F408440

General Info

Members Datasets Scaffolds Average Seq Length
326 187 326 146

Family's Representative Sequence

Representative Sequence 3300041463|Ga0451804_0348952|Ga0451804_0348952_248_724
Length 158
Sequence MTQKTYSAKPTDVDRKWYIIDAAEAPLGRISTVAATLLTGKGKPQFTKHIDCGDYVIVINADNLVVTGKKMEDKMYYKHSNFPGGLTELTMREKMEKDPTSAVFQAVRGMLPVNKLRDARLDRLKIYAGAEHNHEAQKPEVISAKPSVKAEKVEKDKK

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
164 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
170 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
180 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
183 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.94
Nodule 0
Rhizoplane 2.15
Rhizosphere 76.69
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000015 3300002244 Bacteria 27133
2 Ga0070658_10000012 3300005327 Bacteria 277871
3 Ga0070658_10000015 3300005327 Bacteria 230579
4 Ga0070658_10000118 3300005327 Bacteria 71171
5 Ga0070658_10001547 3300005327 Bacteria 19493
6 Ga0070658_10021675 3300005327 Bacteria 5150
7 Ga0070658_10022371 3300005327 Bacteria 5072
8 Ga0070658_10584777 3300005327 Unclassified 967
9 Ga0070676_10000882 3300005328 Bacteria 14791
10 Ga0070676_10048417 3300005328 Bacteria 2485
11 Ga0070683_100000450 3300005329 Bacteria 28685
12 Ga0070683_100458673 3300005329 Bacteria 1216
13 Ga0070690_100013110 3300005330 Bacteria 4892
14 Ga0070680_100000672 3300005336 Bacteria 23772
15 Ga0070680_100229725 3300005336 Bacteria 1567
16 Ga0070682_100003469 3300005337 Bacteria 8728
17 Ga0070660_100086157 3300005339 Bacteria 2471
18 Ga0070660_100766978 3300005339 Bacteria 810
19 Ga0070675_101066833 3300005354 Unclassified 742
20 Ga0070671_100114121 3300005355 Bacteria 2271
21 Ga0070674_100004553 3300005356 Bacteria 7911
22 Ga0070674_100041433 3300005356 Bacteria 3121
23 Ga0070673_100031386 3300005364 Bacteria 3986
24 Ga0070673_101744487 3300005364 Unclassified 589
25 Ga0070663_100948766 3300005455 Unclassified 745
26 Ga0070678_100012060 3300005456 Bacteria 5357
27 Ga0070681_10004770 3300005458 Bacteria 12991
28 Ga0070681_10119439 3300005458 Unclassified 2572
29 Ga0070681_10132692 3300005458 Bacteria 2422
30 Ga0070681_10800995 3300005458 Bacteria 859
31 Ga0068867_100004725 3300005459 Bacteria 9584
32 Ga0070685_10000188 3300005466 Bacteria 41401
33 Ga0070685_10010420 3300005466 Bacteria 4830
34 Ga0070679_100003967 3300005530 Bacteria 13627
35 Ga0070679_100044676 3300005530 Bacteria 4414
36 Ga0070679_100046825 3300005530 Bacteria 4311
37 Ga0070679_100244130 3300005530 Bacteria 1753
38 Ga0070679_100318390 3300005530 Bacteria 1505
39 Ga0070679_100403271 3300005530 Unclassified 1313
40 Ga0070684_100001742 3300005535 Bacteria 15835
41 Ga0070684_100003346 3300005535 Bacteria 12008
42 Ga0070684_100079038 3300005535 Bacteria 2907
43 Ga0070684_100081068 3300005535 Unclassified 2871
44 Ga0070684_100252139 3300005535 Bacteria 1613
45 Ga0070684_100629267 3300005535 Bacteria 998
46 Ga0068853_100008264 3300005539 Bacteria 8353
47 Ga0070672_100017749 3300005543 Bacteria 5129
48 Ga0070686_100006928 3300005544 Bacteria 6316
49 Ga0068855_100000003 3300005563 Bacteria 589862
50 Ga0070664_100300164 3300005564 Bacteria 1451
51 Ga0068856_100000001 3300005614 Bacteria 565602
52 Ga0068856_100001486 3300005614 Bacteria 24509
53 Ga0068856_100001797 3300005614 Bacteria 22390
54 Ga0068856_100877193 3300005614 Bacteria 916
55 Ga0068859_100754718 3300005617 Unclassified 1062
56 Ga0068863_100188895 3300005841 Bacteria 1980
57 Ga0068863_100433736 3300005841 Bacteria 1288
58 Ga0068860_101291885 3300005843 Unclassified 750
59 Ga0068862_100074213 3300005844 Unclassified 2940
60 Ga0081539_10112578 3300005985 Bacteria 1366
61 Ga0081539_10424223 3300005985 Unclassified 552
62 Ga0070717_10721072 3300006028 Unclassified 906
63 Ga0075365_10008718 3300006038 Bacteria 5779
64 Ga0075365_10021935 3300006038 Bacteria 3993
65 Ga0075365_10187471 3300006038 Unclassified 1447
66 Ga0075368_10000022 3300006042 Bacteria 37479
67 Ga0075364_10001221 3300006051 Bacteria 13828
68 Ga0075364_10034044 3300006051 Bacteria 3284
69 Ga0075364_10618551 3300006051 Bacteria 740
70 Ga0075364_11193601 3300006051 Unclassified 516
71 Ga0075362_10010106 3300006177 Bacteria 3675
72 Ga0075367_10000774 3300006178 Bacteria 12537
73 Ga0075369_10000098 3300006186 Bacteria 23291
74 Ga0075366_10000065 3300006195 Bacteria 39633
75 Ga0075366_10000328 3300006195 Bacteria 21743
76 Ga0075366_10001099 3300006195 Bacteria 13281
77 Ga0097621_100001442 3300006237 Bacteria 16323
78 Ga0075370_10026875 3300006353 Bacteria 3190
79 Ga0068871_100000039 3300006358 Bacteria 69204
80 Ga0068871_100340479 3300006358 Unclassified 1324
81 Ga0075428_100018351 3300006844 Bacteria 7734
82 Ga0075431_100976864 3300006847 Unclassified 814
83 Ga0097620_100754691 3300006931 Unclassified 1062
84 Ga0105240_10000003 3300009093 Bacteria 1183681
85 Ga0105240_10005815 3300009093 Bacteria 18300
86 Ga0105245_10000002 3300009098 Bacteria 634374
87 Ga0105245_10000050 3300009098 Bacteria 128014
88 Ga0105245_10020725 3300009098 Bacteria 5763
89 Ga0105245_10583797 3300009098 Unclassified 1142
90 Ga0105247_10961279 3300009101 Unclassified 664
91 Ga0105243_10000001 3300009148 Bacteria 1156578
92 Ga0105241_10000003 3300009174 Bacteria 839043
93 Ga0105241_10068781 3300009174 Bacteria 2744
94 Ga0105242_10000011 3300009176 Bacteria 149791
95 Ga0105242_10011274 3300009176 Bacteria 6869
96 Ga0105242_10219249 3300009176 Unclassified 1699
97 Ga0105248_11057931 3300009177 Bacteria 917
98 Ga0105248_11707275 3300009177 Bacteria 714
99 Ga0105237_10086112 3300009545 Bacteria 3132
100 Ga0105237_10286084 3300009545 Bacteria 1651
101 Ga0105238_10184560 3300009551 Unclassified 2062
102 Ga0105238_10191259 3300009551 Bacteria 2023
103 Ga0105238_10257758 3300009551 Bacteria 1723
104 Ga0105249_10002379 3300009553 Bacteria 16319
105 Ga0105249_10172632 3300009553 Unclassified 2098
106 Ga0105249_10291998 3300009553 Bacteria 1632
107 Ga0105249_10312518 3300009553 Bacteria 1580
108 Ga0105239_10007973 3300010375 Bacteria 12097
109 Ga0105239_10052752 3300010375 Bacteria 4460
110 Ga0105239_10064859 3300010375 Unclassified 4010
111 Ga0105239_10218492 3300010375 Bacteria 2137
112 Ga0105239_11160618 3300010375 Bacteria 890
113 Ga0157373_10000351 3300013100 Bacteria 37083
114 Ga0157370_10084025 3300013104 Unclassified 2993
115 Ga0157369_10003258 3300013105 Bacteria 19325
116 Ga0157369_11509225 3300013105 Unclassified 684
117 Ga0157374_10000031 3300013296 Bacteria 204840
118 Ga0157374_10001076 3300013296 Bacteria 23646
119 Ga0157374_10009614 3300013296 Bacteria 8307
120 Ga0157374_10613742 3300013296 Bacteria 1098
121 Ga0157378_10065846 3300013297 Bacteria 3244
122 Ga0157378_11393693 3300013297 Bacteria 744
123 Ga0163162_10618653 3300013306 Bacteria 1208
124 Ga0163162_11219351 3300013306 Bacteria 854
125 Ga0157372_10000670 3300013307 Bacteria 37704
126 Ga0157372_10002726 3300013307 Bacteria 19106
127 Ga0157372_11181660 3300013307 Bacteria 884
128 Ga0163163_10010260 3300014325 Bacteria 8415
129 Ga0163163_10131354 3300014325 Bacteria 2545
130 Ga0157377_10001723 3300014745 Bacteria 9535
131 Ga0157377_10044686 3300014745 Unclassified 2471
132 Ga0157379_10113987 3300014968 Bacteria 2430
133 Ga0157376_10000001 3300014969 Bacteria 842910
134 Ga0157376_10841112 3300014969 Bacteria 933
135 Ga0197907_10505822 3300020069 Unclassified 619
136 Ga0207647_10208410 3300025904 Unclassified 1129
137 Ga0207645_10005988 3300025907 Bacteria 8752
138 Ga0207645_10057412 3300025907 Bacteria 2485
139 Ga0207705_10000011 3300025909 Bacteria 517768
140 Ga0207705_10000038 3300025909 Bacteria 193812
141 Ga0207705_10000167 3300025909 Bacteria 71284
142 Ga0207705_10027913 3300025909 Bacteria 4025
143 Ga0207705_10215651 3300025909 Bacteria 1456
144 Ga0207654_10000002 3300025911 Bacteria 1460142
145 Ga0207654_10046934 3300025911 Bacteria 2465
146 Ga0207707_10004217 3300025912 Bacteria 12723
147 Ga0207707_10061504 3300025912 Bacteria 3267
148 Ga0207707_10666854 3300025912 Bacteria 876
149 Ga0207695_10000005 3300025913 Bacteria 1196715
150 Ga0207695_10006811 3300025913 Bacteria 14729
151 Ga0207671_10127374 3300025914 Bacteria 1952
152 Ga0207671_10537372 3300025914 Bacteria 932
153 Ga0207660_10000748 3300025917 Bacteria 21610
154 Ga0207660_10205019 3300025917 Bacteria 1541
155 Ga0207657_10016618 3300025919 Bacteria 7090
156 Ga0207652_10002682 3300025921 Bacteria 14930
157 Ga0207652_10008070 3300025921 Bacteria 8450
158 Ga0207652_10028924 3300025921 Bacteria 4627
159 Ga0207652_10785257 3300025921 Bacteria 846
160 Ga0207694_10134833 3300025924 Bacteria 1982
161 Ga0207694_10194213 3300025924 Bacteria 1650
162 Ga0207694_11342322 3300025924 Bacteria 605
163 Ga0207694_11551887 3300025924 Bacteria 558
164 Ga0207687_10000001 3300025927 Bacteria 1130810
165 Ga0207687_10000324 3300025927 Bacteria 32503
166 Ga0207687_10011646 3300025927 Bacteria 5748
167 Ga0207687_10404443 3300025927 Unclassified 1123
168 Ga0207644_10018711 3300025931 Bacteria 4689
169 Ga0207686_10000001 3300025934 Bacteria 1169580
170 Ga0207686_10007276 3300025934 Bacteria 5956
171 Ga0207709_10000002 3300025935 Bacteria 1171536
172 Ga0207669_10003257 3300025937 Bacteria 7020
173 Ga0207669_10068355 3300025937 Bacteria 2218
174 Ga0207704_10198191 3300025938 Bacteria 1467
175 Ga0207691_10168671 3300025940 Bacteria 1917
176 Ga0207711_10805466 3300025941 Bacteria 875
177 Ga0207661_10000021 3300025944 Bacteria 205381
178 Ga0207661_10003681 3300025944 Bacteria 10682
179 Ga0207679_10505066 3300025945 Bacteria 1079
180 Ga0207667_10000008 3300025949 Bacteria 625138
181 Ga0207667_11177067 3300025949 Bacteria 747
182 Ga0207651_10023191 3300025960 Bacteria 3811
183 Ga0207651_10384009 3300025960 Bacteria 1191
184 Ga0207712_10001459 3300025961 Bacteria 16136
185 Ga0207712_10582819 3300025961 Unclassified 966
186 Ga0207712_11050402 3300025961 Unclassified 724
187 Ga0207703_10126906 3300026035 Bacteria 2198
188 Ga0207639_10085904 3300026041 Bacteria 2504
189 Ga0207702_10000001 3300026078 Bacteria 895738
190 Ga0207702_10001268 3300026078 Bacteria 25374
191 Ga0207702_10003219 3300026078 Bacteria 15080
192 Ga0207702_10573015 3300026078 Bacteria 1106
193 Ga0207641_10162711 3300026088 Bacteria 2030
194 Ga0207648_10043597 3300026089 Unclassified 3938
195 Ga0207674_10248630 3300026116 Bacteria 1725
196 Ga0207683_10006630 3300026121 Bacteria 9907
197 Ga0207698_10286574 3300026142 Unclassified 1526
198 Ga0209813_10000206 3300027866 Bacteria 18248
199 Ga0268266_10003734 3300028379 Bacteria 14969
200 Ga0268264_11624788 3300028381 Unclassified 657
201 Ga0265337_1034206 3300028556 Bacteria 1496
202 Ga0265319_1134498 3300028563 Bacteria 768
203 Ga0265334_10000114 3300028573 Bacteria 52821
204 Ga0265334_10024657 3300028573 Bacteria 2438
205 Ga0265338_10000217 3300028800 Bacteria 106453
206 Ga0265338_10000543 3300028800 Bacteria 66162
207 Ga0265338_10081884 3300028800 Unclassified 2704
208 Ga0265320_10118226 3300031240 Unclassified 1210
209 Ga0265340_10000533 3300031247 Bacteria 21017
210 Ga0265327_10000017 3300031251 Bacteria 445264
211 Ga0265327_10019923 3300031251 Unclassified 4107
212 Ga0265342_10541933 3300031712 Unclassified 591
213 Ga0307516_10457394 3300031730 Unclassified 932
214 Ga0373934_0253447 3300035086 Bacteria 728
215 Ga0395899_0008649 3300037312 Bacteria 7833
216 Ga0395900_0005264 3300037418 Bacteria 13568
217 Ga0395900_1465456 3300037418 Unclassified 595
218 Ga0395898_0275817 3300037466 Bacteria 1604
219 Ga0395905_0398645 3300037471 Bacteria 1271
220 Ga0395905_0445866 3300037471 Bacteria 1192
221 Ga0395901_0011912 3300038443 Bacteria 8818
222 Ga0395901_0028005 3300038443 Bacteria 5795
223 Ga0395901_0053748 3300038443 Bacteria 4185
224 Ga0395901_0146552 3300038443 Bacteria 2481
225 Ga0451804_0348952 3300041463 Unclassified 841
226 Ga0451849_1308950 3300041505 Bacteria 527
227 Ga0439456_100226 3300042013 Unclassified 655
228 Ga0451577_0526231 3300042876 Bacteria 1074
229 Ga0495590_0176369 3300046457 Unclassified 780
230 Ga0495609_0069448 3300046538 Bacteria 1549
231 Ga0495672_0099923 3300047320 Bacteria 1576
232 Ga0496100_0261612 3300048903 Bacteria 1283
233 Ga0496104_0428192 3300048907 Bacteria 1235
234 Ga0496105_0958228 3300048908 Bacteria 642
235 Ga0496109_0054472 3300048912 Bacteria 3649
236 Ga0496112_0065373 3300048915 Bacteria 3589
237 Ga0496112_0191809 3300048915 Bacteria 2005
238 Ga0496125_0232675 3300048928 Bacteria 1177
239 Ga0496126_0124833 3300048929 Unclassified 2229
240 Ga0501031_0002004 3300049568 Bacteria 12844
241 Ga0501032_0000394 3300049569 Bacteria 36017
242 Ga0501034_0009643 3300049571 Bacteria 10098
243 Ga0501034_0014829 3300049571 Bacteria 8018
244 Ga0501034_0040779 3300049571 Bacteria 4698
245 Ga0501036_0006297 3300049572 Bacteria 9632
246 Ga0501036_0246558 3300049572 Unclassified 1497
247 Ga0501037_0000133 3300049573 Bacteria 69741
248 Ga0501037_0077445 3300049573 Bacteria 2413
249 Ga0501037_0172972 3300049573 Unclassified 1534
250 Ga0501038_0006750 3300049574 Bacteria 10603
251 Ga0501039_0157714 3300049575 Unclassified 1783
252 Ga0501042_0036960 3300049578 Bacteria 3465
253 Ga0501043_0001721 3300049579 Bacteria 18919
254 Ga0501046_0000038 3300049580 Bacteria 159193
255 Ga0501046_0098790 3300049580 Bacteria 2241
256 Ga0501047_0002015 3300049581 Bacteria 19485
257 Ga0501047_0004985 3300049581 Bacteria 12460
258 Ga0501048_0000033 3300049582 Bacteria 64896
259 Ga0501069_0037707 3300049585 Unclassified 2668
260 Ga0501070_0027994 3300049586 Bacteria 4727
261 Ga0501070_0356844 3300049586 Unclassified 1186
262 Ga0501073_1075649 3300049589 Unclassified 553
263 Ga0501074_0464333 3300049590 Bacteria 897
264 Ga0501080_0494144 3300049742 Unclassified 1094
265 Ga0501083_0027339 3300049744 Bacteria 3937
266 Ga0501083_0127695 3300049744 Unclassified 1666
267 Ga0501276_014686 3300049773 Bacteria 698
268 Ga0501035_0000033 3300049822 Bacteria 175087
269 Ga0501035_0005497 3300049822 Bacteria 11971
270 Ga0501044_0041603 3300049823 Bacteria 4784
271 Ga0501044_0871414 3300049823 Unclassified 776
272 nmdc:mga03683_9557_c1 3300050489 Bacteria 3453
273 nmdc:mga03n38_7220_c1 3300050490 Bacteria 3918
274 nmdc:mga00v17_14675_c1 3300050491 Bacteria 4381
275 nmdc:mga00v17_28052_c1 3300050491 Bacteria 3293
276 nmdc:mga00v17_806065_c1 3300050491 Unclassified 598
277 nmdc:mga0yw44_18435_c1 3300050492 Bacteria 3823
278 nmdc:mga0yw44_330_c1 3300050492 Bacteria 16596
279 nmdc:mga0yw44_40646_c1 3300050492 Bacteria 2764
280 nmdc:mga0k408_144_c1 3300050493 Bacteria 36305
281 nmdc:mga0k408_14_c3 3300050493 Bacteria 36052
282 nmdc:mga0k408_22018_c1 3300050493 Bacteria 3586
283 nmdc:mga0k408_602981_c1 3300050493 Unclassified 647
284 nmdc:mga06z11_10627_c1 3300050494 Bacteria 3932
285 nmdc:mga06z11_53_c2 3300050494 Bacteria 47411
286 nmdc:mga04h51_1103_c1 3300050495 Bacteria 6213
287 nmdc:mga04h51_17608_c1 3300050495 Bacteria 2093
288 nmdc:mga07m45_25181_c1 3300050496 Bacteria 3262
289 nmdc:mga06r32_949615_c1 3300050510 Unclassified 814
290 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
291 nmdc:mga0sz30_2731_c1 3300050516 Bacteria 6301
292 Ga0500610_0000001 3300053079 Bacteria 185468
293 Ga0500610_0104870 3300053079 Bacteria 1459
294 Ga0500610_0124321 3300053079 Bacteria 1317
295 Ga0500643_000011 3300053087 Bacteria 385630
296 Ga0500644_0000636 3300053088 Bacteria 13080
297 Ga0500644_0000923 3300053088 Bacteria 9347
298 Ga0500644_0051746 3300053088 Bacteria 1412
299 Ga0500646_0000426 3300053090 Bacteria 12557
300 Ga0500583_0000067 3300053092 Bacteria 64775
301 Ga0500583_0049026 3300053092 Bacteria 1952
302 Ga0500651_0000416 3300053093 Bacteria 22899
303 Ga0500651_0204921 3300053093 Bacteria 1162
304 Ga0500650_0000001 3300053098 Bacteria 818797
305 Ga0500555_000001 3300053103 Bacteria 1353713
306 Ga0500555_000002 3300053103 Bacteria 1314346
307 Ga0500556_0000246 3300053104 Bacteria 43933
308 Ga0500594_0000001 3300053118 Bacteria 1178472
309 Ga0500594_0000711 3300053118 Bacteria 7094
310 Ga0500594_0079505 3300053118 Bacteria 978
311 Ga0500614_000411 3300053123 Bacteria 11177
312 Ga0500628_000006 3300053129 Bacteria 154858
313 Ga0500642_0000722 3300053130 Bacteria 9746
314 Ga0500652_000084 3300053131 Bacteria 39562
315 Ga0500655_000374 3300053133 Bacteria 9718
316 Ga0500577_0000856 3300053142 Bacteria 7873
317 Ga0500577_0001854 3300053142 Bacteria 5415
318 Ga0500579_003450 3300053143 Bacteria 9502
319 Ga0500589_000008 3300053147 Bacteria 137145
320 Ga0500616_0031886 3300053153 Bacteria 2883
321 Ga0500633_0001431 3300053160 Bacteria 4488
322 Ga0587094_000374 3300059513 Bacteria 3300
323 Ga0587115_012485 3300059626 Bacteria 1086
324 Ga0587069_032626 3300059642 Bacteria 850
325 Ga0587110_000694 3300059654 Bacteria 2129
326 Ga0501082_0012274 3300060353 Bacteria 7363

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000012 Ga0070658_10000012227 128
2 3300005328 Ga0070676_10048417 Ga0070676_100484172 128
3 3300005356 Ga0070674_100041433 Ga0070674_1000414333 128
4 3300005364 Ga0070673_100031386 Ga0070673_1000313863 128
5 3300005456 Ga0070678_100012060 Ga0070678_1000120603 128
6 3300005466 Ga0070685_10000188 Ga0070685_1000018834 128
7 3300005543 Ga0070672_100017749 Ga0070672_1000177495 128
8 3300009176 Ga0105242_10219249 Ga0105242_102192492 128
9 3300010375 Ga0105239_10007973 Ga0105239_100079732 128
10 3300025907 Ga0207645_10057412 Ga0207645_100574123 128
11 3300025909 Ga0207705_10000038 Ga0207705_10000038194 128
12 3300025937 Ga0207669_10068355 Ga0207669_100683553 128
13 3300025940 Ga0207691_10168671 Ga0207691_101686711 128
14 3300025960 Ga0207651_10023191 Ga0207651_100231914 128
15 3300026121 Ga0207683_10006630 Ga0207683_1000663010 128
16 3300050495 nmdc:mga04h51_1103_c1 nmdc:mga04h51_1103_c1_5748_6167 130
17 3300049571 Ga0501034_0014829 Ga0501034_0014829_561_1001 131
18 3300049572 Ga0501036_0246558 Ga0501036_0246558_699_1139 131
19 3300049573 Ga0501037_0172972 Ga0501037_0172972_124_564 131
20 3300049581 Ga0501047_0002015 Ga0501047_0002015_11567_12007 131
21 3300049822 Ga0501035_0000033 Ga0501035_0000033_171957_172397 131
22 3300049823 Ga0501044_0871414 Ga0501044_0871414_136_576 131
23 3300005327 Ga0070658_10584777 Ga0070658_105847772 137
24 3300053087 Ga0500643_000011 Ga0500643_000011_71490_71933 139
25 3300005530 Ga0070679_100318390 Ga0070679_1003183902 143
26 3300005530 Ga0070679_100403271 Ga0070679_1004032712 143
27 3300005985 Ga0081539_10424223 Ga0081539_104242232 143
28 3300006038 Ga0075365_10021935 Ga0075365_100219353 143
29 3300006042 Ga0075368_10000022 Ga0075368_1000002222 143
30 3300006051 Ga0075364_10001221 Ga0075364_1000122119 143
31 3300006177 Ga0075362_10010106 Ga0075362_100101067 143
32 3300006178 Ga0075367_10000774 Ga0075367_1000077425 143
33 3300006186 Ga0075369_10000098 Ga0075369_100000988 143
34 3300006353 Ga0075370_10026875 Ga0075370_100268754 143
35 3300006358 Ga0068871_100340479 Ga0068871_1003404792 143
36 3300025921 Ga0207652_10785257 Ga0207652_107852572 143
37 3300027866 Ga0209813_10000206 Ga0209813_100002068 143
38 3300049589 Ga0501073_1075649 Ga0501073_1075649_84_524 143
39 3300050489 nmdc:mga03683_9557_c1 nmdc:mga03683_9557_c1_2982_3425 143
40 3300050490 nmdc:mga03n38_7220_c1 nmdc:mga03n38_7220_c1_782_1225 143
41 3300050491 nmdc:mga00v17_14675_c1 nmdc:mga00v17_14675_c1_449_892 143
42 3300050492 nmdc:mga0yw44_330_c1 nmdc:mga0yw44_330_c1_10452_10895 143
43 3300050494 nmdc:mga06z11_10627_c1 nmdc:mga06z11_10627_c1_2611_3054 143
44 3300050495 nmdc:mga04h51_17608_c1 nmdc:mga04h51_17608_c1_878_1321 143
45 3300050496 nmdc:mga07m45_25181_c1 nmdc:mga07m45_25181_c1_736_1179 143
46 3300050516 nmdc:mga0sz30_2731_c1 nmdc:mga0sz30_2731_c1_522_965 143
47 3300053088 Ga0500644_0051746 Ga0500644_0051746_743_1186 143
48 3300053153 Ga0500616_0031886 Ga0500616_0031886_2328_2771 143
49 3300005327 Ga0070658_10000015 Ga0070658_1000001510 146
50 3300005327 Ga0070658_10000118 Ga0070658_1000011819 146
51 3300005327 Ga0070658_10001547 Ga0070658_100015473 146
52 3300005327 Ga0070658_10021675 Ga0070658_100216758 146
53 3300005327 Ga0070658_10022371 Ga0070658_100223715 146
54 3300005329 Ga0070683_100000450 Ga0070683_10000045032 146
55 3300005329 Ga0070683_100458673 Ga0070683_1004586732 146
56 3300005330 Ga0070690_100013110 Ga0070690_1000131104 146
57 3300005336 Ga0070680_100000672 Ga0070680_10000067243 146
58 3300005336 Ga0070680_100229725 Ga0070680_1002297253 146
59 3300005337 Ga0070682_100003469 Ga0070682_1000034696 146
60 3300005339 Ga0070660_100086157 Ga0070660_1000861573 146
61 3300005339 Ga0070660_100766978 Ga0070660_1007669782 146
62 3300005354 Ga0070675_101066833 Ga0070675_1010668332 146
63 3300005355 Ga0070671_100114121 Ga0070671_1001141214 146
64 3300005356 Ga0070674_100004553 Ga0070674_1000045539 146
65 3300005455 Ga0070663_100948766 Ga0070663_1009487661 146
66 3300005458 Ga0070681_10004770 Ga0070681_100047709 146
67 3300005458 Ga0070681_10119439 Ga0070681_101194393 146
68 3300005458 Ga0070681_10132692 Ga0070681_101326922 146
69 3300005458 Ga0070681_10800995 Ga0070681_108009951 146
70 3300005459 Ga0068867_100004725 Ga0068867_10000472510 146
71 3300005466 Ga0070685_10010420 Ga0070685_100104209 146
72 3300005530 Ga0070679_100003967 Ga0070679_10000396726 146
73 3300005530 Ga0070679_100044676 Ga0070679_1000446763 146
74 3300005530 Ga0070679_100046825 Ga0070679_1000468257 146
75 3300005530 Ga0070679_100244130 Ga0070679_1002441302 146
76 3300005535 Ga0070684_100003346 Ga0070684_10000334617 146
77 3300005535 Ga0070684_100079038 Ga0070684_1000790383 146
78 3300005535 Ga0070684_100081068 Ga0070684_1000810684 146
79 3300005535 Ga0070684_100252139 Ga0070684_1002521393 146
80 3300005535 Ga0070684_100629267 Ga0070684_1006292672 146
81 3300005539 Ga0068853_100008264 Ga0068853_10000826411 146
82 3300005544 Ga0070686_100006928 Ga0070686_1000069283 146
83 3300005563 Ga0068855_100000003 Ga0068855_100000003161 146
84 3300005564 Ga0070664_100300164 Ga0070664_1003001643 146
85 3300005614 Ga0068856_100000001 Ga0068856_100000001309 146
86 3300005614 Ga0068856_100001486 Ga0068856_10000148616 146
87 3300005617 Ga0068859_100754718 Ga0068859_1007547182 146
88 3300005841 Ga0068863_100188895 Ga0068863_1001888953 146
89 3300005841 Ga0068863_100433736 Ga0068863_1004337362 146
90 3300005844 Ga0068862_100074213 Ga0068862_1000742135 146
91 3300005985 Ga0081539_10112578 Ga0081539_101125783 146
92 3300006028 Ga0070717_10721072 Ga0070717_107210722 146
93 3300006038 Ga0075365_10008718 Ga0075365_100087183 146
94 3300006038 Ga0075365_10187471 Ga0075365_101874712 146
95 3300006051 Ga0075364_10034044 Ga0075364_100340441 146
96 3300006051 Ga0075364_10618551 Ga0075364_106185512 146
97 3300006051 Ga0075364_11193601 Ga0075364_111936011 146
98 3300006195 Ga0075366_10000065 Ga0075366_1000006528 146
99 3300006195 Ga0075366_10001099 Ga0075366_100010999 146
100 3300006237 Ga0097621_100001442 Ga0097621_10000144221 146
101 3300006358 Ga0068871_100000039 Ga0068871_10000003961 146
102 3300006844 Ga0075428_100018351 Ga0075428_1000183518 146
103 3300006847 Ga0075431_100976864 Ga0075431_1009768642 146
104 3300006931 Ga0097620_100754691 Ga0097620_1007546912 146
105 3300009093 Ga0105240_10000003 Ga0105240_10000003864 146
106 3300009098 Ga0105245_10000002 Ga0105245_10000002265 146
107 3300009098 Ga0105245_10000050 Ga0105245_100000503 146
108 3300009098 Ga0105245_10020725 Ga0105245_100207255 146
109 3300009098 Ga0105245_10583797 Ga0105245_105837972 146
110 3300009101 Ga0105247_10961279 Ga0105247_109612791 146
111 3300009148 Ga0105243_10000001 Ga0105243_10000001427 146
112 3300009174 Ga0105241_10000003 Ga0105241_10000003142 146
113 3300009176 Ga0105242_10000011 Ga0105242_1000001124 146
114 3300009176 Ga0105242_10011274 Ga0105242_100112743 146
115 3300009177 Ga0105248_11057931 Ga0105248_110579312 146
116 3300009177 Ga0105248_11707275 Ga0105248_117072752 146
117 3300009545 Ga0105237_10086112 Ga0105237_100861124 146
118 3300009545 Ga0105237_10286084 Ga0105237_102860842 146
119 3300009551 Ga0105238_10184560 Ga0105238_101845604 146
120 3300009551 Ga0105238_10191259 Ga0105238_101912592 146
121 3300009551 Ga0105238_10257758 Ga0105238_102577582 146
122 3300009553 Ga0105249_10002379 Ga0105249_1000237928 146
123 3300009553 Ga0105249_10172632 Ga0105249_101726323 146
124 3300009553 Ga0105249_10312518 Ga0105249_103125182 146
125 3300010375 Ga0105239_10052752 Ga0105239_100527521 146
126 3300010375 Ga0105239_10064859 Ga0105239_100648593 146
127 3300010375 Ga0105239_10218492 Ga0105239_102184923 146
128 3300010375 Ga0105239_11160618 Ga0105239_111606182 146
129 3300013105 Ga0157369_10003258 Ga0157369_1000325834 146
130 3300013105 Ga0157369_11509225 Ga0157369_115092252 146
131 3300013296 Ga0157374_10000031 Ga0157374_10000031106 146
132 3300013296 Ga0157374_10001076 Ga0157374_1000107619 146
133 3300013296 Ga0157374_10009614 Ga0157374_100096142 146
134 3300013296 Ga0157374_10613742 Ga0157374_106137422 146
135 3300013297 Ga0157378_10065846 Ga0157378_100658464 146
136 3300013297 Ga0157378_11393693 Ga0157378_113936931 146
137 3300013306 Ga0163162_10618653 Ga0163162_106186533 146
138 3300013306 Ga0163162_11219351 Ga0163162_112193512 146
139 3300013307 Ga0157372_10000670 Ga0157372_1000067022 146
140 3300013307 Ga0157372_10002726 Ga0157372_1000272636 146
141 3300013307 Ga0157372_11181660 Ga0157372_111816602 146
142 3300014325 Ga0163163_10010260 Ga0163163_100102608 146
143 3300014325 Ga0163163_10131354 Ga0163163_101313544 146
144 3300014745 Ga0157377_10001723 Ga0157377_100017235 146
145 3300014745 Ga0157377_10044686 Ga0157377_100446863 146
146 3300014968 Ga0157379_10113987 Ga0157379_101139872 146
147 3300014969 Ga0157376_10000001 Ga0157376_1000000167 146
148 3300014969 Ga0157376_10841112 Ga0157376_108411122 146
149 3300025904 Ga0207647_10208410 Ga0207647_102084102 146
150 3300025909 Ga0207705_10000011 Ga0207705_10000011336 146
151 3300025909 Ga0207705_10000167 Ga0207705_1000016769 146
152 3300025909 Ga0207705_10027913 Ga0207705_100279133 146
153 3300025909 Ga0207705_10215651 Ga0207705_102156512 146
154 3300025911 Ga0207654_10000002 Ga0207654_100000021067 146
155 3300025912 Ga0207707_10004217 Ga0207707_1000421714 146
156 3300025912 Ga0207707_10061504 Ga0207707_100615045 146
157 3300025912 Ga0207707_10666854 Ga0207707_106668542 146
158 3300025913 Ga0207695_10000005 Ga0207695_10000005874 146
159 3300025914 Ga0207671_10127374 Ga0207671_101273742 146
160 3300025914 Ga0207671_10537372 Ga0207671_105373722 146
161 3300025917 Ga0207660_10000748 Ga0207660_1000074810 146
162 3300025917 Ga0207660_10205019 Ga0207660_102050193 146
163 3300025919 Ga0207657_10016618 Ga0207657_100166185 146
164 3300025921 Ga0207652_10002682 Ga0207652_1000268214 146
165 3300025921 Ga0207652_10008070 Ga0207652_100080704 146
166 3300025921 Ga0207652_10028924 Ga0207652_100289246 146
167 3300025924 Ga0207694_10134833 Ga0207694_101348334 146
168 3300025924 Ga0207694_10194213 Ga0207694_101942133 146
169 3300025924 Ga0207694_11342322 Ga0207694_113423221 146
170 3300025924 Ga0207694_11551887 Ga0207694_115518872 146
171 3300025927 Ga0207687_10000001 Ga0207687_10000001946 146
172 3300025927 Ga0207687_10000324 Ga0207687_100003243 146
173 3300025927 Ga0207687_10011646 Ga0207687_100116465 146
174 3300025927 Ga0207687_10404443 Ga0207687_104044432 146
175 3300025931 Ga0207644_10018711 Ga0207644_100187115 146
176 3300025934 Ga0207686_10000001 Ga0207686_10000001715 146
177 3300025934 Ga0207686_10007276 Ga0207686_100072768 146
178 3300025935 Ga0207709_10000002 Ga0207709_10000002833 146
179 3300025937 Ga0207669_10003257 Ga0207669_100032572 146
180 3300025938 Ga0207704_10198191 Ga0207704_101981913 146
181 3300025941 Ga0207711_10805466 Ga0207711_108054662 146
182 3300025944 Ga0207661_10000021 Ga0207661_10000021194 146
183 3300025945 Ga0207679_10505066 Ga0207679_105050661 146
184 3300025949 Ga0207667_10000008 Ga0207667_10000008160 146
185 3300025949 Ga0207667_11177067 Ga0207667_111770672 146
186 3300025961 Ga0207712_10001459 Ga0207712_100014594 146
187 3300025961 Ga0207712_10582819 Ga0207712_105828192 146
188 3300026035 Ga0207703_10126906 Ga0207703_101269064 146
189 3300026041 Ga0207639_10085904 Ga0207639_100859042 146
190 3300026078 Ga0207702_10000001 Ga0207702_10000001858 146
191 3300026078 Ga0207702_10001268 Ga0207702_1000126817 146
192 3300026088 Ga0207641_10162711 Ga0207641_101627112 146
193 3300026089 Ga0207648_10043597 Ga0207648_100435974 146
194 3300026116 Ga0207674_10248630 Ga0207674_102486303 146
195 3300028379 Ga0268266_10003734 Ga0268266_1000373427 146
196 3300028556 Ga0265337_1034206 Ga0265337_10342061 146
197 3300028563 Ga0265319_1134498 Ga0265319_11344982 146
198 3300028573 Ga0265334_10000114 Ga0265334_1000011447 146
199 3300028573 Ga0265334_10024657 Ga0265334_100246573 146
200 3300028800 Ga0265338_10000217 Ga0265338_1000021791 146
201 3300028800 Ga0265338_10000543 Ga0265338_1000054324 146
202 3300028800 Ga0265338_10081884 Ga0265338_100818845 146
203 3300031240 Ga0265320_10118226 Ga0265320_101182263 146
204 3300031247 Ga0265340_10000533 Ga0265340_1000053321 146
205 3300031251 Ga0265327_10000017 Ga0265327_10000017189 146
206 3300031251 Ga0265327_10019923 Ga0265327_100199237 146
207 3300031712 Ga0265342_10541933 Ga0265342_105419331 146
208 3300035086 Ga0373934_0253447 Ga0373934_0253447_204_644 146
209 3300037312 Ga0395899_0008649 Ga0395899_0008649_6148_6588 146
210 3300037418 Ga0395900_0005264 Ga0395900_0005264_2151_2591 146
211 3300037418 Ga0395900_1465456 Ga0395900_1465456_108_548 146
212 3300037466 Ga0395898_0275817 Ga0395898_0275817_1020_1460 146
213 3300037471 Ga0395905_0398645 Ga0395905_0398645_518_958 146
214 3300037471 Ga0395905_0445866 Ga0395905_0445866_165_605 146
215 3300038443 Ga0395901_0011912 Ga0395901_0011912_7278_7718 146
216 3300038443 Ga0395901_0028005 Ga0395901_0028005_526_966 146
217 3300038443 Ga0395901_0053748 Ga0395901_0053748_2358_2798 146
218 3300038443 Ga0395901_0146552 Ga0395901_0146552_1571_2017 146
219 3300041463 Ga0451804_0348952 Ga0451804_0348952_248_724 146
220 3300041505 Ga0451849_1308950 Ga0451849_1308950_49_489 146
221 3300042013 Ga0439456_100226 Ga0439456_100226_122_562 146
222 3300042876 Ga0451577_0526231 Ga0451577_0526231_598_1044 146
223 3300046538 Ga0495609_0069448 Ga0495609_0069448_602_1042 146
224 3300048903 Ga0496100_0261612 Ga0496100_0261612_519_959 146
225 3300048907 Ga0496104_0428192 Ga0496104_0428192_108_551 146
226 3300048908 Ga0496105_0958228 Ga0496105_0958228_136_579 146
227 3300048912 Ga0496109_0054472 Ga0496109_0054472_609_1052 146
228 3300048915 Ga0496112_0065373 Ga0496112_0065373_634_1077 146
229 3300048928 Ga0496125_0232675 Ga0496125_0232675_225_674 146
230 3300048929 Ga0496126_0124833 Ga0496126_0124833_759_1199 146
231 3300049568 Ga0501031_0002004 Ga0501031_0002004_5416_5856 146
232 3300049569 Ga0501032_0000394 Ga0501032_0000394_9690_10130 146
233 3300049571 Ga0501034_0009643 Ga0501034_0009643_3853_4293 146
234 3300049571 Ga0501034_0040779 Ga0501034_0040779_945_1385 146
235 3300049572 Ga0501036_0006297 Ga0501036_0006297_3834_4274 146
236 3300049573 Ga0501037_0000133 Ga0501037_0000133_44256_44696 146
237 3300049573 Ga0501037_0077445 Ga0501037_0077445_1743_2183 146
238 3300049574 Ga0501038_0006750 Ga0501038_0006750_3913_4353 146
239 3300049575 Ga0501039_0157714 Ga0501039_0157714_444_884 146
240 3300049578 Ga0501042_0036960 Ga0501042_0036960_2150_2590 146
241 3300049579 Ga0501043_0001721 Ga0501043_0001721_13962_14402 146
242 3300049580 Ga0501046_0000038 Ga0501046_0000038_105493_105933 146
243 3300049580 Ga0501046_0098790 Ga0501046_0098790_1121_1561 146
244 3300049581 Ga0501047_0004985 Ga0501047_0004985_9805_10245 146
245 3300049582 Ga0501048_0000033 Ga0501048_0000033_58630_59070 146
246 3300049585 Ga0501069_0037707 Ga0501069_0037707_221_661 146
247 3300049586 Ga0501070_0027994 Ga0501070_0027994_3596_4036 146
248 3300049586 Ga0501070_0356844 Ga0501070_0356844_498_938 146
249 3300049590 Ga0501074_0464333 Ga0501074_0464333_143_583 146
250 3300049742 Ga0501080_0494144 Ga0501080_0494144_631_1074 146
251 3300049744 Ga0501083_0027339 Ga0501083_0027339_1512_1955 146
252 3300049744 Ga0501083_0127695 Ga0501083_0127695_199_639 146
253 3300049773 Ga0501276_014686 Ga0501276_014686_142_585 146
254 3300049822 Ga0501035_0005497 Ga0501035_0005497_6378_6818 146
255 3300049823 Ga0501044_0041603 Ga0501044_0041603_1545_1985 146
256 3300050491 nmdc:mga00v17_28052_c1 nmdc:mga00v17_28052_c1_2794_3240 146
257 3300050491 nmdc:mga00v17_806065_c1 nmdc:mga00v17_806065_c1_102_542 146
258 3300050492 nmdc:mga0yw44_18435_c1 nmdc:mga0yw44_18435_c1_2188_2628 146
259 3300050492 nmdc:mga0yw44_40646_c1 nmdc:mga0yw44_40646_c1_1103_1549 146
260 3300050493 nmdc:mga0k408_144_c1 nmdc:mga0k408_144_c1_28204_28644 146
261 3300050493 nmdc:mga0k408_14_c3 nmdc:mga0k408_14_c3_26020_26460 146
262 3300050493 nmdc:mga0k408_602981_c1 nmdc:mga0k408_602981_c1_142_582 146
263 3300050510 nmdc:mga06r32_949615_c1 nmdc:mga06r32_949615_c1_360_800 146
264 3300053079 Ga0500610_0104870 Ga0500610_0104870_950_1390 146
265 3300053079 Ga0500610_0124321 Ga0500610_0124321_434_880 146
266 3300053090 Ga0500646_0000426 Ga0500646_0000426_3125_3571 146
267 3300053092 Ga0500583_0000067 Ga0500583_0000067_16810_17250 146
268 3300053092 Ga0500583_0049026 Ga0500583_0049026_332_778 146
269 3300053093 Ga0500651_0000416 Ga0500651_0000416_9924_10367 146
270 3300053093 Ga0500651_0204921 Ga0500651_0204921_470_913 146
271 3300053098 Ga0500650_0000001 Ga0500650_0000001_530074_530520 146
272 3300053103 Ga0500555_000001 Ga0500555_000001_815616_816056 146
273 3300053104 Ga0500556_0000246 Ga0500556_0000246_5344_5784 146
274 3300053118 Ga0500594_0000001 Ga0500594_0000001_14191_14637 146
275 3300053118 Ga0500594_0000711 Ga0500594_0000711_3595_4035 146
276 3300053118 Ga0500594_0079505 Ga0500594_0079505_102_542 146
277 3300053123 Ga0500614_000411 Ga0500614_000411_8831_9274 146
278 3300053129 Ga0500628_000006 Ga0500628_000006_130283_130723 146
279 3300053130 Ga0500642_0000722 Ga0500642_0000722_7942_8382 146
280 3300053133 Ga0500655_000374 Ga0500655_000374_6479_6925 146
281 3300053142 Ga0500577_0000856 Ga0500577_0000856_1675_2121 146
282 3300053143 Ga0500579_003450 Ga0500579_003450_2648_3094 146
283 3300053147 Ga0500589_000008 Ga0500589_000008_43053_43493 146
284 3300053160 Ga0500633_0001431 Ga0500633_0001431_1044_1490 146
285 3300059513 Ga0587094_000374 Ga0587094_000374_518_958 146
286 3300059626 Ga0587115_012485 Ga0587115_012485_299_739 146
287 3300059642 Ga0587069_032626 Ga0587069_032626_393_833 146
288 3300059654 Ga0587110_000694 Ga0587110_000694_556_996 146
289 3300060353 Ga0501082_0012274 Ga0501082_0012274_3952_4392 146
290 3300002244 JGI24742J22300_10000015 JGI24742J22300_1000001529 147
291 3300005328 Ga0070676_10000882 Ga0070676_1000088218 147
292 3300005364 Ga0070673_101744487 Ga0070673_1017444871 147
293 3300005535 Ga0070684_100001742 Ga0070684_10000174215 147
294 3300005614 Ga0068856_100001797 Ga0068856_10000179714 147
295 3300005614 Ga0068856_100877193 Ga0068856_1008771932 147
296 3300005843 Ga0068860_101291885 Ga0068860_1012918851 147
297 3300006195 Ga0075366_10000328 Ga0075366_1000032823 147
298 3300009093 Ga0105240_10005815 Ga0105240_1000581522 147
299 3300009174 Ga0105241_10068781 Ga0105241_100687812 147
300 3300009553 Ga0105249_10291998 Ga0105249_102919982 147
301 3300013100 Ga0157373_10000351 Ga0157373_1000035140 147
302 3300013104 Ga0157370_10084025 Ga0157370_100840255 147
303 3300020069 Ga0197907_10505822 Ga0197907_105058221 147
304 3300025907 Ga0207645_10005988 Ga0207645_1000598813 147
305 3300025911 Ga0207654_10046934 Ga0207654_100469342 147
306 3300025913 Ga0207695_10006811 Ga0207695_1000681120 147
307 3300025944 Ga0207661_10003681 Ga0207661_1000368115 147
308 3300025960 Ga0207651_10384009 Ga0207651_103840091 147
309 3300025961 Ga0207712_11050402 Ga0207712_110504022 147
310 3300026078 Ga0207702_10003219 Ga0207702_100032193 147
311 3300026078 Ga0207702_10573015 Ga0207702_105730152 147
312 3300026142 Ga0207698_10286574 Ga0207698_102865742 147
313 3300028381 Ga0268264_11624788 Ga0268264_116247882 147
314 3300031730 Ga0307516_10457394 Ga0307516_104573942 147
315 3300046457 Ga0495590_0176369 Ga0495590_0176369_16_483 147
316 3300047320 Ga0495672_0099923 Ga0495672_0099923_145_612 147
317 3300048915 Ga0496112_0191809 Ga0496112_0191809_1182_1625 147
318 3300050493 nmdc:mga0k408_22018_c1 nmdc:mga0k408_22018_c1_882_1352 147
319 3300050494 nmdc:mga06z11_53_c2 nmdc:mga06z11_53_c2_11873_12343 147
320 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_326490_326957 147
321 3300053079 Ga0500610_0000001 Ga0500610_0000001_38578_39045 147
322 3300053088 Ga0500644_0000636 Ga0500644_0000636_11821_12267 147
323 3300053088 Ga0500644_0000923 Ga0500644_0000923_3698_4165 147
324 3300053103 Ga0500555_000002 Ga0500555_000002_454432_454899 147
325 3300053131 Ga0500652_000084 Ga0500652_000084_37620_38087 147
326 3300053142 Ga0500577_0001854 Ga0500577_0001854_4549_4995 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

15

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_L the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9458 6 140
7a5h-assembly1.cif.gz_K structure of the split human mitoribosomal large subunit with rescue factors mtrf-r and mtres1 0.941 9 131
8c93-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.9336 1 142
7jil-assembly1.cif.gz_J 70s ribosome flavobacterium johnsoniae 0.9325 1 144
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9304 9 140
ID Description Score Start End Superfamily
af_Q9VJ38_1_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.953 11 131 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9392 12 145 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.929 1 142 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9256 12 147 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9227 1 142 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A1X7VF42-F1-model_v4 39S ribosomal protein L13, mitochondrial 0.9613 12 130 GO:0003729
GO:0003735
GO:0005762
GO:0006412
GO:0017148
AF-A0A7J7N2Z6-F1-model_v4 COP9 signalosome complex subunit 3 0.961 13 140 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0006511
GO:0008180
GO:0016740
GO:1990904
AF-A0A7I8XPV4-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.959 11 131 GO:0003735
GO:0004322
GO:0005739
GO:0005840
GO:0006412
GO:0006826
GO:0006879
GO:0008198
GO:0008199
GO:0034986
GO:0051537
GO:1990904
AF-A0A554LWJ8-F1-model_v4 Large ribosomal subunit protein uL13 0.9574 10 125 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904
AF-A0A3Q7NZD4-F1-model_v4 39S ribosomal protein L13, mitochondrial isoform X1 0.9572 11 131 GO:0003729
GO:0003735
GO:0005762
GO:0006412
GO:0017148

Feature Viewer

pLDDT pTM Quality
81.06 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map