F408440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 187 | 326 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300041463|Ga0451804_0348952|Ga0451804_0348952_248_724 |
| Length | 158 |
| Sequence | MTQKTYSAKPTDVDRKWYIIDAAEAPLGRISTVAATLLTGKGKPQFTKHIDCGDYVIVINADNLVVTGKKMEDKMYYKHSNFPGGLTELTMREKMEKDPTSAVFQAVRGMLPVNKLRDARLDRLKIYAGAEHNHEAQKPEVISAKPSVKAEKVEKDKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 120 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 127 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 131 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 132 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 155 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 156 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 157 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 158 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 160 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 161 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 163 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 164 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 165 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 166 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 167 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 168 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 169 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 170 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 171 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 172 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 173 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 174 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 175 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 176 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 177 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 178 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 180 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 181 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 182 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 183 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 1.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.94 |
| Nodule | 0 |
| Rhizoplane | 2.15 |
| Rhizosphere | 76.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10000015 | 3300002244 | Bacteria | 27133 |
| 2 | Ga0070658_10000012 | 3300005327 | Bacteria | 277871 |
| 3 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 4 | Ga0070658_10000118 | 3300005327 | Bacteria | 71171 |
| 5 | Ga0070658_10001547 | 3300005327 | Bacteria | 19493 |
| 6 | Ga0070658_10021675 | 3300005327 | Bacteria | 5150 |
| 7 | Ga0070658_10022371 | 3300005327 | Bacteria | 5072 |
| 8 | Ga0070658_10584777 | 3300005327 | Unclassified | 967 |
| 9 | Ga0070676_10000882 | 3300005328 | Bacteria | 14791 |
| 10 | Ga0070676_10048417 | 3300005328 | Bacteria | 2485 |
| 11 | Ga0070683_100000450 | 3300005329 | Bacteria | 28685 |
| 12 | Ga0070683_100458673 | 3300005329 | Bacteria | 1216 |
| 13 | Ga0070690_100013110 | 3300005330 | Bacteria | 4892 |
| 14 | Ga0070680_100000672 | 3300005336 | Bacteria | 23772 |
| 15 | Ga0070680_100229725 | 3300005336 | Bacteria | 1567 |
| 16 | Ga0070682_100003469 | 3300005337 | Bacteria | 8728 |
| 17 | Ga0070660_100086157 | 3300005339 | Bacteria | 2471 |
| 18 | Ga0070660_100766978 | 3300005339 | Bacteria | 810 |
| 19 | Ga0070675_101066833 | 3300005354 | Unclassified | 742 |
| 20 | Ga0070671_100114121 | 3300005355 | Bacteria | 2271 |
| 21 | Ga0070674_100004553 | 3300005356 | Bacteria | 7911 |
| 22 | Ga0070674_100041433 | 3300005356 | Bacteria | 3121 |
| 23 | Ga0070673_100031386 | 3300005364 | Bacteria | 3986 |
| 24 | Ga0070673_101744487 | 3300005364 | Unclassified | 589 |
| 25 | Ga0070663_100948766 | 3300005455 | Unclassified | 745 |
| 26 | Ga0070678_100012060 | 3300005456 | Bacteria | 5357 |
| 27 | Ga0070681_10004770 | 3300005458 | Bacteria | 12991 |
| 28 | Ga0070681_10119439 | 3300005458 | Unclassified | 2572 |
| 29 | Ga0070681_10132692 | 3300005458 | Bacteria | 2422 |
| 30 | Ga0070681_10800995 | 3300005458 | Bacteria | 859 |
| 31 | Ga0068867_100004725 | 3300005459 | Bacteria | 9584 |
| 32 | Ga0070685_10000188 | 3300005466 | Bacteria | 41401 |
| 33 | Ga0070685_10010420 | 3300005466 | Bacteria | 4830 |
| 34 | Ga0070679_100003967 | 3300005530 | Bacteria | 13627 |
| 35 | Ga0070679_100044676 | 3300005530 | Bacteria | 4414 |
| 36 | Ga0070679_100046825 | 3300005530 | Bacteria | 4311 |
| 37 | Ga0070679_100244130 | 3300005530 | Bacteria | 1753 |
| 38 | Ga0070679_100318390 | 3300005530 | Bacteria | 1505 |
| 39 | Ga0070679_100403271 | 3300005530 | Unclassified | 1313 |
| 40 | Ga0070684_100001742 | 3300005535 | Bacteria | 15835 |
| 41 | Ga0070684_100003346 | 3300005535 | Bacteria | 12008 |
| 42 | Ga0070684_100079038 | 3300005535 | Bacteria | 2907 |
| 43 | Ga0070684_100081068 | 3300005535 | Unclassified | 2871 |
| 44 | Ga0070684_100252139 | 3300005535 | Bacteria | 1613 |
| 45 | Ga0070684_100629267 | 3300005535 | Bacteria | 998 |
| 46 | Ga0068853_100008264 | 3300005539 | Bacteria | 8353 |
| 47 | Ga0070672_100017749 | 3300005543 | Bacteria | 5129 |
| 48 | Ga0070686_100006928 | 3300005544 | Bacteria | 6316 |
| 49 | Ga0068855_100000003 | 3300005563 | Bacteria | 589862 |
| 50 | Ga0070664_100300164 | 3300005564 | Bacteria | 1451 |
| 51 | Ga0068856_100000001 | 3300005614 | Bacteria | 565602 |
| 52 | Ga0068856_100001486 | 3300005614 | Bacteria | 24509 |
| 53 | Ga0068856_100001797 | 3300005614 | Bacteria | 22390 |
| 54 | Ga0068856_100877193 | 3300005614 | Bacteria | 916 |
| 55 | Ga0068859_100754718 | 3300005617 | Unclassified | 1062 |
| 56 | Ga0068863_100188895 | 3300005841 | Bacteria | 1980 |
| 57 | Ga0068863_100433736 | 3300005841 | Bacteria | 1288 |
| 58 | Ga0068860_101291885 | 3300005843 | Unclassified | 750 |
| 59 | Ga0068862_100074213 | 3300005844 | Unclassified | 2940 |
| 60 | Ga0081539_10112578 | 3300005985 | Bacteria | 1366 |
| 61 | Ga0081539_10424223 | 3300005985 | Unclassified | 552 |
| 62 | Ga0070717_10721072 | 3300006028 | Unclassified | 906 |
| 63 | Ga0075365_10008718 | 3300006038 | Bacteria | 5779 |
| 64 | Ga0075365_10021935 | 3300006038 | Bacteria | 3993 |
| 65 | Ga0075365_10187471 | 3300006038 | Unclassified | 1447 |
| 66 | Ga0075368_10000022 | 3300006042 | Bacteria | 37479 |
| 67 | Ga0075364_10001221 | 3300006051 | Bacteria | 13828 |
| 68 | Ga0075364_10034044 | 3300006051 | Bacteria | 3284 |
| 69 | Ga0075364_10618551 | 3300006051 | Bacteria | 740 |
| 70 | Ga0075364_11193601 | 3300006051 | Unclassified | 516 |
| 71 | Ga0075362_10010106 | 3300006177 | Bacteria | 3675 |
| 72 | Ga0075367_10000774 | 3300006178 | Bacteria | 12537 |
| 73 | Ga0075369_10000098 | 3300006186 | Bacteria | 23291 |
| 74 | Ga0075366_10000065 | 3300006195 | Bacteria | 39633 |
| 75 | Ga0075366_10000328 | 3300006195 | Bacteria | 21743 |
| 76 | Ga0075366_10001099 | 3300006195 | Bacteria | 13281 |
| 77 | Ga0097621_100001442 | 3300006237 | Bacteria | 16323 |
| 78 | Ga0075370_10026875 | 3300006353 | Bacteria | 3190 |
| 79 | Ga0068871_100000039 | 3300006358 | Bacteria | 69204 |
| 80 | Ga0068871_100340479 | 3300006358 | Unclassified | 1324 |
| 81 | Ga0075428_100018351 | 3300006844 | Bacteria | 7734 |
| 82 | Ga0075431_100976864 | 3300006847 | Unclassified | 814 |
| 83 | Ga0097620_100754691 | 3300006931 | Unclassified | 1062 |
| 84 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 85 | Ga0105240_10005815 | 3300009093 | Bacteria | 18300 |
| 86 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 87 | Ga0105245_10000050 | 3300009098 | Bacteria | 128014 |
| 88 | Ga0105245_10020725 | 3300009098 | Bacteria | 5763 |
| 89 | Ga0105245_10583797 | 3300009098 | Unclassified | 1142 |
| 90 | Ga0105247_10961279 | 3300009101 | Unclassified | 664 |
| 91 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 92 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 93 | Ga0105241_10068781 | 3300009174 | Bacteria | 2744 |
| 94 | Ga0105242_10000011 | 3300009176 | Bacteria | 149791 |
| 95 | Ga0105242_10011274 | 3300009176 | Bacteria | 6869 |
| 96 | Ga0105242_10219249 | 3300009176 | Unclassified | 1699 |
| 97 | Ga0105248_11057931 | 3300009177 | Bacteria | 917 |
| 98 | Ga0105248_11707275 | 3300009177 | Bacteria | 714 |
| 99 | Ga0105237_10086112 | 3300009545 | Bacteria | 3132 |
| 100 | Ga0105237_10286084 | 3300009545 | Bacteria | 1651 |
| 101 | Ga0105238_10184560 | 3300009551 | Unclassified | 2062 |
| 102 | Ga0105238_10191259 | 3300009551 | Bacteria | 2023 |
| 103 | Ga0105238_10257758 | 3300009551 | Bacteria | 1723 |
| 104 | Ga0105249_10002379 | 3300009553 | Bacteria | 16319 |
| 105 | Ga0105249_10172632 | 3300009553 | Unclassified | 2098 |
| 106 | Ga0105249_10291998 | 3300009553 | Bacteria | 1632 |
| 107 | Ga0105249_10312518 | 3300009553 | Bacteria | 1580 |
| 108 | Ga0105239_10007973 | 3300010375 | Bacteria | 12097 |
| 109 | Ga0105239_10052752 | 3300010375 | Bacteria | 4460 |
| 110 | Ga0105239_10064859 | 3300010375 | Unclassified | 4010 |
| 111 | Ga0105239_10218492 | 3300010375 | Bacteria | 2137 |
| 112 | Ga0105239_11160618 | 3300010375 | Bacteria | 890 |
| 113 | Ga0157373_10000351 | 3300013100 | Bacteria | 37083 |
| 114 | Ga0157370_10084025 | 3300013104 | Unclassified | 2993 |
| 115 | Ga0157369_10003258 | 3300013105 | Bacteria | 19325 |
| 116 | Ga0157369_11509225 | 3300013105 | Unclassified | 684 |
| 117 | Ga0157374_10000031 | 3300013296 | Bacteria | 204840 |
| 118 | Ga0157374_10001076 | 3300013296 | Bacteria | 23646 |
| 119 | Ga0157374_10009614 | 3300013296 | Bacteria | 8307 |
| 120 | Ga0157374_10613742 | 3300013296 | Bacteria | 1098 |
| 121 | Ga0157378_10065846 | 3300013297 | Bacteria | 3244 |
| 122 | Ga0157378_11393693 | 3300013297 | Bacteria | 744 |
| 123 | Ga0163162_10618653 | 3300013306 | Bacteria | 1208 |
| 124 | Ga0163162_11219351 | 3300013306 | Bacteria | 854 |
| 125 | Ga0157372_10000670 | 3300013307 | Bacteria | 37704 |
| 126 | Ga0157372_10002726 | 3300013307 | Bacteria | 19106 |
| 127 | Ga0157372_11181660 | 3300013307 | Bacteria | 884 |
| 128 | Ga0163163_10010260 | 3300014325 | Bacteria | 8415 |
| 129 | Ga0163163_10131354 | 3300014325 | Bacteria | 2545 |
| 130 | Ga0157377_10001723 | 3300014745 | Bacteria | 9535 |
| 131 | Ga0157377_10044686 | 3300014745 | Unclassified | 2471 |
| 132 | Ga0157379_10113987 | 3300014968 | Bacteria | 2430 |
| 133 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 134 | Ga0157376_10841112 | 3300014969 | Bacteria | 933 |
| 135 | Ga0197907_10505822 | 3300020069 | Unclassified | 619 |
| 136 | Ga0207647_10208410 | 3300025904 | Unclassified | 1129 |
| 137 | Ga0207645_10005988 | 3300025907 | Bacteria | 8752 |
| 138 | Ga0207645_10057412 | 3300025907 | Bacteria | 2485 |
| 139 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 140 | Ga0207705_10000038 | 3300025909 | Bacteria | 193812 |
| 141 | Ga0207705_10000167 | 3300025909 | Bacteria | 71284 |
| 142 | Ga0207705_10027913 | 3300025909 | Bacteria | 4025 |
| 143 | Ga0207705_10215651 | 3300025909 | Bacteria | 1456 |
| 144 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 145 | Ga0207654_10046934 | 3300025911 | Bacteria | 2465 |
| 146 | Ga0207707_10004217 | 3300025912 | Bacteria | 12723 |
| 147 | Ga0207707_10061504 | 3300025912 | Bacteria | 3267 |
| 148 | Ga0207707_10666854 | 3300025912 | Bacteria | 876 |
| 149 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 150 | Ga0207695_10006811 | 3300025913 | Bacteria | 14729 |
| 151 | Ga0207671_10127374 | 3300025914 | Bacteria | 1952 |
| 152 | Ga0207671_10537372 | 3300025914 | Bacteria | 932 |
| 153 | Ga0207660_10000748 | 3300025917 | Bacteria | 21610 |
| 154 | Ga0207660_10205019 | 3300025917 | Bacteria | 1541 |
| 155 | Ga0207657_10016618 | 3300025919 | Bacteria | 7090 |
| 156 | Ga0207652_10002682 | 3300025921 | Bacteria | 14930 |
| 157 | Ga0207652_10008070 | 3300025921 | Bacteria | 8450 |
| 158 | Ga0207652_10028924 | 3300025921 | Bacteria | 4627 |
| 159 | Ga0207652_10785257 | 3300025921 | Bacteria | 846 |
| 160 | Ga0207694_10134833 | 3300025924 | Bacteria | 1982 |
| 161 | Ga0207694_10194213 | 3300025924 | Bacteria | 1650 |
| 162 | Ga0207694_11342322 | 3300025924 | Bacteria | 605 |
| 163 | Ga0207694_11551887 | 3300025924 | Bacteria | 558 |
| 164 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 165 | Ga0207687_10000324 | 3300025927 | Bacteria | 32503 |
| 166 | Ga0207687_10011646 | 3300025927 | Bacteria | 5748 |
| 167 | Ga0207687_10404443 | 3300025927 | Unclassified | 1123 |
| 168 | Ga0207644_10018711 | 3300025931 | Bacteria | 4689 |
| 169 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 170 | Ga0207686_10007276 | 3300025934 | Bacteria | 5956 |
| 171 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 172 | Ga0207669_10003257 | 3300025937 | Bacteria | 7020 |
| 173 | Ga0207669_10068355 | 3300025937 | Bacteria | 2218 |
| 174 | Ga0207704_10198191 | 3300025938 | Bacteria | 1467 |
| 175 | Ga0207691_10168671 | 3300025940 | Bacteria | 1917 |
| 176 | Ga0207711_10805466 | 3300025941 | Bacteria | 875 |
| 177 | Ga0207661_10000021 | 3300025944 | Bacteria | 205381 |
| 178 | Ga0207661_10003681 | 3300025944 | Bacteria | 10682 |
| 179 | Ga0207679_10505066 | 3300025945 | Bacteria | 1079 |
| 180 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 181 | Ga0207667_11177067 | 3300025949 | Bacteria | 747 |
| 182 | Ga0207651_10023191 | 3300025960 | Bacteria | 3811 |
| 183 | Ga0207651_10384009 | 3300025960 | Bacteria | 1191 |
| 184 | Ga0207712_10001459 | 3300025961 | Bacteria | 16136 |
| 185 | Ga0207712_10582819 | 3300025961 | Unclassified | 966 |
| 186 | Ga0207712_11050402 | 3300025961 | Unclassified | 724 |
| 187 | Ga0207703_10126906 | 3300026035 | Bacteria | 2198 |
| 188 | Ga0207639_10085904 | 3300026041 | Bacteria | 2504 |
| 189 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 190 | Ga0207702_10001268 | 3300026078 | Bacteria | 25374 |
| 191 | Ga0207702_10003219 | 3300026078 | Bacteria | 15080 |
| 192 | Ga0207702_10573015 | 3300026078 | Bacteria | 1106 |
| 193 | Ga0207641_10162711 | 3300026088 | Bacteria | 2030 |
| 194 | Ga0207648_10043597 | 3300026089 | Unclassified | 3938 |
| 195 | Ga0207674_10248630 | 3300026116 | Bacteria | 1725 |
| 196 | Ga0207683_10006630 | 3300026121 | Bacteria | 9907 |
| 197 | Ga0207698_10286574 | 3300026142 | Unclassified | 1526 |
| 198 | Ga0209813_10000206 | 3300027866 | Bacteria | 18248 |
| 199 | Ga0268266_10003734 | 3300028379 | Bacteria | 14969 |
| 200 | Ga0268264_11624788 | 3300028381 | Unclassified | 657 |
| 201 | Ga0265337_1034206 | 3300028556 | Bacteria | 1496 |
| 202 | Ga0265319_1134498 | 3300028563 | Bacteria | 768 |
| 203 | Ga0265334_10000114 | 3300028573 | Bacteria | 52821 |
| 204 | Ga0265334_10024657 | 3300028573 | Bacteria | 2438 |
| 205 | Ga0265338_10000217 | 3300028800 | Bacteria | 106453 |
| 206 | Ga0265338_10000543 | 3300028800 | Bacteria | 66162 |
| 207 | Ga0265338_10081884 | 3300028800 | Unclassified | 2704 |
| 208 | Ga0265320_10118226 | 3300031240 | Unclassified | 1210 |
| 209 | Ga0265340_10000533 | 3300031247 | Bacteria | 21017 |
| 210 | Ga0265327_10000017 | 3300031251 | Bacteria | 445264 |
| 211 | Ga0265327_10019923 | 3300031251 | Unclassified | 4107 |
| 212 | Ga0265342_10541933 | 3300031712 | Unclassified | 591 |
| 213 | Ga0307516_10457394 | 3300031730 | Unclassified | 932 |
| 214 | Ga0373934_0253447 | 3300035086 | Bacteria | 728 |
| 215 | Ga0395899_0008649 | 3300037312 | Bacteria | 7833 |
| 216 | Ga0395900_0005264 | 3300037418 | Bacteria | 13568 |
| 217 | Ga0395900_1465456 | 3300037418 | Unclassified | 595 |
| 218 | Ga0395898_0275817 | 3300037466 | Bacteria | 1604 |
| 219 | Ga0395905_0398645 | 3300037471 | Bacteria | 1271 |
| 220 | Ga0395905_0445866 | 3300037471 | Bacteria | 1192 |
| 221 | Ga0395901_0011912 | 3300038443 | Bacteria | 8818 |
| 222 | Ga0395901_0028005 | 3300038443 | Bacteria | 5795 |
| 223 | Ga0395901_0053748 | 3300038443 | Bacteria | 4185 |
| 224 | Ga0395901_0146552 | 3300038443 | Bacteria | 2481 |
| 225 | Ga0451804_0348952 | 3300041463 | Unclassified | 841 |
| 226 | Ga0451849_1308950 | 3300041505 | Bacteria | 527 |
| 227 | Ga0439456_100226 | 3300042013 | Unclassified | 655 |
| 228 | Ga0451577_0526231 | 3300042876 | Bacteria | 1074 |
| 229 | Ga0495590_0176369 | 3300046457 | Unclassified | 780 |
| 230 | Ga0495609_0069448 | 3300046538 | Bacteria | 1549 |
| 231 | Ga0495672_0099923 | 3300047320 | Bacteria | 1576 |
| 232 | Ga0496100_0261612 | 3300048903 | Bacteria | 1283 |
| 233 | Ga0496104_0428192 | 3300048907 | Bacteria | 1235 |
| 234 | Ga0496105_0958228 | 3300048908 | Bacteria | 642 |
| 235 | Ga0496109_0054472 | 3300048912 | Bacteria | 3649 |
| 236 | Ga0496112_0065373 | 3300048915 | Bacteria | 3589 |
| 237 | Ga0496112_0191809 | 3300048915 | Bacteria | 2005 |
| 238 | Ga0496125_0232675 | 3300048928 | Bacteria | 1177 |
| 239 | Ga0496126_0124833 | 3300048929 | Unclassified | 2229 |
| 240 | Ga0501031_0002004 | 3300049568 | Bacteria | 12844 |
| 241 | Ga0501032_0000394 | 3300049569 | Bacteria | 36017 |
| 242 | Ga0501034_0009643 | 3300049571 | Bacteria | 10098 |
| 243 | Ga0501034_0014829 | 3300049571 | Bacteria | 8018 |
| 244 | Ga0501034_0040779 | 3300049571 | Bacteria | 4698 |
| 245 | Ga0501036_0006297 | 3300049572 | Bacteria | 9632 |
| 246 | Ga0501036_0246558 | 3300049572 | Unclassified | 1497 |
| 247 | Ga0501037_0000133 | 3300049573 | Bacteria | 69741 |
| 248 | Ga0501037_0077445 | 3300049573 | Bacteria | 2413 |
| 249 | Ga0501037_0172972 | 3300049573 | Unclassified | 1534 |
| 250 | Ga0501038_0006750 | 3300049574 | Bacteria | 10603 |
| 251 | Ga0501039_0157714 | 3300049575 | Unclassified | 1783 |
| 252 | Ga0501042_0036960 | 3300049578 | Bacteria | 3465 |
| 253 | Ga0501043_0001721 | 3300049579 | Bacteria | 18919 |
| 254 | Ga0501046_0000038 | 3300049580 | Bacteria | 159193 |
| 255 | Ga0501046_0098790 | 3300049580 | Bacteria | 2241 |
| 256 | Ga0501047_0002015 | 3300049581 | Bacteria | 19485 |
| 257 | Ga0501047_0004985 | 3300049581 | Bacteria | 12460 |
| 258 | Ga0501048_0000033 | 3300049582 | Bacteria | 64896 |
| 259 | Ga0501069_0037707 | 3300049585 | Unclassified | 2668 |
| 260 | Ga0501070_0027994 | 3300049586 | Bacteria | 4727 |
| 261 | Ga0501070_0356844 | 3300049586 | Unclassified | 1186 |
| 262 | Ga0501073_1075649 | 3300049589 | Unclassified | 553 |
| 263 | Ga0501074_0464333 | 3300049590 | Bacteria | 897 |
| 264 | Ga0501080_0494144 | 3300049742 | Unclassified | 1094 |
| 265 | Ga0501083_0027339 | 3300049744 | Bacteria | 3937 |
| 266 | Ga0501083_0127695 | 3300049744 | Unclassified | 1666 |
| 267 | Ga0501276_014686 | 3300049773 | Bacteria | 698 |
| 268 | Ga0501035_0000033 | 3300049822 | Bacteria | 175087 |
| 269 | Ga0501035_0005497 | 3300049822 | Bacteria | 11971 |
| 270 | Ga0501044_0041603 | 3300049823 | Bacteria | 4784 |
| 271 | Ga0501044_0871414 | 3300049823 | Unclassified | 776 |
| 272 | nmdc:mga03683_9557_c1 | 3300050489 | Bacteria | 3453 |
| 273 | nmdc:mga03n38_7220_c1 | 3300050490 | Bacteria | 3918 |
| 274 | nmdc:mga00v17_14675_c1 | 3300050491 | Bacteria | 4381 |
| 275 | nmdc:mga00v17_28052_c1 | 3300050491 | Bacteria | 3293 |
| 276 | nmdc:mga00v17_806065_c1 | 3300050491 | Unclassified | 598 |
| 277 | nmdc:mga0yw44_18435_c1 | 3300050492 | Bacteria | 3823 |
| 278 | nmdc:mga0yw44_330_c1 | 3300050492 | Bacteria | 16596 |
| 279 | nmdc:mga0yw44_40646_c1 | 3300050492 | Bacteria | 2764 |
| 280 | nmdc:mga0k408_144_c1 | 3300050493 | Bacteria | 36305 |
| 281 | nmdc:mga0k408_14_c3 | 3300050493 | Bacteria | 36052 |
| 282 | nmdc:mga0k408_22018_c1 | 3300050493 | Bacteria | 3586 |
| 283 | nmdc:mga0k408_602981_c1 | 3300050493 | Unclassified | 647 |
| 284 | nmdc:mga06z11_10627_c1 | 3300050494 | Bacteria | 3932 |
| 285 | nmdc:mga06z11_53_c2 | 3300050494 | Bacteria | 47411 |
| 286 | nmdc:mga04h51_1103_c1 | 3300050495 | Bacteria | 6213 |
| 287 | nmdc:mga04h51_17608_c1 | 3300050495 | Bacteria | 2093 |
| 288 | nmdc:mga07m45_25181_c1 | 3300050496 | Bacteria | 3262 |
| 289 | nmdc:mga06r32_949615_c1 | 3300050510 | Unclassified | 814 |
| 290 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 291 | nmdc:mga0sz30_2731_c1 | 3300050516 | Bacteria | 6301 |
| 292 | Ga0500610_0000001 | 3300053079 | Bacteria | 185468 |
| 293 | Ga0500610_0104870 | 3300053079 | Bacteria | 1459 |
| 294 | Ga0500610_0124321 | 3300053079 | Bacteria | 1317 |
| 295 | Ga0500643_000011 | 3300053087 | Bacteria | 385630 |
| 296 | Ga0500644_0000636 | 3300053088 | Bacteria | 13080 |
| 297 | Ga0500644_0000923 | 3300053088 | Bacteria | 9347 |
| 298 | Ga0500644_0051746 | 3300053088 | Bacteria | 1412 |
| 299 | Ga0500646_0000426 | 3300053090 | Bacteria | 12557 |
| 300 | Ga0500583_0000067 | 3300053092 | Bacteria | 64775 |
| 301 | Ga0500583_0049026 | 3300053092 | Bacteria | 1952 |
| 302 | Ga0500651_0000416 | 3300053093 | Bacteria | 22899 |
| 303 | Ga0500651_0204921 | 3300053093 | Bacteria | 1162 |
| 304 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 305 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 306 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 307 | Ga0500556_0000246 | 3300053104 | Bacteria | 43933 |
| 308 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 309 | Ga0500594_0000711 | 3300053118 | Bacteria | 7094 |
| 310 | Ga0500594_0079505 | 3300053118 | Bacteria | 978 |
| 311 | Ga0500614_000411 | 3300053123 | Bacteria | 11177 |
| 312 | Ga0500628_000006 | 3300053129 | Bacteria | 154858 |
| 313 | Ga0500642_0000722 | 3300053130 | Bacteria | 9746 |
| 314 | Ga0500652_000084 | 3300053131 | Bacteria | 39562 |
| 315 | Ga0500655_000374 | 3300053133 | Bacteria | 9718 |
| 316 | Ga0500577_0000856 | 3300053142 | Bacteria | 7873 |
| 317 | Ga0500577_0001854 | 3300053142 | Bacteria | 5415 |
| 318 | Ga0500579_003450 | 3300053143 | Bacteria | 9502 |
| 319 | Ga0500589_000008 | 3300053147 | Bacteria | 137145 |
| 320 | Ga0500616_0031886 | 3300053153 | Bacteria | 2883 |
| 321 | Ga0500633_0001431 | 3300053160 | Bacteria | 4488 |
| 322 | Ga0587094_000374 | 3300059513 | Bacteria | 3300 |
| 323 | Ga0587115_012485 | 3300059626 | Bacteria | 1086 |
| 324 | Ga0587069_032626 | 3300059642 | Bacteria | 850 |
| 325 | Ga0587110_000694 | 3300059654 | Bacteria | 2129 |
| 326 | Ga0501082_0012274 | 3300060353 | Bacteria | 7363 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10000012 | Ga0070658_10000012227 | 128 |
| 2 | 3300005328 | Ga0070676_10048417 | Ga0070676_100484172 | 128 |
| 3 | 3300005356 | Ga0070674_100041433 | Ga0070674_1000414333 | 128 |
| 4 | 3300005364 | Ga0070673_100031386 | Ga0070673_1000313863 | 128 |
| 5 | 3300005456 | Ga0070678_100012060 | Ga0070678_1000120603 | 128 |
| 6 | 3300005466 | Ga0070685_10000188 | Ga0070685_1000018834 | 128 |
| 7 | 3300005543 | Ga0070672_100017749 | Ga0070672_1000177495 | 128 |
| 8 | 3300009176 | Ga0105242_10219249 | Ga0105242_102192492 | 128 |
| 9 | 3300010375 | Ga0105239_10007973 | Ga0105239_100079732 | 128 |
| 10 | 3300025907 | Ga0207645_10057412 | Ga0207645_100574123 | 128 |
| 11 | 3300025909 | Ga0207705_10000038 | Ga0207705_10000038194 | 128 |
| 12 | 3300025937 | Ga0207669_10068355 | Ga0207669_100683553 | 128 |
| 13 | 3300025940 | Ga0207691_10168671 | Ga0207691_101686711 | 128 |
| 14 | 3300025960 | Ga0207651_10023191 | Ga0207651_100231914 | 128 |
| 15 | 3300026121 | Ga0207683_10006630 | Ga0207683_1000663010 | 128 |
| 16 | 3300050495 | nmdc:mga04h51_1103_c1 | nmdc:mga04h51_1103_c1_5748_6167 | 130 |
| 17 | 3300049571 | Ga0501034_0014829 | Ga0501034_0014829_561_1001 | 131 |
| 18 | 3300049572 | Ga0501036_0246558 | Ga0501036_0246558_699_1139 | 131 |
| 19 | 3300049573 | Ga0501037_0172972 | Ga0501037_0172972_124_564 | 131 |
| 20 | 3300049581 | Ga0501047_0002015 | Ga0501047_0002015_11567_12007 | 131 |
| 21 | 3300049822 | Ga0501035_0000033 | Ga0501035_0000033_171957_172397 | 131 |
| 22 | 3300049823 | Ga0501044_0871414 | Ga0501044_0871414_136_576 | 131 |
| 23 | 3300005327 | Ga0070658_10584777 | Ga0070658_105847772 | 137 |
| 24 | 3300053087 | Ga0500643_000011 | Ga0500643_000011_71490_71933 | 139 |
| 25 | 3300005530 | Ga0070679_100318390 | Ga0070679_1003183902 | 143 |
| 26 | 3300005530 | Ga0070679_100403271 | Ga0070679_1004032712 | 143 |
| 27 | 3300005985 | Ga0081539_10424223 | Ga0081539_104242232 | 143 |
| 28 | 3300006038 | Ga0075365_10021935 | Ga0075365_100219353 | 143 |
| 29 | 3300006042 | Ga0075368_10000022 | Ga0075368_1000002222 | 143 |
| 30 | 3300006051 | Ga0075364_10001221 | Ga0075364_1000122119 | 143 |
| 31 | 3300006177 | Ga0075362_10010106 | Ga0075362_100101067 | 143 |
| 32 | 3300006178 | Ga0075367_10000774 | Ga0075367_1000077425 | 143 |
| 33 | 3300006186 | Ga0075369_10000098 | Ga0075369_100000988 | 143 |
| 34 | 3300006353 | Ga0075370_10026875 | Ga0075370_100268754 | 143 |
| 35 | 3300006358 | Ga0068871_100340479 | Ga0068871_1003404792 | 143 |
| 36 | 3300025921 | Ga0207652_10785257 | Ga0207652_107852572 | 143 |
| 37 | 3300027866 | Ga0209813_10000206 | Ga0209813_100002068 | 143 |
| 38 | 3300049589 | Ga0501073_1075649 | Ga0501073_1075649_84_524 | 143 |
| 39 | 3300050489 | nmdc:mga03683_9557_c1 | nmdc:mga03683_9557_c1_2982_3425 | 143 |
| 40 | 3300050490 | nmdc:mga03n38_7220_c1 | nmdc:mga03n38_7220_c1_782_1225 | 143 |
| 41 | 3300050491 | nmdc:mga00v17_14675_c1 | nmdc:mga00v17_14675_c1_449_892 | 143 |
| 42 | 3300050492 | nmdc:mga0yw44_330_c1 | nmdc:mga0yw44_330_c1_10452_10895 | 143 |
| 43 | 3300050494 | nmdc:mga06z11_10627_c1 | nmdc:mga06z11_10627_c1_2611_3054 | 143 |
| 44 | 3300050495 | nmdc:mga04h51_17608_c1 | nmdc:mga04h51_17608_c1_878_1321 | 143 |
| 45 | 3300050496 | nmdc:mga07m45_25181_c1 | nmdc:mga07m45_25181_c1_736_1179 | 143 |
| 46 | 3300050516 | nmdc:mga0sz30_2731_c1 | nmdc:mga0sz30_2731_c1_522_965 | 143 |
| 47 | 3300053088 | Ga0500644_0051746 | Ga0500644_0051746_743_1186 | 143 |
| 48 | 3300053153 | Ga0500616_0031886 | Ga0500616_0031886_2328_2771 | 143 |
| 49 | 3300005327 | Ga0070658_10000015 | Ga0070658_1000001510 | 146 |
| 50 | 3300005327 | Ga0070658_10000118 | Ga0070658_1000011819 | 146 |
| 51 | 3300005327 | Ga0070658_10001547 | Ga0070658_100015473 | 146 |
| 52 | 3300005327 | Ga0070658_10021675 | Ga0070658_100216758 | 146 |
| 53 | 3300005327 | Ga0070658_10022371 | Ga0070658_100223715 | 146 |
| 54 | 3300005329 | Ga0070683_100000450 | Ga0070683_10000045032 | 146 |
| 55 | 3300005329 | Ga0070683_100458673 | Ga0070683_1004586732 | 146 |
| 56 | 3300005330 | Ga0070690_100013110 | Ga0070690_1000131104 | 146 |
| 57 | 3300005336 | Ga0070680_100000672 | Ga0070680_10000067243 | 146 |
| 58 | 3300005336 | Ga0070680_100229725 | Ga0070680_1002297253 | 146 |
| 59 | 3300005337 | Ga0070682_100003469 | Ga0070682_1000034696 | 146 |
| 60 | 3300005339 | Ga0070660_100086157 | Ga0070660_1000861573 | 146 |
| 61 | 3300005339 | Ga0070660_100766978 | Ga0070660_1007669782 | 146 |
| 62 | 3300005354 | Ga0070675_101066833 | Ga0070675_1010668332 | 146 |
| 63 | 3300005355 | Ga0070671_100114121 | Ga0070671_1001141214 | 146 |
| 64 | 3300005356 | Ga0070674_100004553 | Ga0070674_1000045539 | 146 |
| 65 | 3300005455 | Ga0070663_100948766 | Ga0070663_1009487661 | 146 |
| 66 | 3300005458 | Ga0070681_10004770 | Ga0070681_100047709 | 146 |
| 67 | 3300005458 | Ga0070681_10119439 | Ga0070681_101194393 | 146 |
| 68 | 3300005458 | Ga0070681_10132692 | Ga0070681_101326922 | 146 |
| 69 | 3300005458 | Ga0070681_10800995 | Ga0070681_108009951 | 146 |
| 70 | 3300005459 | Ga0068867_100004725 | Ga0068867_10000472510 | 146 |
| 71 | 3300005466 | Ga0070685_10010420 | Ga0070685_100104209 | 146 |
| 72 | 3300005530 | Ga0070679_100003967 | Ga0070679_10000396726 | 146 |
| 73 | 3300005530 | Ga0070679_100044676 | Ga0070679_1000446763 | 146 |
| 74 | 3300005530 | Ga0070679_100046825 | Ga0070679_1000468257 | 146 |
| 75 | 3300005530 | Ga0070679_100244130 | Ga0070679_1002441302 | 146 |
| 76 | 3300005535 | Ga0070684_100003346 | Ga0070684_10000334617 | 146 |
| 77 | 3300005535 | Ga0070684_100079038 | Ga0070684_1000790383 | 146 |
| 78 | 3300005535 | Ga0070684_100081068 | Ga0070684_1000810684 | 146 |
| 79 | 3300005535 | Ga0070684_100252139 | Ga0070684_1002521393 | 146 |
| 80 | 3300005535 | Ga0070684_100629267 | Ga0070684_1006292672 | 146 |
| 81 | 3300005539 | Ga0068853_100008264 | Ga0068853_10000826411 | 146 |
| 82 | 3300005544 | Ga0070686_100006928 | Ga0070686_1000069283 | 146 |
| 83 | 3300005563 | Ga0068855_100000003 | Ga0068855_100000003161 | 146 |
| 84 | 3300005564 | Ga0070664_100300164 | Ga0070664_1003001643 | 146 |
| 85 | 3300005614 | Ga0068856_100000001 | Ga0068856_100000001309 | 146 |
| 86 | 3300005614 | Ga0068856_100001486 | Ga0068856_10000148616 | 146 |
| 87 | 3300005617 | Ga0068859_100754718 | Ga0068859_1007547182 | 146 |
| 88 | 3300005841 | Ga0068863_100188895 | Ga0068863_1001888953 | 146 |
| 89 | 3300005841 | Ga0068863_100433736 | Ga0068863_1004337362 | 146 |
| 90 | 3300005844 | Ga0068862_100074213 | Ga0068862_1000742135 | 146 |
| 91 | 3300005985 | Ga0081539_10112578 | Ga0081539_101125783 | 146 |
| 92 | 3300006028 | Ga0070717_10721072 | Ga0070717_107210722 | 146 |
| 93 | 3300006038 | Ga0075365_10008718 | Ga0075365_100087183 | 146 |
| 94 | 3300006038 | Ga0075365_10187471 | Ga0075365_101874712 | 146 |
| 95 | 3300006051 | Ga0075364_10034044 | Ga0075364_100340441 | 146 |
| 96 | 3300006051 | Ga0075364_10618551 | Ga0075364_106185512 | 146 |
| 97 | 3300006051 | Ga0075364_11193601 | Ga0075364_111936011 | 146 |
| 98 | 3300006195 | Ga0075366_10000065 | Ga0075366_1000006528 | 146 |
| 99 | 3300006195 | Ga0075366_10001099 | Ga0075366_100010999 | 146 |
| 100 | 3300006237 | Ga0097621_100001442 | Ga0097621_10000144221 | 146 |
| 101 | 3300006358 | Ga0068871_100000039 | Ga0068871_10000003961 | 146 |
| 102 | 3300006844 | Ga0075428_100018351 | Ga0075428_1000183518 | 146 |
| 103 | 3300006847 | Ga0075431_100976864 | Ga0075431_1009768642 | 146 |
| 104 | 3300006931 | Ga0097620_100754691 | Ga0097620_1007546912 | 146 |
| 105 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003864 | 146 |
| 106 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002265 | 146 |
| 107 | 3300009098 | Ga0105245_10000050 | Ga0105245_100000503 | 146 |
| 108 | 3300009098 | Ga0105245_10020725 | Ga0105245_100207255 | 146 |
| 109 | 3300009098 | Ga0105245_10583797 | Ga0105245_105837972 | 146 |
| 110 | 3300009101 | Ga0105247_10961279 | Ga0105247_109612791 | 146 |
| 111 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001427 | 146 |
| 112 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003142 | 146 |
| 113 | 3300009176 | Ga0105242_10000011 | Ga0105242_1000001124 | 146 |
| 114 | 3300009176 | Ga0105242_10011274 | Ga0105242_100112743 | 146 |
| 115 | 3300009177 | Ga0105248_11057931 | Ga0105248_110579312 | 146 |
| 116 | 3300009177 | Ga0105248_11707275 | Ga0105248_117072752 | 146 |
| 117 | 3300009545 | Ga0105237_10086112 | Ga0105237_100861124 | 146 |
| 118 | 3300009545 | Ga0105237_10286084 | Ga0105237_102860842 | 146 |
| 119 | 3300009551 | Ga0105238_10184560 | Ga0105238_101845604 | 146 |
| 120 | 3300009551 | Ga0105238_10191259 | Ga0105238_101912592 | 146 |
| 121 | 3300009551 | Ga0105238_10257758 | Ga0105238_102577582 | 146 |
| 122 | 3300009553 | Ga0105249_10002379 | Ga0105249_1000237928 | 146 |
| 123 | 3300009553 | Ga0105249_10172632 | Ga0105249_101726323 | 146 |
| 124 | 3300009553 | Ga0105249_10312518 | Ga0105249_103125182 | 146 |
| 125 | 3300010375 | Ga0105239_10052752 | Ga0105239_100527521 | 146 |
| 126 | 3300010375 | Ga0105239_10064859 | Ga0105239_100648593 | 146 |
| 127 | 3300010375 | Ga0105239_10218492 | Ga0105239_102184923 | 146 |
| 128 | 3300010375 | Ga0105239_11160618 | Ga0105239_111606182 | 146 |
| 129 | 3300013105 | Ga0157369_10003258 | Ga0157369_1000325834 | 146 |
| 130 | 3300013105 | Ga0157369_11509225 | Ga0157369_115092252 | 146 |
| 131 | 3300013296 | Ga0157374_10000031 | Ga0157374_10000031106 | 146 |
| 132 | 3300013296 | Ga0157374_10001076 | Ga0157374_1000107619 | 146 |
| 133 | 3300013296 | Ga0157374_10009614 | Ga0157374_100096142 | 146 |
| 134 | 3300013296 | Ga0157374_10613742 | Ga0157374_106137422 | 146 |
| 135 | 3300013297 | Ga0157378_10065846 | Ga0157378_100658464 | 146 |
| 136 | 3300013297 | Ga0157378_11393693 | Ga0157378_113936931 | 146 |
| 137 | 3300013306 | Ga0163162_10618653 | Ga0163162_106186533 | 146 |
| 138 | 3300013306 | Ga0163162_11219351 | Ga0163162_112193512 | 146 |
| 139 | 3300013307 | Ga0157372_10000670 | Ga0157372_1000067022 | 146 |
| 140 | 3300013307 | Ga0157372_10002726 | Ga0157372_1000272636 | 146 |
| 141 | 3300013307 | Ga0157372_11181660 | Ga0157372_111816602 | 146 |
| 142 | 3300014325 | Ga0163163_10010260 | Ga0163163_100102608 | 146 |
| 143 | 3300014325 | Ga0163163_10131354 | Ga0163163_101313544 | 146 |
| 144 | 3300014745 | Ga0157377_10001723 | Ga0157377_100017235 | 146 |
| 145 | 3300014745 | Ga0157377_10044686 | Ga0157377_100446863 | 146 |
| 146 | 3300014968 | Ga0157379_10113987 | Ga0157379_101139872 | 146 |
| 147 | 3300014969 | Ga0157376_10000001 | Ga0157376_1000000167 | 146 |
| 148 | 3300014969 | Ga0157376_10841112 | Ga0157376_108411122 | 146 |
| 149 | 3300025904 | Ga0207647_10208410 | Ga0207647_102084102 | 146 |
| 150 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011336 | 146 |
| 151 | 3300025909 | Ga0207705_10000167 | Ga0207705_1000016769 | 146 |
| 152 | 3300025909 | Ga0207705_10027913 | Ga0207705_100279133 | 146 |
| 153 | 3300025909 | Ga0207705_10215651 | Ga0207705_102156512 | 146 |
| 154 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021067 | 146 |
| 155 | 3300025912 | Ga0207707_10004217 | Ga0207707_1000421714 | 146 |
| 156 | 3300025912 | Ga0207707_10061504 | Ga0207707_100615045 | 146 |
| 157 | 3300025912 | Ga0207707_10666854 | Ga0207707_106668542 | 146 |
| 158 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005874 | 146 |
| 159 | 3300025914 | Ga0207671_10127374 | Ga0207671_101273742 | 146 |
| 160 | 3300025914 | Ga0207671_10537372 | Ga0207671_105373722 | 146 |
| 161 | 3300025917 | Ga0207660_10000748 | Ga0207660_1000074810 | 146 |
| 162 | 3300025917 | Ga0207660_10205019 | Ga0207660_102050193 | 146 |
| 163 | 3300025919 | Ga0207657_10016618 | Ga0207657_100166185 | 146 |
| 164 | 3300025921 | Ga0207652_10002682 | Ga0207652_1000268214 | 146 |
| 165 | 3300025921 | Ga0207652_10008070 | Ga0207652_100080704 | 146 |
| 166 | 3300025921 | Ga0207652_10028924 | Ga0207652_100289246 | 146 |
| 167 | 3300025924 | Ga0207694_10134833 | Ga0207694_101348334 | 146 |
| 168 | 3300025924 | Ga0207694_10194213 | Ga0207694_101942133 | 146 |
| 169 | 3300025924 | Ga0207694_11342322 | Ga0207694_113423221 | 146 |
| 170 | 3300025924 | Ga0207694_11551887 | Ga0207694_115518872 | 146 |
| 171 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001946 | 146 |
| 172 | 3300025927 | Ga0207687_10000324 | Ga0207687_100003243 | 146 |
| 173 | 3300025927 | Ga0207687_10011646 | Ga0207687_100116465 | 146 |
| 174 | 3300025927 | Ga0207687_10404443 | Ga0207687_104044432 | 146 |
| 175 | 3300025931 | Ga0207644_10018711 | Ga0207644_100187115 | 146 |
| 176 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001715 | 146 |
| 177 | 3300025934 | Ga0207686_10007276 | Ga0207686_100072768 | 146 |
| 178 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002833 | 146 |
| 179 | 3300025937 | Ga0207669_10003257 | Ga0207669_100032572 | 146 |
| 180 | 3300025938 | Ga0207704_10198191 | Ga0207704_101981913 | 146 |
| 181 | 3300025941 | Ga0207711_10805466 | Ga0207711_108054662 | 146 |
| 182 | 3300025944 | Ga0207661_10000021 | Ga0207661_10000021194 | 146 |
| 183 | 3300025945 | Ga0207679_10505066 | Ga0207679_105050661 | 146 |
| 184 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008160 | 146 |
| 185 | 3300025949 | Ga0207667_11177067 | Ga0207667_111770672 | 146 |
| 186 | 3300025961 | Ga0207712_10001459 | Ga0207712_100014594 | 146 |
| 187 | 3300025961 | Ga0207712_10582819 | Ga0207712_105828192 | 146 |
| 188 | 3300026035 | Ga0207703_10126906 | Ga0207703_101269064 | 146 |
| 189 | 3300026041 | Ga0207639_10085904 | Ga0207639_100859042 | 146 |
| 190 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001858 | 146 |
| 191 | 3300026078 | Ga0207702_10001268 | Ga0207702_1000126817 | 146 |
| 192 | 3300026088 | Ga0207641_10162711 | Ga0207641_101627112 | 146 |
| 193 | 3300026089 | Ga0207648_10043597 | Ga0207648_100435974 | 146 |
| 194 | 3300026116 | Ga0207674_10248630 | Ga0207674_102486303 | 146 |
| 195 | 3300028379 | Ga0268266_10003734 | Ga0268266_1000373427 | 146 |
| 196 | 3300028556 | Ga0265337_1034206 | Ga0265337_10342061 | 146 |
| 197 | 3300028563 | Ga0265319_1134498 | Ga0265319_11344982 | 146 |
| 198 | 3300028573 | Ga0265334_10000114 | Ga0265334_1000011447 | 146 |
| 199 | 3300028573 | Ga0265334_10024657 | Ga0265334_100246573 | 146 |
| 200 | 3300028800 | Ga0265338_10000217 | Ga0265338_1000021791 | 146 |
| 201 | 3300028800 | Ga0265338_10000543 | Ga0265338_1000054324 | 146 |
| 202 | 3300028800 | Ga0265338_10081884 | Ga0265338_100818845 | 146 |
| 203 | 3300031240 | Ga0265320_10118226 | Ga0265320_101182263 | 146 |
| 204 | 3300031247 | Ga0265340_10000533 | Ga0265340_1000053321 | 146 |
| 205 | 3300031251 | Ga0265327_10000017 | Ga0265327_10000017189 | 146 |
| 206 | 3300031251 | Ga0265327_10019923 | Ga0265327_100199237 | 146 |
| 207 | 3300031712 | Ga0265342_10541933 | Ga0265342_105419331 | 146 |
| 208 | 3300035086 | Ga0373934_0253447 | Ga0373934_0253447_204_644 | 146 |
| 209 | 3300037312 | Ga0395899_0008649 | Ga0395899_0008649_6148_6588 | 146 |
| 210 | 3300037418 | Ga0395900_0005264 | Ga0395900_0005264_2151_2591 | 146 |
| 211 | 3300037418 | Ga0395900_1465456 | Ga0395900_1465456_108_548 | 146 |
| 212 | 3300037466 | Ga0395898_0275817 | Ga0395898_0275817_1020_1460 | 146 |
| 213 | 3300037471 | Ga0395905_0398645 | Ga0395905_0398645_518_958 | 146 |
| 214 | 3300037471 | Ga0395905_0445866 | Ga0395905_0445866_165_605 | 146 |
| 215 | 3300038443 | Ga0395901_0011912 | Ga0395901_0011912_7278_7718 | 146 |
| 216 | 3300038443 | Ga0395901_0028005 | Ga0395901_0028005_526_966 | 146 |
| 217 | 3300038443 | Ga0395901_0053748 | Ga0395901_0053748_2358_2798 | 146 |
| 218 | 3300038443 | Ga0395901_0146552 | Ga0395901_0146552_1571_2017 | 146 |
| 219 | 3300041463 | Ga0451804_0348952 | Ga0451804_0348952_248_724 | 146 |
| 220 | 3300041505 | Ga0451849_1308950 | Ga0451849_1308950_49_489 | 146 |
| 221 | 3300042013 | Ga0439456_100226 | Ga0439456_100226_122_562 | 146 |
| 222 | 3300042876 | Ga0451577_0526231 | Ga0451577_0526231_598_1044 | 146 |
| 223 | 3300046538 | Ga0495609_0069448 | Ga0495609_0069448_602_1042 | 146 |
| 224 | 3300048903 | Ga0496100_0261612 | Ga0496100_0261612_519_959 | 146 |
| 225 | 3300048907 | Ga0496104_0428192 | Ga0496104_0428192_108_551 | 146 |
| 226 | 3300048908 | Ga0496105_0958228 | Ga0496105_0958228_136_579 | 146 |
| 227 | 3300048912 | Ga0496109_0054472 | Ga0496109_0054472_609_1052 | 146 |
| 228 | 3300048915 | Ga0496112_0065373 | Ga0496112_0065373_634_1077 | 146 |
| 229 | 3300048928 | Ga0496125_0232675 | Ga0496125_0232675_225_674 | 146 |
| 230 | 3300048929 | Ga0496126_0124833 | Ga0496126_0124833_759_1199 | 146 |
| 231 | 3300049568 | Ga0501031_0002004 | Ga0501031_0002004_5416_5856 | 146 |
| 232 | 3300049569 | Ga0501032_0000394 | Ga0501032_0000394_9690_10130 | 146 |
| 233 | 3300049571 | Ga0501034_0009643 | Ga0501034_0009643_3853_4293 | 146 |
| 234 | 3300049571 | Ga0501034_0040779 | Ga0501034_0040779_945_1385 | 146 |
| 235 | 3300049572 | Ga0501036_0006297 | Ga0501036_0006297_3834_4274 | 146 |
| 236 | 3300049573 | Ga0501037_0000133 | Ga0501037_0000133_44256_44696 | 146 |
| 237 | 3300049573 | Ga0501037_0077445 | Ga0501037_0077445_1743_2183 | 146 |
| 238 | 3300049574 | Ga0501038_0006750 | Ga0501038_0006750_3913_4353 | 146 |
| 239 | 3300049575 | Ga0501039_0157714 | Ga0501039_0157714_444_884 | 146 |
| 240 | 3300049578 | Ga0501042_0036960 | Ga0501042_0036960_2150_2590 | 146 |
| 241 | 3300049579 | Ga0501043_0001721 | Ga0501043_0001721_13962_14402 | 146 |
| 242 | 3300049580 | Ga0501046_0000038 | Ga0501046_0000038_105493_105933 | 146 |
| 243 | 3300049580 | Ga0501046_0098790 | Ga0501046_0098790_1121_1561 | 146 |
| 244 | 3300049581 | Ga0501047_0004985 | Ga0501047_0004985_9805_10245 | 146 |
| 245 | 3300049582 | Ga0501048_0000033 | Ga0501048_0000033_58630_59070 | 146 |
| 246 | 3300049585 | Ga0501069_0037707 | Ga0501069_0037707_221_661 | 146 |
| 247 | 3300049586 | Ga0501070_0027994 | Ga0501070_0027994_3596_4036 | 146 |
| 248 | 3300049586 | Ga0501070_0356844 | Ga0501070_0356844_498_938 | 146 |
| 249 | 3300049590 | Ga0501074_0464333 | Ga0501074_0464333_143_583 | 146 |
| 250 | 3300049742 | Ga0501080_0494144 | Ga0501080_0494144_631_1074 | 146 |
| 251 | 3300049744 | Ga0501083_0027339 | Ga0501083_0027339_1512_1955 | 146 |
| 252 | 3300049744 | Ga0501083_0127695 | Ga0501083_0127695_199_639 | 146 |
| 253 | 3300049773 | Ga0501276_014686 | Ga0501276_014686_142_585 | 146 |
| 254 | 3300049822 | Ga0501035_0005497 | Ga0501035_0005497_6378_6818 | 146 |
| 255 | 3300049823 | Ga0501044_0041603 | Ga0501044_0041603_1545_1985 | 146 |
| 256 | 3300050491 | nmdc:mga00v17_28052_c1 | nmdc:mga00v17_28052_c1_2794_3240 | 146 |
| 257 | 3300050491 | nmdc:mga00v17_806065_c1 | nmdc:mga00v17_806065_c1_102_542 | 146 |
| 258 | 3300050492 | nmdc:mga0yw44_18435_c1 | nmdc:mga0yw44_18435_c1_2188_2628 | 146 |
| 259 | 3300050492 | nmdc:mga0yw44_40646_c1 | nmdc:mga0yw44_40646_c1_1103_1549 | 146 |
| 260 | 3300050493 | nmdc:mga0k408_144_c1 | nmdc:mga0k408_144_c1_28204_28644 | 146 |
| 261 | 3300050493 | nmdc:mga0k408_14_c3 | nmdc:mga0k408_14_c3_26020_26460 | 146 |
| 262 | 3300050493 | nmdc:mga0k408_602981_c1 | nmdc:mga0k408_602981_c1_142_582 | 146 |
| 263 | 3300050510 | nmdc:mga06r32_949615_c1 | nmdc:mga06r32_949615_c1_360_800 | 146 |
| 264 | 3300053079 | Ga0500610_0104870 | Ga0500610_0104870_950_1390 | 146 |
| 265 | 3300053079 | Ga0500610_0124321 | Ga0500610_0124321_434_880 | 146 |
| 266 | 3300053090 | Ga0500646_0000426 | Ga0500646_0000426_3125_3571 | 146 |
| 267 | 3300053092 | Ga0500583_0000067 | Ga0500583_0000067_16810_17250 | 146 |
| 268 | 3300053092 | Ga0500583_0049026 | Ga0500583_0049026_332_778 | 146 |
| 269 | 3300053093 | Ga0500651_0000416 | Ga0500651_0000416_9924_10367 | 146 |
| 270 | 3300053093 | Ga0500651_0204921 | Ga0500651_0204921_470_913 | 146 |
| 271 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_530074_530520 | 146 |
| 272 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_815616_816056 | 146 |
| 273 | 3300053104 | Ga0500556_0000246 | Ga0500556_0000246_5344_5784 | 146 |
| 274 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_14191_14637 | 146 |
| 275 | 3300053118 | Ga0500594_0000711 | Ga0500594_0000711_3595_4035 | 146 |
| 276 | 3300053118 | Ga0500594_0079505 | Ga0500594_0079505_102_542 | 146 |
| 277 | 3300053123 | Ga0500614_000411 | Ga0500614_000411_8831_9274 | 146 |
| 278 | 3300053129 | Ga0500628_000006 | Ga0500628_000006_130283_130723 | 146 |
| 279 | 3300053130 | Ga0500642_0000722 | Ga0500642_0000722_7942_8382 | 146 |
| 280 | 3300053133 | Ga0500655_000374 | Ga0500655_000374_6479_6925 | 146 |
| 281 | 3300053142 | Ga0500577_0000856 | Ga0500577_0000856_1675_2121 | 146 |
| 282 | 3300053143 | Ga0500579_003450 | Ga0500579_003450_2648_3094 | 146 |
| 283 | 3300053147 | Ga0500589_000008 | Ga0500589_000008_43053_43493 | 146 |
| 284 | 3300053160 | Ga0500633_0001431 | Ga0500633_0001431_1044_1490 | 146 |
| 285 | 3300059513 | Ga0587094_000374 | Ga0587094_000374_518_958 | 146 |
| 286 | 3300059626 | Ga0587115_012485 | Ga0587115_012485_299_739 | 146 |
| 287 | 3300059642 | Ga0587069_032626 | Ga0587069_032626_393_833 | 146 |
| 288 | 3300059654 | Ga0587110_000694 | Ga0587110_000694_556_996 | 146 |
| 289 | 3300060353 | Ga0501082_0012274 | Ga0501082_0012274_3952_4392 | 146 |
| 290 | 3300002244 | JGI24742J22300_10000015 | JGI24742J22300_1000001529 | 147 |
| 291 | 3300005328 | Ga0070676_10000882 | Ga0070676_1000088218 | 147 |
| 292 | 3300005364 | Ga0070673_101744487 | Ga0070673_1017444871 | 147 |
| 293 | 3300005535 | Ga0070684_100001742 | Ga0070684_10000174215 | 147 |
| 294 | 3300005614 | Ga0068856_100001797 | Ga0068856_10000179714 | 147 |
| 295 | 3300005614 | Ga0068856_100877193 | Ga0068856_1008771932 | 147 |
| 296 | 3300005843 | Ga0068860_101291885 | Ga0068860_1012918851 | 147 |
| 297 | 3300006195 | Ga0075366_10000328 | Ga0075366_1000032823 | 147 |
| 298 | 3300009093 | Ga0105240_10005815 | Ga0105240_1000581522 | 147 |
| 299 | 3300009174 | Ga0105241_10068781 | Ga0105241_100687812 | 147 |
| 300 | 3300009553 | Ga0105249_10291998 | Ga0105249_102919982 | 147 |
| 301 | 3300013100 | Ga0157373_10000351 | Ga0157373_1000035140 | 147 |
| 302 | 3300013104 | Ga0157370_10084025 | Ga0157370_100840255 | 147 |
| 303 | 3300020069 | Ga0197907_10505822 | Ga0197907_105058221 | 147 |
| 304 | 3300025907 | Ga0207645_10005988 | Ga0207645_1000598813 | 147 |
| 305 | 3300025911 | Ga0207654_10046934 | Ga0207654_100469342 | 147 |
| 306 | 3300025913 | Ga0207695_10006811 | Ga0207695_1000681120 | 147 |
| 307 | 3300025944 | Ga0207661_10003681 | Ga0207661_1000368115 | 147 |
| 308 | 3300025960 | Ga0207651_10384009 | Ga0207651_103840091 | 147 |
| 309 | 3300025961 | Ga0207712_11050402 | Ga0207712_110504022 | 147 |
| 310 | 3300026078 | Ga0207702_10003219 | Ga0207702_100032193 | 147 |
| 311 | 3300026078 | Ga0207702_10573015 | Ga0207702_105730152 | 147 |
| 312 | 3300026142 | Ga0207698_10286574 | Ga0207698_102865742 | 147 |
| 313 | 3300028381 | Ga0268264_11624788 | Ga0268264_116247882 | 147 |
| 314 | 3300031730 | Ga0307516_10457394 | Ga0307516_104573942 | 147 |
| 315 | 3300046457 | Ga0495590_0176369 | Ga0495590_0176369_16_483 | 147 |
| 316 | 3300047320 | Ga0495672_0099923 | Ga0495672_0099923_145_612 | 147 |
| 317 | 3300048915 | Ga0496112_0191809 | Ga0496112_0191809_1182_1625 | 147 |
| 318 | 3300050493 | nmdc:mga0k408_22018_c1 | nmdc:mga0k408_22018_c1_882_1352 | 147 |
| 319 | 3300050494 | nmdc:mga06z11_53_c2 | nmdc:mga06z11_53_c2_11873_12343 | 147 |
| 320 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_326490_326957 | 147 |
| 321 | 3300053079 | Ga0500610_0000001 | Ga0500610_0000001_38578_39045 | 147 |
| 322 | 3300053088 | Ga0500644_0000636 | Ga0500644_0000636_11821_12267 | 147 |
| 323 | 3300053088 | Ga0500644_0000923 | Ga0500644_0000923_3698_4165 | 147 |
| 324 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_454432_454899 | 147 |
| 325 | 3300053131 | Ga0500652_000084 | Ga0500652_000084_37620_38087 | 147 |
| 326 | 3300053142 | Ga0500577_0001854 | Ga0500577_0001854_4549_4995 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fn2-assembly1.cif.gz_L | the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi | 0.9458 | 6 | 140 |
| 7a5h-assembly1.cif.gz_K | structure of the split human mitoribosomal large subunit with rescue factors mtrf-r and mtres1 | 0.941 | 9 | 131 |
| 8c93-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.9336 | 1 | 142 |
| 7jil-assembly1.cif.gz_J | 70s ribosome flavobacterium johnsoniae | 0.9325 | 1 | 144 |
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9304 | 9 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VJ38_1_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.953 | 11 | 131 | 3.90.1180.10 |
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9392 | 12 | 145 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.929 | 1 | 142 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9256 | 12 | 147 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9227 | 1 | 142 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X7VF42-F1-model_v4 | 39S ribosomal protein L13, mitochondrial | 0.9613 | 12 | 130 |
GO:0003729
GO:0003735 GO:0005762 GO:0006412 GO:0017148 |
| AF-A0A7J7N2Z6-F1-model_v4 | COP9 signalosome complex subunit 3 | 0.961 | 13 | 140 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:0006511 GO:0008180 GO:0016740 GO:1990904 |
| AF-A0A7I8XPV4-F1-model_v4 | ferroxidase (EC 1.16.3.1) | 0.959 | 11 | 131 |
GO:0003735
GO:0004322 GO:0005739 GO:0005840 GO:0006412 GO:0006826 GO:0006879 GO:0008198 GO:0008199 GO:0034986 GO:0051537 GO:1990904 |
| AF-A0A554LWJ8-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9574 | 10 | 125 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |
| AF-A0A3Q7NZD4-F1-model_v4 | 39S ribosomal protein L13, mitochondrial isoform X1 | 0.9572 | 11 | 131 |
GO:0003729
GO:0003735 GO:0005762 GO:0006412 GO:0017148 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar