F408532

General Info

Members Datasets Scaffolds Average Seq Length
326 156 652 192

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0004380|Ga0501069_0004380_1372_2043
Length 223
Sequence MSHARFRTGASRRSEACPPFDRKTEQEGTLVPEAHLEPVASGLAPVTPGWFVVNTADAAWMNNDRTGGVCIFESDDYVLRGRPDLTEYMKPDAGFTIRVFPPGETGMQYHAESVQEDFLVLAGECVLIIEDEERHLKAWDFVHCPPMTAHGFVARGDGPCVILATGNRRDDLERVYPRSEVARRNGAEAVLRPGAGSDGEQEREPYGRWSVARPTTWAELPWS

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
91 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
92 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
96 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
97 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 1.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 3.37
Rhizosphere 95.4
Stem 0
Stem Tuber 0
Unclassified 22.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0004380 3300049585 Bacteria 7290
2 JGI25407J50210_10000353 3300003373 Bacteria 8624
3 Ga0070658_10350170 3300005327 Unclassified 1264
4 Ga0070683_100175557 3300005329 Unclassified 2034
5 Ga0070683_101322207 3300005329 Unclassified 693
6 Ga0070680_100037475 3300005336 Bacteria 3918
7 Ga0070682_100319618 3300005337 Bacteria 1146
8 Ga0068868_100144169 3300005338 Bacteria 1957
9 Ga0070660_101214537 3300005339 Unclassified 639
10 Ga0070674_100712555 3300005356 Unclassified 859
11 Ga0070659_100314446 3300005366 Unclassified 1308
12 Ga0070714_100100493 3300005435 Bacteria 2548
13 Ga0070714_100229206 3300005435 Unclassified 1711
14 Ga0070714_100882145 3300005435 Unclassified 868
15 Ga0070713_100340135 3300005436 Unclassified 1390
16 Ga0070710_10027804 3300005437 Bacteria 3020
17 Ga0070711_100039436 3300005439 Bacteria 3182
18 Ga0070681_10300548 3300005458 Unclassified 1515
19 Ga0070679_100457686 3300005530 Bacteria 1220
20 Ga0070684_100006518 3300005535 Bacteria 9037
21 Ga0070684_100008734 3300005535 Bacteria 7942
22 Ga0070684_100068397 3300005535 Bacteria 3121
23 Ga0070684_100286433 3300005535 Bacteria 1510
24 Ga0068855_100015489 3300005563 Bacteria 9180
25 Ga0070664_100271749 3300005564 Unclassified 1527
26 Ga0070664_100544532 3300005564 Bacteria 1073
27 Ga0068857_100013352 3300005577 Bacteria 7154
28 Ga0068857_100108290 3300005577 Bacteria 2497
29 Ga0068854_100052351 3300005578 Bacteria 2927
30 Ga0068856_100132500 3300005614 Bacteria 2497
31 Ga0068856_100164411 3300005614 Bacteria 2230
32 Ga0068856_100174645 3300005614 Unclassified 2161
33 Ga0070702_100546044 3300005615 Bacteria 859
34 Ga0070702_100572630 3300005615 Unclassified 842
35 Ga0068852_100210396 3300005616 Bacteria 1845
36 Ga0068852_101175640 3300005616 Unclassified 788
37 Ga0068866_10420476 3300005718 Unclassified 867
38 Ga0081455_10008482 3300005937 Bacteria 10681
39 Ga0081455_10011880 3300005937 Bacteria 8719
40 Ga0081455_10014065 3300005937 Bacteria 7866
41 Ga0081455_10021246 3300005937 Bacteria 6091
42 Ga0081455_10053722 3300005937 Bacteria 3440
43 Ga0081455_10071790 3300005937 Bacteria 2868
44 Ga0081455_10111699 3300005937 Bacteria 2170
45 Ga0081455_10175131 3300005937 Unclassified 1630
46 Ga0081538_10000461 3300005981 Bacteria 45573
47 Ga0081538_10001743 3300005981 Bacteria 22114
48 Ga0081538_10001944 3300005981 Bacteria 20689
49 Ga0081538_10004189 3300005981 Bacteria 13379
50 Ga0081538_10008995 3300005981 Bacteria 8391
51 Ga0081538_10018172 3300005981 Bacteria 5296
52 Ga0081538_10062448 3300005981 Bacteria 2124
53 Ga0081538_10074200 3300005981 Unclassified 1853
54 Ga0081538_10206503 3300005981 Unclassified 798
55 Ga0070717_10971844 3300006028 Unclassified 773
56 Ga0075365_10065213 3300006038 Bacteria 2440
57 Ga0070712_100100352 3300006175 Unclassified 2139
58 Ga0097621_100486609 3300006237 Unclassified 1116
59 Ga0075428_100589225 3300006844 Unclassified 1188
60 Ga0075431_100267552 3300006847 Unclassified 1733
61 Ga0075433_10110750 3300006852 Bacteria 2436
62 Ga0075434_100020090 3300006871 Bacteria 6471
63 Ga0075436_100011983 3300006914 Bacteria 5947
64 Ga0075435_100001474 3300007076 Bacteria 15114
65 Ga0105240_10116214 3300009093 Bacteria 3228
66 Ga0105245_10718642 3300009098 Bacteria 1033
67 Ga0114129_10475910 3300009147 Bacteria 1635
68 Ga0105243_10624680 3300009148 Unclassified 1040
69 Ga0105241_11527088 3300009174 Unclassified 644
70 Ga0105242_10146671 3300009176 Unclassified 2053
71 Ga0105242_11399673 3300009176 Unclassified 727
72 Ga0105237_10082597 3300009545 Bacteria 3203
73 Ga0105238_10144657 3300009551 Bacteria 2354
74 Ga0105249_10480772 3300009553 Bacteria 1285
75 Ga0105239_10163428 3300010375 Bacteria 2489
76 Ga0157373_10425831 3300013100 Unclassified 953
77 Ga0157370_10631357 3300013104 Unclassified 980
78 Ga0157369_10015673 3300013105 Bacteria 8541
79 Ga0157369_10385460 3300013105 Bacteria 1454
80 Ga0157374_10047485 3300013296 Bacteria 3981
81 Ga0157374_10905640 3300013296 Unclassified 900
82 Ga0157372_10023083 3300013307 Bacteria 6741
83 Ga0157372_10071439 3300013307 Bacteria 3909
84 Ga0182008_10019728 3300014497 Bacteria 3476
85 Ga0157376_11254624 3300014969 Bacteria 770
86 Ga0182007_10015373 3300015262 Bacteria 2857
87 Ga0197907_10217985 3300020069 Bacteria 1195
88 Ga0206356_10426227 3300020070 Bacteria 1312
89 Ga0206354_10137514 3300020081 Bacteria 1596
90 Ga0224712_10206451 3300022467 Bacteria 894
91 Ga0207692_10012847 3300025898 Bacteria 3612
92 Ga0207654_10385910 3300025911 Bacteria 971
93 Ga0207707_10016397 3300025912 Bacteria 6463
94 Ga0207707_10056370 3300025912 Bacteria 3419
95 Ga0207695_10025288 3300025913 Bacteria 6651
96 Ga0207671_10260526 3300025914 Bacteria 1365
97 Ga0207693_10067338 3300025915 Bacteria 2804
98 Ga0207660_10113525 3300025917 Bacteria 2042
99 Ga0207694_10164686 3300025924 Bacteria 1792
100 Ga0207650_10762710 3300025925 Bacteria 819
101 Ga0207687_10112127 3300025927 Bacteria 2026
102 Ga0207700_10280733 3300025928 Bacteria 1433
103 Ga0207664_10235149 3300025929 Bacteria 1594
104 Ga0207690_10193113 3300025932 Bacteria 1541
105 Ga0207669_10090319 3300025937 Unclassified 1992
106 Ga0207661_10051735 3300025944 Bacteria 3278
107 Ga0207661_10074450 3300025944 Bacteria 2783
108 Ga0207661_10210460 3300025944 Unclassified 1713
109 Ga0207661_10256680 3300025944 Bacteria 1556
110 Ga0207679_10126302 3300025945 Bacteria 2044
111 Ga0207678_10486234 3300026067 Bacteria 1075
112 Ga0207702_10087495 3300026078 Bacteria 2720
113 Ga0207702_10403617 3300026078 Unclassified 1318
114 Ga0207674_10015815 3300026116 Bacteria 8273
115 Ga0207674_10161872 3300026116 Bacteria 2192
116 Ga0207698_10120523 3300026142 Bacteria 2219
117 Ga0265338_10072137 3300028800 Bacteria 2950
118 Ga0265338_10120803 3300028800 Unclassified 2088
119 Ga0265328_10267060 3300031239 Unclassified 657
120 Ga0265327_10008255 3300031251 Bacteria 7801
121 Ga0265313_10033903 3300031595 Bacteria 2588
122 Ga0307406_10523510 3300031901 Unclassified 965
123 Ga0395899_0009386 3300037312 Bacteria 7512
124 Ga0395900_0100482 3300037418 Unclassified 2971
125 Ga0395900_0230810 3300037418 Unclassified 1861
126 Ga0395900_0365579 3300037418 Bacteria 1413
127 Ga0395898_0064437 3300037466 Unclassified 3554
128 Ga0395905_0034730 3300037471 Unclassified 4735
129 Ga0395905_0597558 3300037471 Bacteria 1005
130 Ga0395905_0889953 3300037471 Bacteria 793
131 Ga0395901_0034132 3300038443 Bacteria 5253
132 Ga0395901_0081167 3300038443 Unclassified 3387
133 Ga0395901_0366198 3300038443 Bacteria 1485
134 Ga0439439_0013012 3300041406 Bacteria 2014
135 Ga0439453_0025156 3300041408 Bacteria 1097
136 Ga0451847_0972254 3300041503 Bacteria 627
137 Ga0451853_0141805 3300041512 Unclassified 984
138 Ga0439433_0001312 3300041999 Bacteria 5110
139 Ga0439449_0038809 3300042007 Bacteria 1770
140 Ga0439451_002455 3300042009 Unclassified 3757
141 Ga0439456_072099 3300042013 Unclassified 766
142 Ga0439446_0008142 3300042156 Bacteria 2775
143 Ga0439434_0044957 3300042435 Unclassified 1361
144 Ga0439435_0221310 3300042436 Bacteria 630
145 Ga0466966_0035867 3300044684 Bacteria 3203
146 Ga0466961_0009155 3300044693 Bacteria 6305
147 Ga0466963_0003952 3300044694 Bacteria 8575
148 Ga0466964_0005315 3300044706 Bacteria 4779
149 Ga0451576_0259690 3300045051 Bacteria 1815
150 Ga0466958_0006786 3300045836 Bacteria 6256
151 Ga0466967_0477114 3300045976 Unclassified 1221
152 Ga0495620_0350536 3300046515 Unclassified 560
153 Ga0495684_0028380 3300047471 Bacteria 4297
154 Ga0496101_0082069 3300048904 Unclassified 2386
155 Ga0496102_1404059 3300048905 Unclassified 617
156 Ga0496104_0050459 3300048907 Bacteria 3925
157 Ga0496105_0150370 3300048908 Bacteria 1914
158 Ga0496108_0008835 3300048911 Bacteria 8165
159 Ga0496109_0003191 3300048912 Bacteria 13643
160 Ga0496109_0065048 3300048912 Bacteria 3338
161 Ga0496110_0003521 3300048913 Bacteria 12017
162 Ga0496111_0000134 3300048914 Bacteria 32642
163 Ga0496111_0105233 3300048914 Bacteria 2076
164 Ga0496113_0037899 3300048916 Unclassified 3541
165 Ga0501031_0010987 3300049568 Bacteria 5900
166 Ga0501031_0080745 3300049568 Bacteria 2119
167 Ga0501031_0223636 3300049568 Unclassified 1225
168 Ga0501031_0358657 3300049568 Bacteria 943
169 Ga0501031_0400432 3300049568 Bacteria 888
170 Ga0501032_0086411 3300049569 Bacteria 2084
171 Ga0501032_0204798 3300049569 Unclassified 1287
172 Ga0501033_0022274 3300049570 Bacteria 4780
173 Ga0501033_0066278 3300049570 Unclassified 2655
174 Ga0501033_0125074 3300049570 Unclassified 1864
175 Ga0501033_0325452 3300049570 Bacteria 1079
176 Ga0501036_0012311 3300049572 Bacteria 7082
177 Ga0501036_0040462 3300049572 Bacteria 3942
178 Ga0501036_0163655 3300049572 Unclassified 1875
179 Ga0501036_0166322 3300049572 Unclassified 1859
180 Ga0501036_0573826 3300049572 Bacteria 937
181 Ga0501036_1109896 3300049572 Unclassified 646
182 Ga0501037_0001342 3300049573 Bacteria 18062
183 Ga0501037_0002387 3300049573 Bacteria 13558
184 Ga0501037_0124806 3300049573 Bacteria 1849
185 Ga0501038_0003954 3300049574 Bacteria 13773
186 Ga0501038_0007028 3300049574 Bacteria 10397
187 Ga0501038_0010683 3300049574 Bacteria 8396
188 Ga0501038_0059178 3300049574 Bacteria 3282
189 Ga0501039_0005866 3300049575 Bacteria 9305
190 Ga0501039_0011636 3300049575 Bacteria 6700
191 Ga0501039_0014170 3300049575 Bacteria 6104
192 Ga0501039_0037193 3300049575 Bacteria 3756
193 Ga0501040_0006795 3300049576 Bacteria 7417
194 Ga0501040_0014881 3300049576 Bacteria 5136
195 Ga0501040_0024935 3300049576 Bacteria 4018
196 Ga0501040_0181150 3300049576 Bacteria 1494
197 Ga0501040_0192372 3300049576 Bacteria 1448
198 Ga0501040_0216591 3300049576 Bacteria 1362
199 Ga0501040_0271510 3300049576 Bacteria 1211
200 Ga0501040_0289949 3300049576 Bacteria 1169
201 Ga0501040_0773620 3300049576 Unclassified 694
202 Ga0501041_0006951 3300049577 Bacteria 6638
203 Ga0501041_0007528 3300049577 Bacteria 6392
204 Ga0501041_0011657 3300049577 Bacteria 5201
205 Ga0501041_0019461 3300049577 Bacteria 4054
206 Ga0501041_0714134 3300049577 Unclassified 642
207 Ga0501042_0007018 3300049578 Bacteria 7354
208 Ga0501042_0008246 3300049578 Bacteria 6867
209 Ga0501042_0153568 3300049578 Bacteria 1660
210 Ga0501042_0405665 3300049578 Bacteria 987
211 Ga0501042_0557158 3300049578 Bacteria 833
212 Ga0501043_0004913 3300049579 Bacteria 10808
213 Ga0501043_0018328 3300049579 Bacteria 5489
214 Ga0501043_0115998 3300049579 Bacteria 2102
215 Ga0501043_0264749 3300049579 Unclassified 1321
216 Ga0501046_0005570 3300049580 Bacteria 11253
217 Ga0501046_0011866 3300049580 Bacteria 7435
218 Ga0501046_0024951 3300049580 Bacteria 4898
219 Ga0501046_0044438 3300049580 Bacteria 3533
220 Ga0501046_0359410 3300049580 Unclassified 1056
221 Ga0501048_0012448 3300049582 Bacteria 6328
222 Ga0501048_0014531 3300049582 Bacteria 5826
223 Ga0501048_0022013 3300049582 Bacteria 4665
224 Ga0501048_0082542 3300049582 Bacteria 2267
225 Ga0501048_0088820 3300049582 Bacteria 2180
226 Ga0501048_0316358 3300049582 Bacteria 1112
227 Ga0501048_0388627 3300049582 Bacteria 997
228 Ga0501048_0455703 3300049582 Bacteria 916
229 Ga0501048_0593029 3300049582 Bacteria 795
230 Ga0501068_0001860 3300049584 Bacteria 11209
231 Ga0501068_0003039 3300049584 Bacteria 8960
232 Ga0501068_0063450 3300049584 Bacteria 2247
233 Ga0501069_0005356 3300049585 Bacteria 6673
234 Ga0501069_0218322 3300049585 Bacteria 1107
235 Ga0501070_0005294 3300049586 Bacteria 11009
236 Ga0501070_0039819 3300049586 Bacteria 3919
237 Ga0501070_0042381 3300049586 Bacteria 3791
238 Ga0501070_0306584 3300049586 Bacteria 1293
239 Ga0501071_0006169 3300049587 Bacteria 7772
240 Ga0501071_0016948 3300049587 Bacteria 5014
241 Ga0501071_0041892 3300049587 Bacteria 3279
242 Ga0501071_0092763 3300049587 Bacteria 2220
243 Ga0501071_0255700 3300049587 Unclassified 1322
244 Ga0501071_0383711 3300049587 Bacteria 1072
245 Ga0501072_0005714 3300049588 Bacteria 9471
246 Ga0501072_0006231 3300049588 Bacteria 9087
247 Ga0501072_0009619 3300049588 Bacteria 7352
248 Ga0501072_0010148 3300049588 Bacteria 7172
249 Ga0501072_0016156 3300049588 Bacteria 5725
250 Ga0501072_0478467 3300049588 Unclassified 985
251 Ga0501073_0004020 3300049589 Bacteria 11048
252 Ga0501073_0029439 3300049589 Bacteria 3924
253 Ga0501074_0017499 3300049590 Bacteria 5202
254 Ga0501074_0018894 3300049590 Bacteria 5005
255 Ga0501074_0049119 3300049590 Bacteria 3046
256 Ga0501074_0330801 3300049590 Bacteria 1081
257 Ga0501075_0016174 3300049591 Bacteria 5369
258 Ga0501075_0026422 3300049591 Bacteria 4273
259 Ga0501075_0027600 3300049591 Bacteria 4184
260 Ga0501075_0118361 3300049591 Bacteria 2014
261 Ga0501075_0120247 3300049591 Bacteria 1998
262 Ga0501075_0174224 3300049591 Unclassified 1642
263 Ga0501076_0001766 3300049592 Bacteria 14627
264 Ga0501076_0004224 3300049592 Bacteria 10163
265 Ga0501076_0035784 3300049592 Bacteria 3885
266 Ga0501076_0063006 3300049592 Bacteria 2953
267 Ga0501076_1182638 3300049592 Unclassified 629
268 Ga0501077_0015913 3300049593 Bacteria 4738
269 Ga0501077_0026654 3300049593 Bacteria 3668
270 Ga0501077_0037589 3300049593 Bacteria 3083
271 Ga0501079_0025964 3300049741 Bacteria 4492
272 Ga0501079_0039442 3300049741 Bacteria 3643
273 Ga0501079_0112748 3300049741 Bacteria 2113
274 Ga0501079_0126679 3300049741 Bacteria 1986
275 Ga0501079_0342326 3300049741 Bacteria 1171
276 Ga0501080_0013450 3300049742 Bacteria 7528
277 Ga0501080_0018014 3300049742 Bacteria 6539
278 Ga0501080_0027125 3300049742 Bacteria 5326
279 Ga0501081_0015687 3300049743 Bacteria 5000
280 Ga0501081_0037395 3300049743 Bacteria 3311
281 Ga0501081_0048999 3300049743 Bacteria 2907
282 Ga0501081_0326814 3300049743 Unclassified 1128
283 Ga0501081_0349464 3300049743 Bacteria 1089
284 Ga0501083_0003057 3300049744 Bacteria 11631
285 Ga0501083_0006547 3300049744 Bacteria 8264
286 Ga0501083_0156188 3300049744 Unclassified 1493
287 Ga0501083_0229509 3300049744 Bacteria 1209
288 Ga0501035_0046718 3300049822 Bacteria 3894
289 Ga0501035_0052291 3300049822 Bacteria 3655
290 Ga0501035_0136485 3300049822 Bacteria 2135
291 Ga0501035_0413486 3300049822 Bacteria 1121
292 Ga0501035_0508132 3300049822 Unclassified 991
293 Ga0501035_0838778 3300049822 Bacteria 732
294 Ga0501044_0504974 3300049823 Unclassified 1110
295 Ga0501045_0002032 3300049824 Bacteria 13666
296 Ga0501045_0002453 3300049824 Bacteria 12611
297 Ga0501045_0006759 3300049824 Bacteria 7942
298 Ga0501045_0009549 3300049824 Bacteria 6787
299 Ga0501045_0034329 3300049824 Bacteria 3682
300 Ga0501045_0115014 3300049824 Bacteria 1996
301 Ga0501045_0732817 3300049824 Bacteria 729
302 nmdc:mga0yw44_127078_c1 3300050492 Bacteria 1647
303 nmdc:mga06r32_74252_c1 3300050510 Unclassified 3296
304 nmdc:mga08y16_169844_c1 3300050511 Bacteria 2265
305 nmdc:mga08y16_265925_c1 3300050511 Archaea 1770
306 nmdc:mga0n895_230777_c1 3300050512 Bacteria 1879
307 nmdc:mga08x19_96801_c1 3300050514 Bacteria 1954
308 Ga0501084_0007977 3300054114 Bacteria 8716
309 Ga0501084_0029841 3300054114 Bacteria 4560
310 Ga0501084_0073293 3300054114 Bacteria 2867
311 Ga0501084_0132222 3300054114 Unclassified 2101
312 Ga0501084_0284373 3300054114 Bacteria 1397
313 Ga0501084_0348861 3300054114 Bacteria 1250
314 Ga0501084_0351284 3300054114 Bacteria 1246
315 Ga0501084_0482722 3300054114 Bacteria 1047
316 Ga0590071_040983 3300059421 Bacteria 1115
317 Ga0501082_0033004 3300060353 Bacteria 4464
318 Ga0501082_0077917 3300060353 Bacteria 2858
319 Ga0501082_0118733 3300060353 Bacteria 2291
320 Ga0501082_0541048 3300060353 Bacteria 1018
321 Ga0530510_0009903 3300061734 Bacteria 6689
322 Ga0530510_0021695 3300061734 Bacteria 4569
323 Ga0530510_0133829 3300061734 Bacteria 1825
324 Ga0530510_0171168 3300061734 Bacteria 1608
325 Ga0530510_0277836 3300061734 Bacteria 1251
326 Ga0530510_0954531 3300061734 Unclassified 656
327 Ga0501069_0004380
328 JGI25407J50210_10000353
329 Ga0070658_10350170
330 Ga0070683_100175557
331 Ga0070683_101322207
332 Ga0070680_100037475
333 Ga0070682_100319618
334 Ga0068868_100144169
335 Ga0070660_101214537
336 Ga0070674_100712555
337 Ga0070659_100314446
338 Ga0070714_100100493
339 Ga0070714_100229206
340 Ga0070714_100882145
341 Ga0070713_100340135
342 Ga0070710_10027804
343 Ga0070711_100039436
344 Ga0070681_10300548
345 Ga0070679_100457686
346 Ga0070684_100006518
347 Ga0070684_100008734
348 Ga0070684_100068397
349 Ga0070684_100286433
350 Ga0068855_100015489
351 Ga0070664_100271749
352 Ga0070664_100544532
353 Ga0068857_100013352
354 Ga0068857_100108290
355 Ga0068854_100052351
356 Ga0068856_100132500
357 Ga0068856_100164411
358 Ga0068856_100174645
359 Ga0070702_100546044
360 Ga0070702_100572630
361 Ga0068852_100210396
362 Ga0068852_101175640
363 Ga0068866_10420476
364 Ga0081455_10008482
365 Ga0081455_10011880
366 Ga0081455_10014065
367 Ga0081455_10021246
368 Ga0081455_10053722
369 Ga0081455_10071790
370 Ga0081455_10111699
371 Ga0081455_10175131
372 Ga0081538_10000461
373 Ga0081538_10001743
374 Ga0081538_10001944
375 Ga0081538_10004189
376 Ga0081538_10008995
377 Ga0081538_10018172
378 Ga0081538_10062448
379 Ga0081538_10074200
380 Ga0081538_10206503
381 Ga0070717_10971844
382 Ga0075365_10065213
383 Ga0070712_100100352
384 Ga0097621_100486609
385 Ga0075428_100589225
386 Ga0075431_100267552
387 Ga0075433_10110750
388 Ga0075434_100020090
389 Ga0075436_100011983
390 Ga0075435_100001474
391 Ga0105240_10116214
392 Ga0105245_10718642
393 Ga0114129_10475910
394 Ga0105243_10624680
395 Ga0105241_11527088
396 Ga0105242_10146671
397 Ga0105242_11399673
398 Ga0105237_10082597
399 Ga0105238_10144657
400 Ga0105249_10480772
401 Ga0105239_10163428
402 Ga0157373_10425831
403 Ga0157370_10631357
404 Ga0157369_10015673
405 Ga0157369_10385460
406 Ga0157374_10047485
407 Ga0157374_10905640
408 Ga0157372_10023083
409 Ga0157372_10071439
410 Ga0182008_10019728
411 Ga0157376_11254624
412 Ga0182007_10015373
413 Ga0197907_10217985
414 Ga0206356_10426227
415 Ga0206354_10137514
416 Ga0224712_10206451
417 Ga0207692_10012847
418 Ga0207654_10385910
419 Ga0207707_10016397
420 Ga0207707_10056370
421 Ga0207695_10025288
422 Ga0207671_10260526
423 Ga0207693_10067338
424 Ga0207660_10113525
425 Ga0207694_10164686
426 Ga0207650_10762710
427 Ga0207687_10112127
428 Ga0207700_10280733
429 Ga0207664_10235149
430 Ga0207690_10193113
431 Ga0207669_10090319
432 Ga0207661_10051735
433 Ga0207661_10074450
434 Ga0207661_10210460
435 Ga0207661_10256680
436 Ga0207679_10126302
437 Ga0207678_10486234
438 Ga0207702_10087495
439 Ga0207702_10403617
440 Ga0207674_10015815
441 Ga0207674_10161872
442 Ga0207698_10120523
443 Ga0265338_10072137
444 Ga0265338_10120803
445 Ga0265328_10267060
446 Ga0265327_10008255
447 Ga0265313_10033903
448 Ga0307406_10523510
449 Ga0395899_0009386
450 Ga0395900_0100482
451 Ga0395900_0230810
452 Ga0395900_0365579
453 Ga0395898_0064437
454 Ga0395905_0034730
455 Ga0395905_0597558
456 Ga0395905_0889953
457 Ga0395901_0034132
458 Ga0395901_0081167
459 Ga0395901_0366198
460 Ga0439439_0013012
461 Ga0439453_0025156
462 Ga0451847_0972254
463 Ga0451853_0141805
464 Ga0439433_0001312
465 Ga0439449_0038809
466 Ga0439451_002455
467 Ga0439456_072099
468 Ga0439446_0008142
469 Ga0439434_0044957
470 Ga0439435_0221310
471 Ga0466966_0035867
472 Ga0466961_0009155
473 Ga0466963_0003952
474 Ga0466964_0005315
475 Ga0451576_0259690
476 Ga0466958_0006786
477 Ga0466967_0477114
478 Ga0495620_0350536
479 Ga0495684_0028380
480 Ga0496101_0082069
481 Ga0496102_1404059
482 Ga0496104_0050459
483 Ga0496105_0150370
484 Ga0496108_0008835
485 Ga0496109_0003191
486 Ga0496109_0065048
487 Ga0496110_0003521
488 Ga0496111_0000134
489 Ga0496111_0105233
490 Ga0496113_0037899
491 Ga0501031_0010987
492 Ga0501031_0080745
493 Ga0501031_0223636
494 Ga0501031_0358657
495 Ga0501031_0400432
496 Ga0501032_0086411
497 Ga0501032_0204798
498 Ga0501033_0022274
499 Ga0501033_0066278
500 Ga0501033_0125074
501 Ga0501033_0325452
502 Ga0501036_0012311
503 Ga0501036_0040462
504 Ga0501036_0163655
505 Ga0501036_0166322
506 Ga0501036_0573826
507 Ga0501036_1109896
508 Ga0501037_0001342
509 Ga0501037_0002387
510 Ga0501037_0124806
511 Ga0501038_0003954
512 Ga0501038_0007028
513 Ga0501038_0010683
514 Ga0501038_0059178
515 Ga0501039_0005866
516 Ga0501039_0011636
517 Ga0501039_0014170
518 Ga0501039_0037193
519 Ga0501040_0006795
520 Ga0501040_0014881
521 Ga0501040_0024935
522 Ga0501040_0181150
523 Ga0501040_0192372
524 Ga0501040_0216591
525 Ga0501040_0271510
526 Ga0501040_0289949
527 Ga0501040_0773620
528 Ga0501041_0006951
529 Ga0501041_0007528
530 Ga0501041_0011657
531 Ga0501041_0019461
532 Ga0501041_0714134
533 Ga0501042_0007018
534 Ga0501042_0008246
535 Ga0501042_0153568
536 Ga0501042_0405665
537 Ga0501042_0557158
538 Ga0501043_0004913
539 Ga0501043_0018328
540 Ga0501043_0115998
541 Ga0501043_0264749
542 Ga0501046_0005570
543 Ga0501046_0011866
544 Ga0501046_0024951
545 Ga0501046_0044438
546 Ga0501046_0359410
547 Ga0501048_0012448
548 Ga0501048_0014531
549 Ga0501048_0022013
550 Ga0501048_0082542
551 Ga0501048_0088820
552 Ga0501048_0316358
553 Ga0501048_0388627
554 Ga0501048_0455703
555 Ga0501048_0593029
556 Ga0501068_0001860
557 Ga0501068_0003039
558 Ga0501068_0063450
559 Ga0501069_0005356
560 Ga0501069_0218322
561 Ga0501070_0005294
562 Ga0501070_0039819
563 Ga0501070_0042381
564 Ga0501070_0306584
565 Ga0501071_0006169
566 Ga0501071_0016948
567 Ga0501071_0041892
568 Ga0501071_0092763
569 Ga0501071_0255700
570 Ga0501071_0383711
571 Ga0501072_0005714
572 Ga0501072_0006231
573 Ga0501072_0009619
574 Ga0501072_0010148
575 Ga0501072_0016156
576 Ga0501072_0478467
577 Ga0501073_0004020
578 Ga0501073_0029439
579 Ga0501074_0017499
580 Ga0501074_0018894
581 Ga0501074_0049119
582 Ga0501074_0330801
583 Ga0501075_0016174
584 Ga0501075_0026422
585 Ga0501075_0027600
586 Ga0501075_0118361
587 Ga0501075_0120247
588 Ga0501075_0174224
589 Ga0501076_0001766
590 Ga0501076_0004224
591 Ga0501076_0035784
592 Ga0501076_0063006
593 Ga0501076_1182638
594 Ga0501077_0015913
595 Ga0501077_0026654
596 Ga0501077_0037589
597 Ga0501079_0025964
598 Ga0501079_0039442
599 Ga0501079_0112748
600 Ga0501079_0126679
601 Ga0501079_0342326
602 Ga0501080_0013450
603 Ga0501080_0018014
604 Ga0501080_0027125
605 Ga0501081_0015687
606 Ga0501081_0037395
607 Ga0501081_0048999
608 Ga0501081_0326814
609 Ga0501081_0349464
610 Ga0501083_0003057
611 Ga0501083_0006547
612 Ga0501083_0156188
613 Ga0501083_0229509
614 Ga0501035_0046718
615 Ga0501035_0052291
616 Ga0501035_0136485
617 Ga0501035_0413486
618 Ga0501035_0508132
619 Ga0501035_0838778
620 Ga0501044_0504974
621 Ga0501045_0002032
622 Ga0501045_0002453
623 Ga0501045_0006759
624 Ga0501045_0009549
625 Ga0501045_0034329
626 Ga0501045_0115014
627 Ga0501045_0732817
628 nmdc:mga0yw44_127078_c1
629 nmdc:mga06r32_74252_c1
630 nmdc:mga08y16_169844_c1
631 nmdc:mga08y16_265925_c1
632 nmdc:mga0n895_230777_c1
633 nmdc:mga08x19_96801_c1
634 Ga0501084_0007977
635 Ga0501084_0029841
636 Ga0501084_0073293
637 Ga0501084_0132222
638 Ga0501084_0284373
639 Ga0501084_0348861
640 Ga0501084_0351284
641 Ga0501084_0482722
642 Ga0590071_040983
643 Ga0501082_0033004
644 Ga0501082_0077917
645 Ga0501082_0118733
646 Ga0501082_0541048
647 Ga0530510_0009903
648 Ga0530510_0021695
649 Ga0530510_0133829
650 Ga0530510_0171168
651 Ga0530510_0277836
652 Ga0530510_0954531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

96

166

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8867 59 138
4e4h-assembly1.cif.gz_D crystal structure of histone demethylase no66 0.8811 64 139
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.8787 58 140
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.8752 35 144
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8734 31 139
ID Description Score Start End Superfamily
af_Q7K4H4_195_438_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8996 64 139 2.60.120.650
af_Q4D641_20_259_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8983 64 139 2.60.120.650
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8963 60 140 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8948 65 148 2.60.120.10
4cugB01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8942 66 140 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A7W0UC51-F1-model_v4 Cupin domain-containing protein 0.9601 1 182
AF-A0A7V8XKS2-F1-model_v4 Cupin domain-containing protein 0.9547 3 164
AF-A0A7W0UC51-F1-model_v4 Cupin domain-containing protein 0.9498 1 182
AF-A0A538ICU1-F1-model_v4 Cupin domain-containing protein 0.9403 1 182
AF-A0A523EFJ6-F1-model_v4 Cupin domain-containing protein 0.9397 20 168

Map