15396
82 Ga0075433_10005846 3300006852 Bacteria 9691
83 Ga0075433_10006818 3300006852 Bacteria 9054
84 Ga0075433_10030810 3300006852 Bacteria 4580
85 Ga0075434_100000516 3300006871 Bacteria 29363
86 Ga0075434_100122321 3300006871 Bacteria 2618
87 Ga0075434_100133232 3300006871 Bacteria 2504
88 Ga0075434_100190517 3300006871 Bacteria 2071
89 Ga0075434_100698842 3300006871 Bacteria 1032
90 Ga0075429_100008222 3300006880 Bacteria 9071
91 Ga0075429_100009996 3300006880 Bacteria 8224
92 Ga0075429_100068775 3300006880 Bacteria 3082
93 Ga0075429_100928127 3300006880 Bacteria 761
94 Ga0075429_101034601 3300006880 Bacteria 718
95 Ga0068865_100007605 3300006881 Bacteria 6671
96 Ga0097620_100008287 3300006931 Bacteria 10537
97 Ga0097620_100072199 3300006931 Unclassified 3488
98 Ga0079104_1018599 3300006946 Bacteria 1965
99 Ga0075435_100019609 3300007076 Bacteria 5169
100 Ga0075435_100022117 3300007076 Bacteria 4902
101 Ga0075435_100558703 3300007076 Bacteria 991
102 Ga0075435_100601562 3300007076 Bacteria 953
103 Ga0105244_10196039 3300009036 Bacteria 953
104 Ga0111539_10043228 3300009094 Bacteria 5403
105 Ga0111539_10049337 3300009094 Bacteria 5021
106 Ga0111539_10192319 3300009094 Bacteria 2381
107 Ga0111539_11773546 3300009094 Bacteria 716
108 Ga0114129_10002847 3300009147 Bacteria 24179
109 Ga0114129_10059247 3300009147 Bacteria 5354
110 Ga0114129_10130278 3300009147 Bacteria 3455
111 Ga0114129_10136266 3300009147 Bacteria 3368
112 Ga0114129_10208760 3300009147 Bacteria 2641
113 Ga0114129_10262878 3300009147 Bacteria 2312
114 Ga0114129_10465492 3300009147 Bacteria 1656
115 Ga0114129_10555567 3300009147 Bacteria 1492
116 Ga0114129_11439215 3300009147 Unclassified 849
117 Ga0105243_10269203 3300009148 Bacteria 1529
118 Ga0105248_10136111 3300009177 Bacteria 2771
119 Ga0105249_10033254 3300009553 Unclassified 4668
120 Ga0105249_10037930 3300009553 Bacteria 4373
121 Ga0105249_10076016 3300009553 Bacteria 3112
122 Ga0105246_10943087 3300011119 Bacteria 777
123 Ga0105246_11361556 3300011119 Bacteria 660
124 Ga0157373_10799750 3300013100 Unclassified 695
125 Ga0157374_10207920 3300013296 Unclassified 1918
126 Ga0157374_10386184 3300013296 Bacteria 1395
127 Ga0157374_10709537 3300013296 Bacteria 1019
128 Ga0157378_10644063 3300013297 Bacteria 1075
129 Ga0157378_11529479 3300013297 Bacteria 712
130 Ga0163162_10323672 3300013306 Unclassified 1674
131 Ga0157375_10024440 3300013308 Bacteria 5592
132 Ga0163163_10000358 3300014325 Bacteria 43838
133 Ga0163163_11573601 3300014325 Unclassified 718
134 Ga0157380_10015158 3300014326 Bacteria 5658
135 Ga0157380_10386017 3300014326 Unclassified 1323
136 Ga0157380_10585868 3300014326 Bacteria 1101
137 Ga0157380_10737590 3300014326 Bacteria 995
138 Ga0157377_10141358 3300014745 Bacteria 1480
139 Ga0157377_10338453 3300014745 Bacteria 1005
140 Ga0157377_10529011 3300014745 Bacteria 829
141 Ga0157379_10061499 3300014968 Unclassified 3358
142 Ga0157379_10398140 3300014968 Bacteria 1265
143 Ga0157379_10560475 3300014968 Bacteria 1064
144 Ga0157376_10484704 3300014969 Bacteria 1212
145 Ga0157376_10726352 3300014969 Bacteria 1000
146 Ga0157376_11919348 3300014969 Bacteria 629
147 Ga0207697_10000363 3300025315 Bacteria 25398
148 Ga0207682_10001420 3300025893 Bacteria 11068
149 Ga0207642_10929848 3300025899 Unclassified 558
150 Ga0207680_10020147 3300025903 Bacteria 3582
151 Ga0207662_10014116 3300025918 Bacteria 4474
152 Ga0207662_10462562 3300025918 Bacteria 869
153 Ga0207681_10007459 3300025923 Bacteria 6702
154 Ga0207681_10011422 3300025923 Bacteria 5456
155 Ga0207650_10000025 3300025925 Bacteria 265351
156 Ga0207659_10024665 3300025926 Bacteria 4032
157 Ga0207659_10065271 3300025926 Bacteria 2637
158 Ga0207659_10295332 3300025926 Bacteria 1329
159 Ga0207644_10000481 3300025931 Bacteria 25696
160 Ga0207706_10011146 3300025933 Bacteria 8192
161 Ga0207706_10341506 3300025933 Unclassified 1302
162 Ga0207670_10613808 3300025936 Unclassified 894
163 Ga0207704_11473131 3300025938 Bacteria 584
164 Ga0207691_10010239 3300025940 Bacteria 8995
165 Ga0207691_10396510 3300025940 Bacteria 1177
166 Ga0207711_10000291 3300025941 Bacteria 53588
167 Ga0207689_10315675 3300025942 Bacteria 1296
168 Ga0207679_10106634 3300025945 Bacteria 2203
169 Ga0207679_10535358 3300025945 Bacteria 1049
170 Ga0207651_10004325 3300025960 Bacteria 7134
171 Ga0207651_10067285 3300025960 Bacteria 2521
172 Ga0207651_10248107 3300025960 Bacteria 1455
173 Ga0207712_10058786 3300025961 Unclassified 2718
174 Ga0207658_10000008 3300025986 Bacteria 265351
175 Ga0207658_10709007 3300025986 Bacteria 910
176 Ga0207703_10059154 3300026035 Unclassified 3130
177 Ga0207708_10003218 3300026075 Bacteria 12026
178 Ga0207708_10008137 3300026075 Bacteria 7767
179 Ga0207708_10418163 3300026075 Bacteria 1111
180 Ga0207641_10010160 3300026088 Bacteria 7741
181 Ga0207641_10339792 3300026088 Bacteria 1429
182 Ga0207648_10004114 3300026089 Bacteria 15054
183 Ga0207676_10000024 3300026095 Bacteria 265351
184 Ga0207676_10048238 3300026095 Bacteria 3305
185 Ga0207676_10502547 3300026095 Bacteria 1151
186 Ga0207676_11543134 3300026095 Bacteria 661
187 Ga0207674_10026543 3300026116 Bacteria 6147
188 Ga0207675_100025341 3300026118 Bacteria 5519
189 Ga0207683_10307793 3300026121 Bacteria 1450
190 Ga0209983_1086061 3300027665 Bacteria 706
191 Ga0207428_10039057 3300027907 Bacteria 3855
192 Ga0207428_10045169 3300027907 Bacteria 3550
193 Ga0207428_10119887 3300027907 Bacteria 2018
194 Ga0268266_10008312 3300028379 Bacteria 9241
195 Ga0268265_10011870 3300028380 Bacteria 5889
196 Ga0268265_10032112 3300028380 Bacteria 3799
197 Ga0268265_10749018 3300028380 Unclassified 948
198 Ga0268265_10849390 3300028380 Bacteria 893
199 Ga0268264_10000323 3300028381 Bacteria 75489
200 Ga0265760_10090212 3300031090 Bacteria 959
201 Ga0316576_10011091 3300031727 Bacteria 5886
202 Ga0316578_10526503 3300031728 Bacteria 695
203 Ga0307405_10346133 3300031731 Bacteria 1145
204 Ga0307412_10389677 3300031911 Bacteria 1131
205 Ga0307409_100221426 3300031995 Bacteria 1709
206 Ga0373940_0028835 3300035088 Bacteria 1467
207 Ga0373940_0142095 3300035088 Unclassified 759
208 Ga0373949_0048754 3300035090 Bacteria 1062
209 Ga0373949_0069794 3300035090 Bacteria 918
210 Ga0373951_0158355 3300035091 Unclassified 639
211 Ga0373952_0043644 3300035092 Unclassified 1045
212 Ga0373961_0053290 3300035241 Bacteria 1207
213 Ga0316584_0197441 3300036712 Bacteria 1486
214 Ga0451576_0019413 3300045051 Bacteria 7419
215 Ga0451576_0044627 3300045051 Bacteria 4672
216 Ga0451576_0073045 3300045051 Bacteria 3569
217 Ga0451576_0218718 3300045051 Bacteria 1989
218 Ga0451576_0423379 3300045051 Bacteria 1397
219 Ga0451576_2418897 3300045051 Archaea 537
220 Ga0495639_0292739 3300046475 Bacteria 811
221 Ga0495594_0003143 3300046499 Bacteria 8541
222 Ga0495642_0008871 3300046528 Bacteria 3847
223 Ga0495598_0006420 3300046537 Bacteria 2658
224 Ga0495598_0014012 3300046537 Bacteria 1998
225 Ga0495609_0224565 3300046538 Bacteria 779
226 Ga0495609_0258881 3300046538 Bacteria 715
227 Ga0495621_0001989 3300046539 Bacteria 5378
228 Ga0495621_0027171 3300046539 Bacteria 1936
229 Ga0495633_0075742 3300046558 Bacteria 1567
230 Ga0495659_0003657 3300046664 Bacteria 4889
231 Ga0495659_0015253 3300046664 Bacteria 2524
232 Ga0495659_0018869 3300046664 Bacteria 2302
233 Ga0495659_0043186 3300046664 Bacteria 1616
234 Ga0495659_0052729 3300046664 Bacteria 1485
235 Ga0495659_0129679 3300046664 Bacteria 999
236 Ga0495588_0003949 3300046674 Bacteria 6508
237 Ga0495669_0402054 3300046684 Bacteria 664
238 Ga0495670_0612878 3300046691 Bacteria 593
239 Ga0495685_113839 3300047447 Bacteria 889
240 Ga0495685_154431 3300047447 Bacteria 745
241 Ga0496106_0082518 3300048909 Bacteria 2471
242 Ga0496108_0278194 3300048911 Unclassified 1457
243 Ga0496108_0465213 3300048911 Bacteria 1105
244 Ga0496109_0773452 3300048912 Bacteria 898
245 Ga0496121_0539554 3300048924 Bacteria 732
246 Ga0496125_0105160 3300048928 Unclassified 2064
247 Ga0501031_0209286 3300049568 Bacteria 1271
248 Ga0501040_0109302 3300049576 Bacteria 1933
249 Ga0501040_0276404 3300049576 Bacteria 1199
250 Ga0501040_0879780 3300049576 Bacteria 649
251 Ga0501041_0017306 3300049577 Bacteria 4289
252 Ga0501041_0024934 3300049577 Bacteria 3592
253 Ga0501042_0011747 3300049578 Bacteria 5916
254 Ga0501046_0053448 3300049580 Bacteria 3181
255 Ga0501046_0645124 3300049580 Bacteria 749
256 Ga0501047_1072977 3300049581 Bacteria 619
257 Ga0501048_0114113 3300049582 Bacteria 1908
258 Ga0501072_0099264 3300049588 Bacteria 2314
259 Ga0501072_0131847 3300049588 Bacteria 1992
260 Ga0501073_0729616 3300049589 Bacteria 683
261 Ga0501074_0198984 3300049590 Bacteria 1428
262 Ga0501074_0531036 3300049590 Bacteria 833
263 Ga0501075_0147340 3300049591 Bacteria 1794
264 Ga0501076_0031371 3300049592 Bacteria 4143
265 Ga0501076_1652503 3300049592 Bacteria 525
266 Ga0501233_125715 3300049668 Bacteria 697
267 Ga0501257_083244 3300049686 Unclassified 827
268 Ga0501079_0003512 3300049741 Bacteria 11523
269 Ga0501079_0042016 3300049741 Unclassified 3531
270 Ga0501079_0074849 3300049741 Bacteria 2618
271 Ga0501080_0195075 3300049742 Bacteria 1860
272 Ga0501081_0010767 3300049743 Bacteria 5972
273 Ga0501081_0299765 3300049743 Unclassified 1179
274 Ga0501045_0055581 3300049824 Bacteria 2894
275 Ga0501045_0141590 3300049824 Bacteria 1788
276 nmdc:mga05p37_1373565_c1 3300050507 Unclassified 714
277 nmdc:mga05p37_1507259_c1 3300050507 Bacteria 669
278 nmdc:mga05p37_1579316_c1 3300050507 Bacteria 648
279 nmdc:mga05p37_420791_c1 3300050507 Bacteria 1555
280 nmdc:mga05p37_4413_c1 3300050507 Bacteria 16447
281 nmdc:mga05p37_631868_c1 3300050507 Bacteria 1203
282 nmdc:mga05p37_7453_c1 3300050507 Bacteria 12901
283 nmdc:mga09592_1065097_c1 3300050508 Bacteria 673
284 nmdc:mga09592_1662_c1 3300050508 Bacteria 17911
285 nmdc:mga09592_22846_c1 3300050508 Bacteria 5160
286 nmdc:mga09592_3341_c1 3300050508 Bacteria 12971
287 nmdc:mga09592_492339_c1 3300050508 Bacteria 1056
288 nmdc:mga09592_599560_c1 3300050508 Bacteria 944
289 nmdc:mga09592_655982_c1 3300050508 Bacteria 896
290 nmdc:mga0qj67_168233_c1 3300050509 Bacteria 1780
291 nmdc:mga0qj67_24285_c1 3300050509 Bacteria 4672
292 nmdc:mga0qj67_36661_c1 3300050509 Bacteria 3838
293 nmdc:mga0qj67_441896_c1 3300050509 Bacteria 1048
294 nmdc:mga0qj67_534779_c1 3300050509 Unclassified 941
295 nmdc:mga06r32_13335_c1 3300050510 Bacteria 7444
296 nmdc:mga06r32_29909_c1 3300050510 Bacteria 5109
297 nmdc:mga06r32_363421_c1 3300050510 Bacteria 1431
298 nmdc:mga06r32_3782_c1 3300050510 Bacteria 13538
299 nmdc:mga06r32_598313_c1 3300050510 Unclassified 1074
300 nmdc:mga06r32_696244_c1 3300050510 Bacteria 982
301 nmdc:mga06r32_92476_c1 3300050510 Bacteria 2957
302 nmdc:mga08y16_1106321_c1 3300050511 Bacteria 767
303 nmdc:mga08y16_27069_c1 3300050511 Bacteria 6042
304 nmdc:mga08y16_321662_c1 3300050511 Bacteria 1593
305 nmdc:mga08y16_429142_c1 3300050511 Bacteria 1350
306 nmdc:mga08y16_60070_c1 3300050511 Bacteria 3971
307 nmdc:mga0n895_11429_c1 3300050512 Bacteria 7921
308 nmdc:mga0n895_1272_c1 3300050512 Bacteria 18627
309 nmdc:mga0n895_34719_c1 3300050512 Bacteria 4857
310 nmdc:mga0n895_352321_c1 3300050512 Bacteria 1491
311 nmdc:mga0n895_424012_c1 3300050512 Bacteria 1345
312 nmdc:mga0n895_878613_c1 3300050512 Bacteria 883
313 nmdc:mga0rr50_21374_c1 3300050513 Bacteria 4416
314 nmdc:mga0rr50_29338_c1 3300050513 Bacteria 3878
315 nmdc:mga0a205_14610_c1 3300050515 Bacteria 7327
316 nmdc:mga0a205_202773_c1 3300050515 Bacteria 1874
317 nmdc:mga0a205_2251_c2 3300050515 Bacteria 15425
318 nmdc:mga0a205_339896_c1 3300050515 Bacteria 1370
319 nmdc:mga0a205_8263_c1 3300050515 Bacteria 9462
320 Ga0500564_004313 3300053138 Bacteria 5678
321 Ga0501084_0063964 3300054114 Bacteria 3080
322 Ga0501084_0081258 3300054114 Bacteria 2718
323 Ga0501082_0094311 3300060353 Bacteria 2586
324 Ga0501082_0195987 3300060353 Bacteria 1757
325 Ga0530510_0002664 3300061734 Bacteria 12271
326 Ga0530510_0521425 3300061734 Bacteria 901
327 nmdc:mga00v17_95293_c1
328 SwRhRL2b_contig_1332398
329 Ga0065704_10462243
330 Ga0065715_10204829
331 Ga0065707_10000981
332 Ga0070690_101218302
333 Ga0070670_100000011
334 Ga0068869_100409929
335 Ga0070666_10009326
336 Ga0070689_100631960
337 Ga0070692_10013948
338 Ga0070692_10028847
339 Ga0070668_100345897
340 Ga0070669_100010224
341 Ga0070669_100018002
342 Ga0070669_100666015
343 Ga0070675_100036038
344 Ga0070675_100131318
345 Ga0070671_100000026
346 Ga0070671_100572084
347 Ga0070674_100854032
348 Ga0070673_100030166
349 Ga0070673_100070393
350 Ga0070673_100163965
351 Ga0070688_100017386
352 Ga0070688_100051698
353 Ga0070688_100216739
354 Ga0070688_100276374
355 Ga0070688_100754368
356 Ga0070667_100000092
357 Ga0070701_10001436
358 Ga0070701_10194870
359 Ga0070701_10240558
360 Ga0070700_100012741
361 Ga0070700_100107395
362 Ga0070694_100042021
363 Ga0070663_101372475
364 Ga0070685_10000035
365 Ga0070707_100548226
366 Ga0070698_100203767
367 Ga0070697_100309426
368 Ga0070672_100050337
369 Ga0070695_101401793
370 Ga0070696_101163353
371 Ga0070665_100039674
372 Ga0070704_100000699
373 Ga0070704_100035622
374 Ga0070664_100294793
375 Ga0068857_100019297
376 Ga0068852_100394155
377 Ga0068859_100008287
378 Ga0068859_100072197
379 Ga0068864_100000020
380 Ga0068864_100043255
381 Ga0068864_100582128
382 Ga0068864_100782143
383 Ga0068866_10579388
384 Ga0068861_100005109
385 Ga0068870_10010612
386 Ga0068870_10018080
387 Ga0068858_100039522
388 Ga0068858_100059201
389 Ga0068860_100002884
390 Ga0068860_100384674
391 Ga0068860_101112923
392 Ga0068862_100002645
393 Ga0068862_100087702
394 Ga0068862_101719694
395 Ga0070717_10364078
396 Ga0075364_10666364
397 Ga0068871_100449640
398 Ga0075428_100119322
399 Ga0075428_100219947
400 Ga0075428_101559633
401 Ga0075430_100305098
402 Ga0075431_100000722
403 Ga0075431_100001230
404 Ga0075431_100046729
405 Ga0075431_100316789
406 Ga0075431_101276664
407 Ga0075433_10001985
408 Ga0075433_10005846
409 Ga0075433_10006818
410 Ga0075433_10030810
411 Ga0075434_100000516
412 Ga0075434_100122321
413 Ga0075434_100133232
414 Ga0075434_100190517
415 Ga0075434_100698842
416 Ga0075429_100008222
417 Ga0075429_100009996
418 Ga0075429_100068775
419 Ga0075429_100928127
420 Ga0075429_101034601
421 Ga0068865_100007605
422 Ga0097620_100008287
423 Ga0097620_100072199
424 Ga0079104_1018599
425 Ga0075435_100019609
426 Ga0075435_100022117
427 Ga0075435_100558703
428 Ga0075435_100601562
429 Ga0105244_10196039
430 Ga0111539_10043228
431 Ga0111539_10049337
432 Ga0111539_10192319
433 Ga0111539_11773546
434 Ga0114129_10002847
435 Ga0114129_10059247
436 Ga0114129_10130278
437 Ga0114129_10136266
438 Ga0114129_10208760
439 Ga0114129_10262878
440 Ga0114129_10465492
441 Ga0114129_10555567
442 Ga0114129_11439215
443 Ga0105243_10269203
444 Ga0105248_10136111
445 Ga0105249_10033254
446 Ga0105249_10037930
447 Ga0105249_10076016
448 Ga0105246_10943087
449 Ga0105246_11361556
450 Ga0157373_10799750
451 Ga0157374_10207920
452 Ga0157374_10386184
453 Ga0157374_10709537
454 Ga0157378_10644063
455 Ga0157378_11529479
456 Ga0163162_10323672
457 Ga0157375_10024440
458 Ga0163163_10000358
459 Ga0163163_11573601
460 Ga0157380_10015158
461 Ga0157380_10386017
462 Ga0157380_10585868
463 Ga0157380_10737590
464 Ga0157377_10141358
465 Ga0157377_10338453
466 Ga0157377_10529011
467 Ga0157379_10061499
468 Ga0157379_10398140
469 Ga0157379_10560475
470 Ga0157376_10484704
471 Ga0157376_10726352
472 Ga0157376_11919348
473 Ga0207697_10000363
474 Ga0207682_10001420
475 Ga0207642_10929848
476 Ga0207680_10020147
477 Ga0207662_10014116
478 Ga0207662_10462562
479 Ga0207681_10007459
480 Ga0207681_10011422
481 Ga0207650_10000025
482 Ga0207659_10024665
483 Ga0207659_10065271
484 Ga0207659_10295332
485 Ga0207644_10000481
486 Ga0207706_10011146
487 Ga0207706_10341506
488 Ga0207670_10613808
489 Ga0207704_11473131
490 Ga0207691_10010239
491 Ga0207691_10396510
492 Ga0207711_10000291
493 Ga0207689_10315675
494 Ga0207679_10106634
495 Ga0207679_10535358
496 Ga0207651_10004325
497 Ga0207651_10067285
498 Ga0207651_10248107
499 Ga0207712_10058786
500 Ga0207658_10000008
501 Ga0207658_10709007
502 Ga0207703_10059154
503 Ga0207708_10003218
504 Ga0207708_10008137
505 Ga0207708_10418163
506 Ga0207641_10010160
507 Ga0207641_10339792
508 Ga0207648_10004114
509 Ga0207676_10000024
510 Ga0207676_10048238
511 Ga0207676_10502547
512 Ga0207676_11543134
513 Ga0207674_10026543
514 Ga0207675_100025341
515 Ga0207683_10307793
516 Ga0209983_1086061
517 Ga0207428_10039057
518 Ga0207428_10045169
519 Ga0207428_10119887
520 Ga0268266_10008312
521 Ga0268265_10011870
522 Ga0268265_10032112
523 Ga0268265_10749018
524 Ga0268265_10849390
525 Ga0268264_10000323
526 Ga0265760_10090212
527 Ga0316576_10011091
528 Ga0316578_10526503
529 Ga0307405_10346133
530 Ga0307412_10389677
531 Ga0307409_100221426
532 Ga0373940_0028835
533 Ga0373940_0142095
534 Ga0373949_0048754
535 Ga0373949_0069794
536 Ga0373951_0158355
537 Ga0373952_0043644
538 Ga0373961_0053290
539 Ga0316584_0197441
540 Ga0451576_0019413
541 Ga0451576_0044627
542 Ga0451576_0073045
543 Ga0451576_0218718
544 Ga0451576_0423379
545 Ga0451576_2418897
546 Ga0495639_0292739
547 Ga0495594_0003143
548 Ga0495642_0008871
549 Ga0495598_0006420
550 Ga0495598_0014012
551 Ga0495609_0224565
552 Ga0495609_0258881
553 Ga0495621_0001989
554 Ga0495621_0027171
555 Ga0495633_0075742
556 Ga0495659_0003657
557 Ga0495659_0015253
558 Ga0495659_0018869
559 Ga0495659_0043186
560 Ga0495659_0052729
561 Ga0495659_0129679
562 Ga0495588_0003949
563 Ga0495669_0402054
564 Ga0495670_0612878
565 Ga0495685_113839
566 Ga0495685_154431
567 Ga0496106_0082518
568 Ga0496108_0278194
569 Ga0496108_0465213
570 Ga0496109_0773452
571 Ga0496121_0539554
572 Ga0496125_0105160
573 Ga0501031_0209286
574 Ga0501040_0109302
575 Ga0501040_0276404
576 Ga0501040_0879780
577 Ga0501041_0017306
578 Ga0501041_0024934
579 Ga0501042_0011747
580 Ga0501046_0053448
581 Ga0501046_0645124
582 Ga0501047_1072977
583 Ga0501048_0114113
584 Ga0501072_0099264
585 Ga0501072_0131847
586 Ga0501073_0729616
587 Ga0501074_0198984
588 Ga0501074_0531036
589 Ga0501075_0147340
590 Ga0501076_0031371
591 Ga0501076_1652503
592 Ga0501233_125715
593 Ga0501257_083244
594 Ga0501079_0003512
595 Ga0501079_0042016
596 Ga0501079_0074849
597 Ga0501080_0195075
598 Ga0501081_0010767
599 Ga0501081_0299765
600 Ga0501045_0055581
601 Ga0501045_0141590
602 nmdc:mga05p37_1373565_c1
603 nmdc:mga05p37_1507259_c1
604 nmdc:mga05p37_1579316_c1
605 nmdc:mga05p37_420791_c1
606 nmdc:mga05p37_4413_c1
607 nmdc:mga05p37_631868_c1
608 nmdc:mga05p37_7453_c1
609 nmdc:mga09592_1065097_c1
610 nmdc:mga09592_1662_c1
611 nmdc:mga09592_22846_c1
612 nmdc:mga09592_3341_c1
613 nmdc:mga09592_492339_c1
614 nmdc:mga09592_599560_c1
615 nmdc:mga09592_655982_c1
616 nmdc:mga0qj67_168233_c1
617 nmdc:mga0qj67_24285_c1
618 nmdc:mga0qj67_36661_c1
619 nmdc:mga0qj67_441896_c1
620 nmdc:mga0qj67_534779_c1
621 nmdc:mga06r32_13335_c1
622 nmdc:mga06r32_29909_c1
623 nmdc:mga06r32_363421_c1
624 nmdc:mga06r32_3782_c1
625 nmdc:mga06r32_598313_c1
626 nmdc:mga06r32_696244_c1
627 nmdc:mga06r32_92476_c1
628 nmdc:mga08y16_1106321_c1
629 nmdc:mga08y16_27069_c1
630 nmdc:mga08y16_321662_c1
631 nmdc:mga08y16_429142_c1
632 nmdc:mga08y16_60070_c1
633 nmdc:mga0n895_11429_c1
634 nmdc:mga0n895_1272_c1
635 nmdc:mga0n895_34719_c1
636 nmdc:mga0n895_352321_c1
637 nmdc:mga0n895_424012_c1
638 nmdc:mga0n895_878613_c1
639 nmdc:mga0rr50_21374_c1
640 nmdc:mga0rr50_29338_c1
641 nmdc:mga0a205_14610_c1
642 nmdc:mga0a205_202773_c1
643 nmdc:mga0a205_2251_c2
644 nmdc:mga0a205_339896_c1
645 nmdc:mga0a205_8263_c1
646 Ga0500564_004313
647 Ga0501084_0063964
648 Ga0501084_0081258
649 Ga0501082_0094311
650 Ga0501082_0195987
651 Ga0530510_0002664
652 Ga0530510_0521425

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

3

104

0.97

PF14437

MafB19-deam

MafB19-like deaminase

4

149

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e2r-assembly1.cif.gz_A crystal structure of tadac-1.14 0.9569 1 144
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9448 1 149
8e2r-assembly1.cif.gz_A crystal structure of tadac-1.14 0.944 1 144
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.943 1 145
8e2q-assembly2.cif.gz_C crystal structure of tadac-1.17 in a complex with ssdna 0.9419 1 145
ID Description Score Start End Superfamily
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9448 1 149 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9342 4 149 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9327 1 149 3.40.140.10
2a8nA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9296 5 130 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9271 4 150 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A7Y4TF05-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9567 1 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A451DBW7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9559 4 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A2W4PJM2-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9553 4 148 GO:0002100
GO:0008270
GO:0052717
AF-A0A2V7ZKE2-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9519 4 147 GO:0002100
GO:0008270
GO:0052717
AF-A0A2E5H1W6-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9513 2 149 GO:0002100
GO:0008270
GO:0052717

Map