F408351

General Info

Members Datasets Scaffolds Average Seq Length
326 164 652 275

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10378551|Ga0207695_103785512
Length 283
Sequence MAVTPATGKPSSRDQKRAQFARYKEDVKERGKPFYPYAMFHDTLMSLVVVMTITGLAVVWKYTTPGNHIGTHAGWLGKLYDAPADPGTINFVPRPDWYFYFLFYLLRIFKWPNSVVLGTVGIPTILLIILIALPFFDTRAERHPKRRPVAMTAAVLTIFSMGILTYRGATAKEALGSELLTKVPTWAKQQGFENNPAAVQGAKLFATLGCLNCHTYLGDGNHNLGAPDLSAEGAKHKGILFQIAHLTCPSCVNKGSPMPSFASQGKRNLTLLATFLEASKGPH

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
95 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
96 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 3.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.72
Rhizosphere 84.05
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10378551 3300025913 Bacteria 1301
2 Ga0070658_10016326 3300005327 Bacteria 5942
3 Ga0070658_10239852 3300005327 Bacteria 1536
4 Ga0070683_100008892 3300005329 Bacteria 8556
5 Ga0070683_100167246 3300005329 Unclassified 2087
6 Ga0070683_100197643 3300005329 Unclassified 1910
7 Ga0070680_100008814 3300005336 Bacteria 7738
8 Ga0070680_100152738 3300005336 Bacteria 1939
9 Ga0070660_100003246 3300005339 Bacteria 11161
10 Ga0070660_100006612 3300005339 Bacteria 8044
11 Ga0070660_100009205 3300005339 Bacteria 6940
12 Ga0070660_100230563 3300005339 Bacteria 1507
13 Ga0070661_100057267 3300005344 Bacteria 2856
14 Ga0070661_100192259 3300005344 Bacteria 1557
15 Ga0070671_100081582 3300005355 Bacteria 2704
16 Ga0070659_100041485 3300005366 Bacteria 3597
17 Ga0070659_100263660 3300005366 Unclassified 1430
18 Ga0070667_100007613 3300005367 Bacteria 8984
19 Ga0070714_100132797 3300005435 Bacteria 2226
20 Ga0070662_100041741 3300005457 Bacteria 3274
21 Ga0070681_10013669 3300005458 Bacteria 8079
22 Ga0070681_10016470 3300005458 Bacteria 7380
23 Ga0070681_10025118 3300005458 Bacteria 5995
24 Ga0070681_10031632 3300005458 Bacteria 5312
25 Ga0070681_10065858 3300005458 Bacteria 3592
26 Ga0070681_10143328 3300005458 Bacteria 2318
27 Ga0070706_100103371 3300005467 Bacteria 2649
28 Ga0070699_100131093 3300005518 Bacteria 2210
29 Ga0070679_100001630 3300005530 Bacteria 20209
30 Ga0070679_100060644 3300005530 Bacteria 3769
31 Ga0070679_100295266 3300005530 Unclassified 1572
32 Ga0070679_100436859 3300005530 Bacteria 1254
33 Ga0070684_100022491 3300005535 Bacteria 5259
34 Ga0070684_100051215 3300005535 Bacteria 3586
35 Ga0070684_100149019 3300005535 Bacteria 2119
36 Ga0070684_100153282 3300005535 Bacteria 2088
37 Ga0070665_100028395 3300005548 Bacteria 5635
38 Ga0068855_100021007 3300005563 Bacteria 7829
39 Ga0068855_100076939 3300005563 Bacteria 3871
40 Ga0068855_100226193 3300005563 Bacteria 2097
41 Ga0068855_100509393 3300005563 Bacteria 1307
42 Ga0068857_100053874 3300005577 Bacteria 3568
43 Ga0068857_100226931 3300005577 Bacteria 1707
44 Ga0068857_100377106 3300005577 Unclassified 1316
45 Ga0068856_100124837 3300005614 Bacteria 2577
46 Ga0068856_100148839 3300005614 Bacteria 2349
47 Ga0068852_100003051 3300005616 Bacteria 11654
48 Ga0068861_100023774 3300005719 Bacteria 4424
49 Ga0068858_100088504 3300005842 Bacteria 2881
50 Ga0070717_10045477 3300006028 Bacteria 3589
51 Ga0070717_10291931 3300006028 Bacteria 1448
52 Ga0070712_100159232 3300006175 Bacteria 1742
53 Ga0075433_10063808 3300006852 Bacteria 3228
54 Ga0075435_100054882 3300007076 Bacteria 3217
55 Ga0105240_10146315 3300009093 Bacteria 2819
56 Ga0105240_10483523 3300009093 Unclassified 1380
57 Ga0105245_10177911 3300009098 Bacteria 2030
58 Ga0105245_10323126 3300009098 Bacteria 1521
59 Ga0105245_10491144 3300009098 Bacteria 1242
60 Ga0105241_10068139 3300009174 Bacteria 2756
61 Ga0105242_10045356 3300009176 Bacteria 3562
62 Ga0105237_10049061 3300009545 Bacteria 4245
63 Ga0105237_10083163 3300009545 Bacteria 3193
64 Ga0105238_10107336 3300009551 Bacteria 2773
65 Ga0105238_10164177 3300009551 Bacteria 2196
66 Ga0105249_10065378 3300009553 Bacteria 3346
67 Ga0105239_10320897 3300010375 Bacteria 1746
68 Ga0105239_10335155 3300010375 Bacteria 1707
69 Ga0105239_10381795 3300010375 Bacteria 1593
70 Ga0105239_10690646 3300010375 Bacteria 1167
71 Ga0157373_10034139 3300013100 Bacteria 3654
72 Ga0157371_10135454 3300013102 Bacteria 1754
73 Ga0157370_10004749 3300013104 Bacteria 15468
74 Ga0157370_10048501 3300013104 Bacteria 4068
75 Ga0157370_10128496 3300013104 Bacteria 2365
76 Ga0157369_10010278 3300013105 Bacteria 10675
77 Ga0157369_10107492 3300013105 Bacteria 2968
78 Ga0157369_10168271 3300013105 Bacteria 2310
79 Ga0157369_10206198 3300013105 Bacteria 2062
80 Ga0157369_10590177 3300013105 Bacteria 1147
81 Ga0157374_10344765 3300013296 Bacteria 1479
82 Ga0157372_10074113 3300013307 Bacteria 3837
83 Ga0157372_10346811 3300013307 Bacteria 1730
84 Ga0157372_10412208 3300013307 Bacteria 1574
85 Ga0206356_10521456 3300020070 Bacteria 1399
86 Ga0206356_11146824 3300020070 Bacteria 3962
87 Ga0206356_11629012 3300020070 Bacteria 3779
88 Ga0206354_10787368 3300020081 Bacteria 2967
89 Ga0206354_11332741 3300020081 Bacteria 2926
90 Ga0206354_11548243 3300020081 Bacteria 967
91 Ga0206354_11645562 3300020081 Unclassified 1412
92 Ga0206353_11435311 3300020082 Bacteria 3609
93 Ga0206353_12005519 3300020082 Bacteria 3311
94 Ga0224712_10170515 3300022467 Bacteria 976
95 Ga0207705_10021922 3300025909 Bacteria 4557
96 Ga0207705_10491749 3300025909 Unclassified 953
97 Ga0207684_10143718 3300025910 Bacteria 2052
98 Ga0207707_10026310 3300025912 Bacteria 5085
99 Ga0207707_10087957 3300025912 Bacteria 2714
100 Ga0207707_10105303 3300025912 Bacteria 2465
101 Ga0207707_10122398 3300025912 Bacteria 2275
102 Ga0207707_10150793 3300025912 Unclassified 2033
103 Ga0207707_10213730 3300025912 Unclassified 1680
104 Ga0207707_10526563 3300025912 Unclassified 1006
105 Ga0207695_10155213 3300025913 Bacteria 2224
106 Ga0207671_10051879 3300025914 Bacteria 3039
107 Ga0207693_10149445 3300025915 Bacteria 1837
108 Ga0207663_10083154 3300025916 Bacteria 2102
109 Ga0207660_10027681 3300025917 Bacteria 3871
110 Ga0207660_10392245 3300025917 Unclassified 1117
111 Ga0207657_10000902 3300025919 Bacteria 31364
112 Ga0207657_10001937 3300025919 Bacteria 22358
113 Ga0207657_10004242 3300025919 Bacteria 15190
114 Ga0207657_10006752 3300025919 Bacteria 11856
115 Ga0207657_10028151 3300025919 Bacteria 5132
116 Ga0207657_10137973 3300025919 Bacteria 1994
117 Ga0207649_10024978 3300025920 Bacteria 3478
118 Ga0207652_10043446 3300025921 Bacteria 3826
119 Ga0207652_10132210 3300025921 Bacteria 2226
120 Ga0207694_10095603 3300025924 Bacteria 2349
121 Ga0207694_10200550 3300025924 Bacteria 1623
122 Ga0207694_10438902 3300025924 Bacteria 1089
123 Ga0207687_10034412 3300025927 Bacteria 3440
124 Ga0207687_10361468 3300025927 Bacteria 1185
125 Ga0207664_10128030 3300025929 Bacteria 2134
126 Ga0207664_10750597 3300025929 Unclassified 877
127 Ga0207644_10022302 3300025931 Bacteria 4325
128 Ga0207644_10340828 3300025931 Bacteria 1215
129 Ga0207661_10087907 3300025944 Bacteria 2582
130 Ga0207667_10290452 3300025949 Bacteria 1671
131 Ga0207667_10295292 3300025949 Bacteria 1655
132 Ga0207667_10447429 3300025949 Unclassified 1313
133 Ga0207640_10460086 3300025981 Unclassified 1050
134 Ga0207658_10006792 3300025986 Bacteria 7793
135 Ga0207678_10091227 3300026067 Bacteria 2604
136 Ga0207702_10248775 3300026078 Unclassified 1668
137 Ga0207702_10635190 3300026078 Bacteria 1049
138 Ga0207674_10009498 3300026116 Bacteria 11105
139 Ga0207674_10205065 3300026116 Bacteria 1921
140 Ga0265319_1007444 3300028563 Bacteria 4925
141 Ga0265334_10084340 3300028573 Unclassified 1167
142 Ga0265318_10006536 3300028577 Bacteria 5355
143 Ga0265338_10066909 3300028800 Bacteria 3107
144 Ga0265338_10106325 3300028800 Bacteria 2272
145 Ga0265320_10012806 3300031240 Bacteria 4858
146 Ga0265325_10055148 3300031241 Unclassified 2033
147 Ga0307409_100079053 3300031995 Bacteria 2649
148 Ga0373934_0050818 3300035086 Bacteria 1643
149 Ga0373945_0055347 3300035116 Bacteria 1468
150 Ga0373945_0141826 3300035116 Bacteria 969
151 Ga0373953_0065874 3300035117 Bacteria 1488
152 Ga0373956_0024392 3300035119 Bacteria 2606
153 Ga0373943_0000713 3300035170 Bacteria 14523
154 Ga0373933_0227112 3300035724 Bacteria 1198
155 Ga0373947_0015561 3300035725 Bacteria 4369
156 Ga0373937_0362041 3300036401 Unclassified 1374
157 Ga0373925_0121699 3300037068 Bacteria 2026
158 Ga0395899_0103040 3300037312 Bacteria 2058
159 Ga0395900_0021879 3300037418 Bacteria 6538
160 Ga0395900_0049505 3300037418 Bacteria 4330
161 Ga0395900_0071191 3300037418 Bacteria 3574
162 Ga0395900_0100516 3300037418 Bacteria 2971
163 Ga0395898_0038145 3300037466 Bacteria 4764
164 Ga0395898_0043792 3300037466 Bacteria 4409
165 Ga0395898_0100337 3300037466 Bacteria 2780
166 Ga0395898_0155499 3300037466 Bacteria 2187
167 Ga0395898_0281354 3300037466 Bacteria 1587
168 Ga0395905_0035657 3300037471 Bacteria 4670
169 Ga0395905_0289664 3300037471 Bacteria 1524
170 Ga0436364_1123401 3300037853 Bacteria 2098
171 Ga0395901_0017823 3300038443 Bacteria 7247
172 Ga0395901_0070362 3300038443 Bacteria 3645
173 Ga0395901_0098688 3300038443 Bacteria 3062
174 Ga0395901_0288835 3300038443 Bacteria 1702
175 Ga0395901_0413319 3300038443 Bacteria 1384
176 Ga0436363_0698232 3300039450 Bacteria 1771
177 Ga0451793_1279283 3300041452 Bacteria 3588
178 Ga0451795_1501454 3300041456 Bacteria 907
179 Ga0451798_1094145 3300041458 Bacteria 927
180 Ga0451800_1211602 3300041459 Bacteria 1417
181 Ga0451802_1057988 3300041460 Bacteria 1354
182 Ga0451835_0036970 3300041492 Bacteria 2928
183 Ga0451851_0850975 3300041507 Bacteria 1213
184 Ga0439448_0048965 3300042005 Unclassified 1381
185 Ga0466969_0051121 3300044656 Bacteria 2035
186 Ga0466972_0085852 3300044658 Unclassified 1496
187 Ga0466965_0098007 3300044683 Bacteria 1497
188 Ga0466966_0004486 3300044684 Bacteria 9208
189 Ga0466966_0118387 3300044684 Bacteria 1629
190 Ga0466966_0143626 3300044684 Bacteria 1457
191 Ga0466961_0002730 3300044693 Bacteria 10974
192 Ga0466961_0040041 3300044693 Bacteria 3004
193 Ga0466961_0067487 3300044693 Bacteria 2272
194 Ga0466963_0002477 3300044694 Bacteria 10328
195 Ga0466963_0223179 3300044694 Bacteria 1320
196 Ga0466963_0298006 3300044694 Bacteria 1134
197 Ga0466963_0417243 3300044694 Bacteria 947
198 Ga0466964_0002899 3300044706 Bacteria 6192
199 Ga0466964_0067972 3300044706 Bacteria 1499
200 Ga0466968_0007906 3300044735 Bacteria 4060
201 Ga0466970_0040974 3300044765 Bacteria 2460
202 Ga0466970_0114647 3300044765 Bacteria 1473
203 Ga0466957_0003657 3300044842 Bacteria 8484
204 Ga0466957_0031513 3300044842 Bacteria 3169
205 Ga0466960_0001639 3300044901 Bacteria 8196
206 Ga0466960_0001940 3300044901 Bacteria 7647
207 Ga0466960_0028026 3300044901 Bacteria 2575
208 Ga0466959_0006196 3300045049 Bacteria 8264
209 Ga0466959_0041598 3300045049 Bacteria 3392
210 Ga0466959_0214004 3300045049 Bacteria 1338
211 Ga0466958_0002290 3300045836 Bacteria 9547
212 Ga0466958_0040574 3300045836 Bacteria 2797
213 Ga0466958_0043353 3300045836 Bacteria 2709
214 Ga0466958_0054888 3300045836 Bacteria 2417
215 Ga0466967_0001971 3300045976 Bacteria 12441
216 Ga0466967_0003133 3300045976 Bacteria 10650
217 Ga0466967_0009932 3300045976 Bacteria 7104
218 Ga0466967_0013472 3300045976 Bacteria 6321
219 Ga0466967_0013734 3300045976 Bacteria 6274
220 Ga0466967_0023108 3300045976 Bacteria 5090
221 Ga0466967_0026684 3300045976 Bacteria 4789
222 Ga0466967_0073057 3300045976 Bacteria 3076
223 Ga0466967_0079846 3300045976 Bacteria 2950
224 Ga0466967_0114057 3300045976 Bacteria 2487
225 Ga0466967_0311164 3300045976 Bacteria 1517
226 Ga0466967_0355996 3300045976 Bacteria 1417
227 Ga0466967_0425738 3300045976 Bacteria 1294
228 Ga0466967_0490820 3300045976 Bacteria 1204
229 Ga0466967_0550670 3300045976 Unclassified 1135
230 Ga0495653_0186002 3300046463 Bacteria 1421
231 Ga0495582_0203431 3300046473 Unclassified 1131
232 Ga0495664_0177619 3300046477 Bacteria 1291
233 Ga0495608_0008932 3300046511 Bacteria 7007
234 Ga0495618_0108263 3300046514 Bacteria 1780
235 Ga0495628_0129965 3300046516 Bacteria 1927
236 Ga0495652_0254915 3300046529 Archaea 1298
237 Ga0495640_0115657 3300046533 Bacteria 1748
238 Ga0495587_0066124 3300046536 Bacteria 2109
239 Ga0495645_0045052 3300046543 Bacteria 3218
240 Ga0495667_0009604 3300046559 Bacteria 6559
241 Ga0495634_0138798 3300046642 Unclassified 1545
242 Ga0495657_0040975 3300046675 Bacteria 3172
243 Ga0495657_0095801 3300046675 Bacteria 1897
244 Ga0495623_0145520 3300046679 Bacteria 1406
245 Ga0495623_0237218 3300046679 Unclassified 1031
246 Ga0495646_0166672 3300046680 Bacteria 1216
247 Ga0495658_0036746 3300046683 Bacteria 2704
248 Ga0495658_0152270 3300046683 Bacteria 1421
249 Ga0495600_0143072 3300046809 Bacteria 1551
250 Ga0495600_0371251 3300046809 Bacteria 894
251 Ga0495604_0028259 3300047317 Bacteria 4461
252 Ga0495604_0111140 3300047317 Bacteria 1998
253 Ga0495674_0194141 3300047319 Bacteria 1686
254 Ga0495675_0203428 3300047444 Unclassified 1204
255 Ga0495602_0052140 3300048088 Bacteria 3636
256 Ga0495602_0224041 3300048088 Unclassified 1417
257 Ga0496100_0000446 3300048903 Bacteria 19967
258 Ga0496100_0032451 3300048903 Bacteria 3257
259 Ga0496100_0358782 3300048903 Bacteria 1102
260 Ga0496101_0016518 3300048904 Bacteria 4989
261 Ga0496101_0093603 3300048904 Bacteria 2238
262 Ga0496102_0009428 3300048905 Bacteria 8387
263 Ga0496102_0016175 3300048905 Bacteria 6517
264 Ga0496102_0112241 3300048905 Bacteria 2542
265 Ga0496104_0002859 3300048907 Bacteria 14876
266 Ga0496104_0051715 3300048907 Bacteria 3878
267 Ga0496104_0490634 3300048907 Bacteria 1140
268 Ga0496105_0000258 3300048908 Bacteria 35685
269 Ga0496105_0069539 3300048908 Bacteria 2909
270 Ga0496105_0363011 3300048908 Bacteria 1155
271 Ga0496106_0000449 3300048909 Bacteria 29371
272 Ga0496106_0010664 3300048909 Bacteria 6790
273 Ga0496107_0005810 3300048910 Bacteria 8446
274 Ga0496107_0105721 3300048910 Bacteria 2066
275 Ga0496107_0148418 3300048910 Bacteria 1734
276 Ga0496107_0312171 3300048910 Bacteria 1170
277 Ga0496108_0010252 3300048911 Bacteria 7607
278 Ga0496108_0049252 3300048911 Bacteria 3524
279 Ga0496108_0088992 3300048911 Bacteria 2624
280 Ga0496109_0001531 3300048912 Bacteria 19233
281 Ga0496109_0146434 3300048912 Bacteria 2210
282 Ga0496109_0154523 3300048912 Unclassified 2149
283 Ga0496110_0071809 3300048913 Bacteria 3070
284 Ga0496110_0102443 3300048913 Bacteria 2567
285 Ga0496110_0193818 3300048913 Bacteria 1845
286 Ga0496111_0018040 3300048914 Bacteria 4882
287 Ga0496111_0057416 3300048914 Bacteria 2818
288 Ga0496112_0020909 3300048915 Bacteria 6213
289 Ga0496112_0037966 3300048915 Bacteria 4703
290 Ga0496112_0111360 3300048915 Bacteria 2707
291 Ga0496112_0132680 3300048915 Bacteria 2461
292 Ga0496112_0149342 3300048915 Bacteria 2304
293 Ga0496113_0032237 3300048916 Unclassified 3808
294 Ga0496113_0350492 3300048916 Bacteria 1184
295 Ga0496114_0000526 3300048917 Bacteria 28186
296 Ga0496114_0097608 3300048917 Bacteria 2503
297 Ga0496115_0000671 3300048918 Bacteria 25284
298 Ga0496115_0037956 3300048918 Bacteria 3820
299 Ga0496115_0260517 3300048918 Bacteria 1426
300 Ga0501034_0312649 3300049571 Bacteria 1505
301 Ga0501046_0156213 3300049580 Bacteria 1718
302 Ga0501047_0192666 3300049581 Bacteria 1901
303 Ga0501047_0384661 3300049581 Bacteria 1237
304 Ga0501067_0001412 3300049583 Bacteria 13020
305 Ga0501067_0019242 3300049583 Bacteria 3778
306 Ga0501067_0186269 3300049583 Bacteria 1156
307 Ga0501069_0006081 3300049585 Bacteria 6300
308 Ga0501069_0012276 3300049585 Bacteria 4553
309 Ga0501070_0000049 3300049586 Bacteria 104564
310 Ga0501070_0167579 3300049586 Bacteria 1810
311 Ga0501074_0013310 3300049590 Bacteria 5982
312 Ga0501074_0066081 3300049590 Bacteria 2602
313 Ga0501074_0095383 3300049590 Bacteria 2130
314 Ga0501080_0146325 3300049742 Bacteria 2184
315 Ga0501080_0236854 3300049742 Bacteria 1667
316 Ga0501080_0331396 3300049742 Bacteria 1376
317 nmdc:mga0n895_122049_c1 3300050512 Bacteria 2627
318 nmdc:mga0rr50_54186_c1 3300050513 Bacteria 2987
319 nmdc:mga0a205_21434_c1 3300050515 Bacteria 6112
320 Ga0495601_0063512 3300053077 Bacteria 2347
321 Ga0495612_0050566 3300053078 Bacteria 1707
322 Ga0495655_0012342 3300053083 Bacteria 1739
323 Ga0495595_0231879 3300053084 Bacteria 922
324 Ga0495619_0237160 3300053085 Bacteria 1264
325 Ga0530510_0008860 3300061734 Bacteria 7041
326 Ga0530510_0010002 3300061734 Bacteria 6654
327 Ga0207695_10378551
328 Ga0070658_10016326
329 Ga0070658_10239852
330 Ga0070683_100008892
331 Ga0070683_100167246
332 Ga0070683_100197643
333 Ga0070680_100008814
334 Ga0070680_100152738
335 Ga0070660_100003246
336 Ga0070660_100006612
337 Ga0070660_100009205
338 Ga0070660_100230563
339 Ga0070661_100057267
340 Ga0070661_100192259
341 Ga0070671_100081582
342 Ga0070659_100041485
343 Ga0070659_100263660
344 Ga0070667_100007613
345 Ga0070714_100132797
346 Ga0070662_100041741
347 Ga0070681_10013669
348 Ga0070681_10016470
349 Ga0070681_10025118
350 Ga0070681_10031632
351 Ga0070681_10065858
352 Ga0070681_10143328
353 Ga0070706_100103371
354 Ga0070699_100131093
355 Ga0070679_100001630
356 Ga0070679_100060644
357 Ga0070679_100295266
358 Ga0070679_100436859
359 Ga0070684_100022491
360 Ga0070684_100051215
361 Ga0070684_100149019
362 Ga0070684_100153282
363 Ga0070665_100028395
364 Ga0068855_100021007
365 Ga0068855_100076939
366 Ga0068855_100226193
367 Ga0068855_100509393
368 Ga0068857_100053874
369 Ga0068857_100226931
370 Ga0068857_100377106
371 Ga0068856_100124837
372 Ga0068856_100148839
373 Ga0068852_100003051
374 Ga0068861_100023774
375 Ga0068858_100088504
376 Ga0070717_10045477
377 Ga0070717_10291931
378 Ga0070712_100159232
379 Ga0075433_10063808
380 Ga0075435_100054882
381 Ga0105240_10146315
382 Ga0105240_10483523
383 Ga0105245_10177911
384 Ga0105245_10323126
385 Ga0105245_10491144
386 Ga0105241_10068139
387 Ga0105242_10045356
388 Ga0105237_10049061
389 Ga0105237_10083163
390 Ga0105238_10107336
391 Ga0105238_10164177
392 Ga0105249_10065378
393 Ga0105239_10320897
394 Ga0105239_10335155
395 Ga0105239_10381795
396 Ga0105239_10690646
397 Ga0157373_10034139
398 Ga0157371_10135454
399 Ga0157370_10004749
400 Ga0157370_10048501
401 Ga0157370_10128496
402 Ga0157369_10010278
403 Ga0157369_10107492
404 Ga0157369_10168271
405 Ga0157369_10206198
406 Ga0157369_10590177
407 Ga0157374_10344765
408 Ga0157372_10074113
409 Ga0157372_10346811
410 Ga0157372_10412208
411 Ga0206356_10521456
412 Ga0206356_11146824
413 Ga0206356_11629012
414 Ga0206354_10787368
415 Ga0206354_11332741
416 Ga0206354_11548243
417 Ga0206354_11645562
418 Ga0206353_11435311
419 Ga0206353_12005519
420 Ga0224712_10170515
421 Ga0207705_10021922
422 Ga0207705_10491749
423 Ga0207684_10143718
424 Ga0207707_10026310
425 Ga0207707_10087957
426 Ga0207707_10105303
427 Ga0207707_10122398
428 Ga0207707_10150793
429 Ga0207707_10213730
430 Ga0207707_10526563
431 Ga0207695_10155213
432 Ga0207671_10051879
433 Ga0207693_10149445
434 Ga0207663_10083154
435 Ga0207660_10027681
436 Ga0207660_10392245
437 Ga0207657_10000902
438 Ga0207657_10001937
439 Ga0207657_10004242
440 Ga0207657_10006752
441 Ga0207657_10028151
442 Ga0207657_10137973
443 Ga0207649_10024978
444 Ga0207652_10043446
445 Ga0207652_10132210
446 Ga0207694_10095603
447 Ga0207694_10200550
448 Ga0207694_10438902
449 Ga0207687_10034412
450 Ga0207687_10361468
451 Ga0207664_10128030
452 Ga0207664_10750597
453 Ga0207644_10022302
454 Ga0207644_10340828
455 Ga0207661_10087907
456 Ga0207667_10290452
457 Ga0207667_10295292
458 Ga0207667_10447429
459 Ga0207640_10460086
460 Ga0207658_10006792
461 Ga0207678_10091227
462 Ga0207702_10248775
463 Ga0207702_10635190
464 Ga0207674_10009498
465 Ga0207674_10205065
466 Ga0265319_1007444
467 Ga0265334_10084340
468 Ga0265318_10006536
469 Ga0265338_10066909
470 Ga0265338_10106325
471 Ga0265320_10012806
472 Ga0265325_10055148
473 Ga0307409_100079053
474 Ga0373934_0050818
475 Ga0373945_0055347
476 Ga0373945_0141826
477 Ga0373953_0065874
478 Ga0373956_0024392
479 Ga0373943_0000713
480 Ga0373933_0227112
481 Ga0373947_0015561
482 Ga0373937_0362041
483 Ga0373925_0121699
484 Ga0395899_0103040
485 Ga0395900_0021879
486 Ga0395900_0049505
487 Ga0395900_0071191
488 Ga0395900_0100516
489 Ga0395898_0038145
490 Ga0395898_0043792
491 Ga0395898_0100337
492 Ga0395898_0155499
493 Ga0395898_0281354
494 Ga0395905_0035657
495 Ga0395905_0289664
496 Ga0436364_1123401
497 Ga0395901_0017823
498 Ga0395901_0070362
499 Ga0395901_0098688
500 Ga0395901_0288835
501 Ga0395901_0413319
502 Ga0436363_0698232
503 Ga0451793_1279283
504 Ga0451795_1501454
505 Ga0451798_1094145
506 Ga0451800_1211602
507 Ga0451802_1057988
508 Ga0451835_0036970
509 Ga0451851_0850975
510 Ga0439448_0048965
511 Ga0466969_0051121
512 Ga0466972_0085852
513 Ga0466965_0098007
514 Ga0466966_0004486
515 Ga0466966_0118387
516 Ga0466966_0143626
517 Ga0466961_0002730
518 Ga0466961_0040041
519 Ga0466961_0067487
520 Ga0466963_0002477
521 Ga0466963_0223179
522 Ga0466963_0298006
523 Ga0466963_0417243
524 Ga0466964_0002899
525 Ga0466964_0067972
526 Ga0466968_0007906
527 Ga0466970_0040974
528 Ga0466970_0114647
529 Ga0466957_0003657
530 Ga0466957_0031513
531 Ga0466960_0001639
532 Ga0466960_0001940
533 Ga0466960_0028026
534 Ga0466959_0006196
535 Ga0466959_0041598
536 Ga0466959_0214004
537 Ga0466958_0002290
538 Ga0466958_0040574
539 Ga0466958_0043353
540 Ga0466958_0054888
541 Ga0466967_0001971
542 Ga0466967_0003133
543 Ga0466967_0009932
544 Ga0466967_0013472
545 Ga0466967_0013734
546 Ga0466967_0023108
547 Ga0466967_0026684
548 Ga0466967_0073057
549 Ga0466967_0079846
550 Ga0466967_0114057
551 Ga0466967_0311164
552 Ga0466967_0355996
553 Ga0466967_0425738
554 Ga0466967_0490820
555 Ga0466967_0550670
556 Ga0495653_0186002
557 Ga0495582_0203431
558 Ga0495664_0177619
559 Ga0495608_0008932
560 Ga0495618_0108263
561 Ga0495628_0129965
562 Ga0495652_0254915
563 Ga0495640_0115657
564 Ga0495587_0066124
565 Ga0495645_0045052
566 Ga0495667_0009604
567 Ga0495634_0138798
568 Ga0495657_0040975
569 Ga0495657_0095801
570 Ga0495623_0145520
571 Ga0495623_0237218
572 Ga0495646_0166672
573 Ga0495658_0036746
574 Ga0495658_0152270
575 Ga0495600_0143072
576 Ga0495600_0371251
577 Ga0495604_0028259
578 Ga0495604_0111140
579 Ga0495674_0194141
580 Ga0495675_0203428
581 Ga0495602_0052140
582 Ga0495602_0224041
583 Ga0496100_0000446
584 Ga0496100_0032451
585 Ga0496100_0358782
586 Ga0496101_0016518
587 Ga0496101_0093603
588 Ga0496102_0009428
589 Ga0496102_0016175
590 Ga0496102_0112241
591 Ga0496104_0002859
592 Ga0496104_0051715
593 Ga0496104_0490634
594 Ga0496105_0000258
595 Ga0496105_0069539
596 Ga0496105_0363011
597 Ga0496106_0000449
598 Ga0496106_0010664
599 Ga0496107_0005810
600 Ga0496107_0105721
601 Ga0496107_0148418
602 Ga0496107_0312171
603 Ga0496108_0010252
604 Ga0496108_0049252
605 Ga0496108_0088992
606 Ga0496109_0001531
607 Ga0496109_0146434
608 Ga0496109_0154523
609 Ga0496110_0071809
610 Ga0496110_0102443
611 Ga0496110_0193818
612 Ga0496111_0018040
613 Ga0496111_0057416
614 Ga0496112_0020909
615 Ga0496112_0037966
616 Ga0496112_0111360
617 Ga0496112_0132680
618 Ga0496112_0149342
619 Ga0496113_0032237
620 Ga0496113_0350492
621 Ga0496114_0000526
622 Ga0496114_0097608
623 Ga0496115_0000671
624 Ga0496115_0037956
625 Ga0496115_0260517
626 Ga0501034_0312649
627 Ga0501046_0156213
628 Ga0501047_0192666
629 Ga0501047_0384661
630 Ga0501067_0001412
631 Ga0501067_0019242
632 Ga0501067_0186269
633 Ga0501069_0006081
634 Ga0501069_0012276
635 Ga0501070_0000049
636 Ga0501070_0167579
637 Ga0501074_0013310
638 Ga0501074_0066081
639 Ga0501074_0095383
640 Ga0501080_0146325
641 Ga0501080_0236854
642 Ga0501080_0331396
643 nmdc:mga0n895_122049_c1
644 nmdc:mga0rr50_54186_c1
645 nmdc:mga0a205_21434_c1
646 Ga0495601_0063512
647 Ga0495612_0050566
648 Ga0495655_0012342
649 Ga0495595_0231879
650 Ga0495619_0237160
651 Ga0530510_0008860
652 Ga0530510_0010002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

83

185

0.85

Map