F408332

General Info

Members Datasets Scaffolds Average Seq Length
326 186 322 222

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10005210|Ga0213875_100052106
Length 262
Sequence MNPRTNGHSSTGPAARSAAESRSDDLASLYPFLYAHPDNVGHDTPEVGNLETVLAEVRRSTVDKAHQIVALRREVLARDSQRLAACASAMAAAFATGGRLFAIGNGGSCTDAADLASLFLHPGPGRRALPAFALTGDIAVLTALSNDVSFDVVFARQIAAFGRRGDVVVGLSTSGNSTNLVRGFEEAGRRGLLTIGLAGYEGGAMAELGSIDHLFVVPSDSVHRIQEAQTTIYHTLWELTLDELISRSRHPERESGRRSLVE

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
3 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
4 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
69 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
182 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 4.29
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 2.76
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009466 3300003203 Bacteria 4361
2 rootH2_10084999 3300003320 Bacteria 1696
3 rootH1_10124329 3300003323 Bacteria 2030
4 JGI25407J50210_10000833 3300003373 Bacteria 6609
5 Ga0070658_10004366 3300005327 Bacteria 11537
6 Ga0070676_10264935 3300005328 Bacteria 1152
7 Ga0070680_100070131 3300005336 Bacteria 2879
8 Ga0070680_100245706 3300005336 Bacteria 1513
9 Ga0070675_100047747 3300005354 Bacteria 3509
10 Ga0070709_10285196 3300005434 Bacteria 1201
11 Ga0070714_100000163 3300005435 Bacteria 53786
12 Ga0070714_100004509 3300005435 Bacteria 10500
13 Ga0070714_100056404 3300005435 Bacteria 3360
14 Ga0070714_100280173 3300005435 Bacteria 1549
15 Ga0070713_100056705 3300005436 Bacteria 3259
16 Ga0070713_100192759 3300005436 Bacteria 1837
17 Ga0070713_100225770 3300005436 Bacteria 1700
18 Ga0070710_10030164 3300005437 Bacteria 2916
19 Ga0070708_100047160 3300005445 Bacteria 3805
20 Ga0070706_100068637 3300005467 Bacteria 3278
21 Ga0070707_100046334 3300005468 Bacteria 4161
22 Ga0070707_100047441 3300005468 Bacteria 4112
23 Ga0070698_100014944 3300005471 Bacteria 8207
24 Ga0070698_100026343 3300005471 Bacteria 6052
25 Ga0070698_100029353 3300005471 Bacteria 5709
26 Ga0070679_100042111 3300005530 Bacteria 4547
27 Ga0070697_100013829 3300005536 Bacteria 6333
28 Ga0068853_100103386 3300005539 Bacteria 2521
29 Ga0068854_100076718 3300005578 Bacteria 2457
30 Ga0068856_100211973 3300005614 Bacteria 1952
31 Ga0068856_100357297 3300005614 Bacteria 1479
32 Ga0068864_100182083 3300005618 Bacteria 1921
33 Ga0068862_100446609 3300005844 Bacteria 1218
34 Ga0081538_10000212 3300005981 Bacteria 64889
35 Ga0081539_10000179 3300005985 Bacteria 149126
36 Ga0081539_10022930 3300005985 Bacteria 4107
37 Ga0070717_10193141 3300006028 Bacteria 1779
38 Ga0070717_10211385 3300006028 Bacteria 1702
39 Ga0070712_100609903 3300006175 Bacteria 924
40 Ga0075428_100258644 3300006844 Bacteria 1875
41 Ga0075431_100853271 3300006847 Bacteria 882
42 Ga0111539_10391018 3300009094 Bacteria 1619
43 Ga0114129_10146873 3300009147 Bacteria 3229
44 Ga0157376_11311698 3300014969 Bacteria 754
45 Ga0163161_10325631 3300017792 Bacteria 1216
46 Ga0197907_10951335 3300020069 Bacteria 1142
47 Ga0206356_10868564 3300020070 Bacteria 2370
48 Ga0206356_11908530 3300020070 Bacteria 1188
49 Ga0206351_10143192 3300020077 Bacteria 1246
50 Ga0206354_11415301 3300020081 Bacteria 2794
51 Ga0206354_11461454 3300020081 Bacteria 1287
52 Ga0213873_10000186 3300021358 Bacteria 11313
53 Ga0213876_10287369 3300021384 Bacteria 874
54 Ga0213875_10000129 3300021388 Bacteria 83647
55 Ga0213875_10002623 3300021388 Bacteria 10661
56 Ga0213875_10005210 3300021388 Bacteria 7022
57 Ga0213875_10159171 3300021388 Bacteria 1059
58 Ga0224712_10001818 3300022467 Bacteria 5097
59 Ga0224712_10068663 3300022467 Bacteria 1433
60 Ga0224712_10093988 3300022467 Bacteria 1261
61 Ga0224572_1006583 3300024225 Bacteria 2104
62 Ga0207692_10011707 3300025898 Bacteria 3744
63 Ga0207647_10041444 3300025904 Bacteria 2895
64 Ga0207699_10068996 3300025906 Bacteria 2154
65 Ga0207699_10190074 3300025906 Bacteria 1385
66 Ga0207705_10003633 3300025909 Bacteria 11745
67 Ga0207684_10070031 3300025910 Bacteria 2981
68 Ga0207684_10455954 3300025910 Bacteria 1097
69 Ga0207693_10083464 3300025915 Bacteria 2503
70 Ga0207663_10295018 3300025916 Bacteria 1209
71 Ga0207660_10144328 3300025917 Bacteria 1823
72 Ga0207660_10189496 3300025917 Bacteria 1601
73 Ga0207652_10058279 3300025921 Bacteria 3328
74 Ga0207646_10028915 3300025922 Bacteria 5042
75 Ga0207646_10274234 3300025922 Bacteria 1524
76 Ga0207694_10080096 3300025924 Bacteria 2563
77 Ga0207650_10363895 3300025925 Bacteria 1192
78 Ga0207700_10008397 3300025928 Bacteria 6396
79 Ga0207700_10044926 3300025928 Bacteria 3256
80 Ga0207700_10045917 3300025928 Bacteria 3227
81 Ga0207700_10103401 3300025928 Bacteria 2277
82 Ga0207664_10001071 3300025929 Bacteria 18253
83 Ga0207664_10090973 3300025929 Bacteria 2501
84 Ga0207664_10140340 3300025929 Bacteria 2043
85 Ga0207664_10396211 3300025929 Bacteria 1227
86 Ga0207664_10674737 3300025929 Bacteria 929
87 Ga0207665_10131467 3300025939 Bacteria 1777
88 Ga0207691_10045018 3300025940 Bacteria 4059
89 Ga0207640_10063899 3300025981 Bacteria 2448
90 Ga0207639_10190813 3300026041 Bacteria 1750
91 Ga0207702_10392200 3300026078 Bacteria 1337
92 Ga0207674_10193226 3300026116 Bacteria 1985
93 Ga0207698_10200771 3300026142 Bacteria 1785
94 Ga0307512_10017534 3300030522 Bacteria 6565
95 Ga0265769_100001 3300030888 Bacteria 11934
96 Ga0307408_100045417 3300031548 Bacteria 3137
97 Ga0307408_100147376 3300031548 Bacteria 1854
98 Ga0307405_10039915 3300031731 Bacteria 2840
99 Ga0307405_10047414 3300031731 Bacteria 2645
100 Ga0307413_10007121 3300031824 Bacteria 5164
101 Ga0307413_10014634 3300031824 Bacteria 3993
102 Ga0307410_10004986 3300031852 Bacteria 6963
103 Ga0307410_10096255 3300031852 Bacteria 2112
104 Ga0307406_10039468 3300031901 Bacteria 2929
105 Ga0307406_10043441 3300031901 Bacteria 2810
106 Ga0307406_10127083 3300031901 Bacteria 1783
107 Ga0307406_10229485 3300031901 Bacteria 1385
108 Ga0307406_10275818 3300031901 Bacteria 1280
109 Ga0307407_10020090 3300031903 Bacteria 3414
110 Ga0307412_10060950 3300031911 Bacteria 2534
111 Ga0307412_10138387 3300031911 Bacteria 1779
112 Ga0307409_100052762 3300031995 Bacteria 3119
113 Ga0307409_100069896 3300031995 Bacteria 2784
114 Ga0307409_100264481 3300031995 Bacteria 1580
115 Ga0307416_100035417 3300032002 Bacteria 3812
116 Ga0307416_100041689 3300032002 Bacteria 3577
117 Ga0307416_100200567 3300032002 Bacteria 1892
118 Ga0307414_10022997 3300032004 Bacteria 3943
119 Ga0307414_10369031 3300032004 Bacteria 1237
120 Ga0307411_10119527 3300032005 Bacteria 1903
121 Ga0307415_100023754 3300032126 Bacteria 3813
122 Ga0307415_100564795 3300032126 Bacteria 1006
123 Ga0373926_0001004 3300035083 Bacteria 8245
124 Ga0373934_0000032 3300035086 Bacteria 44940
125 Ga0373934_0007982 3300035086 Bacteria 3939
126 Ga0373934_0016843 3300035086 Bacteria 2782
127 Ga0373944_0006255 3300035089 Bacteria 3156
128 Ga0373923_0003121 3300035111 Bacteria 5260
129 Ga0373923_0008519 3300035111 Bacteria 3661
130 Ga0373923_0036785 3300035111 Bacteria 2000
131 Ga0373936_0000482 3300035113 Bacteria 13475
132 Ga0373945_0000485 3300035116 Bacteria 11271
133 Ga0373953_0004740 3300035117 Bacteria 4359
134 Ga0373953_0026214 3300035117 Bacteria 2232
135 Ga0373953_0033777 3300035117 Bacteria 2002
136 Ga0373954_0006952 3300035118 Bacteria 4939
137 Ga0373954_0012340 3300035118 Bacteria 3797
138 Ga0373954_0053385 3300035118 Bacteria 1900
139 Ga0373956_0000533 3300035119 Bacteria 15567
140 Ga0373956_0013013 3300035119 Bacteria 3458
141 Ga0373956_0021732 3300035119 Bacteria 2738
142 Ga0373957_0000080 3300035120 Bacteria 23006
143 Ga0373943_0014761 3300035170 Bacteria 3542
144 Ga0373943_0140612 3300035170 Bacteria 1300
145 Ga0373946_0002015 3300035171 Bacteria 7115
146 Ga0373955_0000015 3300035172 Bacteria 72056
147 Ga0373955_0082199 3300035172 Bacteria 1822
148 Ga0373955_0355560 3300035172 Bacteria 887
149 Ga0373924_0000273 3300035410 Bacteria 15868
150 Ga0373924_0052552 3300035410 Bacteria 1691
151 Ga0373935_0003807 3300035692 Bacteria 8809
152 Ga0373935_0088136 3300035692 Bacteria 2027
153 Ga0373935_0115238 3300035692 Bacteria 1789
154 Ga0373927_0002270 3300035695 Bacteria 14086
155 Ga0373933_0000004 3300035724 Bacteria 143741
156 Ga0373933_0032192 3300035724 Bacteria 3046
157 Ga0373933_0076554 3300035724 Bacteria 2044
158 Ga0373933_0206955 3300035724 Bacteria 1256
159 Ga0373947_0009607 3300035725 Bacteria 5551
160 Ga0373937_0000012 3300036401 Bacteria 159418
161 Ga0373937_0064872 3300036401 Bacteria 3360
162 Ga0373937_0378462 3300036401 Bacteria 1342
163 Ga0373925_0045325 3300037068 Bacteria 3266
164 Ga0373925_0063329 3300037068 Bacteria 2782
165 Ga0373925_0064771 3300037068 Bacteria 2752
166 Ga0373925_0076966 3300037068 Bacteria 2531
167 Ga0373925_0293496 3300037068 Bacteria 1311
168 Ga0373925_0419977 3300037068 Bacteria 1092
169 Ga0395900_0112176 3300037418 Bacteria 2800
170 Ga0395898_0078378 3300037466 Bacteria 3188
171 Ga0395905_0057391 3300037471 Bacteria 3642
172 Ga0436364_0451842 3300037853 Bacteria 1063
173 Ga0436364_0590382 3300037853 Bacteria 30498
174 Ga0395901_0147768 3300038443 Bacteria 2470
175 Ga0395901_0241988 3300038443 Bacteria 1882
176 Ga0436362_0982748 3300039453 Bacteria 11358
177 Ga0466963_0036150 3300044694 Bacteria 3220
178 Ga0466963_0077349 3300044694 Bacteria 2248
179 Ga0466964_0275348 3300044706 Bacteria 839
180 Ga0466957_0158585 3300044842 Bacteria 1468
181 Ga0466959_0220635 3300045049 Bacteria 1315
182 Ga0466959_0390028 3300045049 Bacteria 947
183 Ga0466958_0061049 3300045836 Bacteria 2295
184 Ga0466967_0142653 3300045976 Bacteria 2232
185 Ga0495592_0000227 3300046454 Bacteria 48658
186 Ga0495592_0060290 3300046454 Bacteria 2791
187 Ga0495629_0139865 3300046459 Bacteria 1685
188 Ga0495629_0205101 3300046459 Bacteria 1362
189 Ga0495641_0090324 3300046461 Bacteria 1368
190 Ga0495651_0000020 3300046462 Bacteria 120523
191 Ga0495651_0001466 3300046462 Bacteria 18233
192 Ga0495651_0010452 3300046462 Bacteria 7131
193 Ga0495651_0032413 3300046462 Bacteria 4075
194 Ga0495651_0142239 3300046462 Bacteria 1738
195 Ga0495653_0000828 3300046463 Bacteria 23835
196 Ga0495653_0015253 3300046463 Bacteria 6261
197 Ga0495653_0154556 3300046463 Bacteria 1599
198 Ga0495582_0021305 3300046473 Bacteria 3548
199 Ga0495582_0084939 3300046473 Bacteria 1760
200 Ga0495662_0027556 3300046476 Bacteria 2744
201 Ga0495662_0056693 3300046476 Bacteria 1892
202 Ga0495662_0084037 3300046476 Bacteria 1549
203 Ga0495664_0016818 3300046477 Bacteria 4175
204 Ga0495664_0028425 3300046477 Bacteria 3265
205 Ga0495608_0000015 3300046511 Bacteria 200266
206 Ga0495608_0032959 3300046511 Bacteria 3503
207 Ga0495608_0063052 3300046511 Bacteria 2433
208 Ga0495618_0012812 3300046514 Bacteria 5096
209 Ga0495618_0140431 3300046514 Bacteria 1545
210 Ga0495618_0285860 3300046514 Bacteria 1027
211 Ga0495628_0071384 3300046516 Bacteria 2707
212 Ga0495628_0110770 3300046516 Bacteria 2111
213 Ga0495628_0201255 3300046516 Bacteria 1500
214 Ga0495630_0111063 3300046517 Bacteria 2076
215 Ga0495630_0282121 3300046517 Bacteria 1269
216 Ga0495630_0517050 3300046517 Bacteria 915
217 Ga0495652_0000074 3300046529 Bacteria 105662
218 Ga0495652_0035058 3300046529 Bacteria 4368
219 Ga0495652_0241325 3300046529 Bacteria 1344
220 Ga0495665_0028246 3300046531 Bacteria 3008
221 Ga0495640_0125858 3300046533 Bacteria 1662
222 Ga0495640_0214722 3300046533 Bacteria 1215
223 Ga0495587_0000085 3300046536 Bacteria 72715
224 Ga0495587_0048774 3300046536 Bacteria 2507
225 Ga0495587_0075566 3300046536 Bacteria 1956
226 Ga0495587_0202139 3300046536 Bacteria 1123
227 Ga0495587_0247324 3300046536 Bacteria 1003
228 Ga0495645_0092650 3300046543 Bacteria 2157
229 Ga0495645_0096985 3300046543 Bacteria 2100
230 Ga0495667_0000033 3300046559 Bacteria 143083
231 Ga0495667_0021699 3300046559 Bacteria 4333
232 Ga0495667_0030332 3300046559 Bacteria 3635
233 Ga0495667_0039980 3300046559 Bacteria 3115
234 Ga0495667_0044382 3300046559 Bacteria 2944
235 Ga0495634_0015344 3300046642 Bacteria 5506
236 Ga0495634_0072421 3300046642 Bacteria 2266
237 Ga0495635_0000658 3300046663 Bacteria 22137
238 Ga0495635_0056326 3300046663 Bacteria 2706
239 Ga0495657_0001020 3300046675 Bacteria 24667
240 Ga0495657_0042308 3300046675 Bacteria 3112
241 Ga0495657_0094320 3300046675 Bacteria 1914
242 Ga0495657_0113282 3300046675 Bacteria 1716
243 Ga0495599_0000018 3300046678 Bacteria 144334
244 Ga0495599_0008209 3300046678 Bacteria 6345
245 Ga0495599_0009768 3300046678 Bacteria 5874
246 Ga0495599_0036981 3300046678 Bacteria 3067
247 Ga0495599_0104391 3300046678 Bacteria 1765
248 Ga0495623_0000075 3300046679 Bacteria 59383
249 Ga0495623_0073714 3300046679 Bacteria 2122
250 Ga0495646_0001864 3300046680 Bacteria 12677
251 Ga0495646_0029459 3300046680 Bacteria 3431
252 Ga0495646_0070249 3300046680 Bacteria 2063
253 Ga0495624_0035552 3300046690 Bacteria 3216
254 Ga0495624_0068963 3300046690 Bacteria 2204
255 Ga0495600_0004171 3300046809 Bacteria 8618
256 Ga0495600_0018569 3300046809 Bacteria 4432
257 Ga0495600_0029448 3300046809 Bacteria 3555
258 Ga0495600_0065690 3300046809 Bacteria 2372
259 Ga0495600_0130438 3300046809 Bacteria 1634
260 Ga0495581_0015967 3300047315 Bacteria 4364
261 Ga0495604_0000025 3300047317 Bacteria 145481
262 Ga0495604_0087625 3300047317 Bacteria 2318
263 Ga0495604_0115749 3300047317 Bacteria 1948
264 Ga0495674_0044712 3300047319 Bacteria 3935
265 Ga0495674_0088142 3300047319 Bacteria 2654
266 Ga0495674_0175583 3300047319 Bacteria 1786
267 Ga0495674_0387688 3300047319 Bacteria 1129
268 Ga0495676_0035969 3300047321 Bacteria 4139
269 Ga0495680_0000015 3300047322 Bacteria 131335
270 Ga0495680_0021161 3300047322 Bacteria 5451
271 Ga0495680_0150464 3300047322 Bacteria 1697
272 Ga0495680_0495847 3300047322 Bacteria 829
273 Ga0495675_0000304 3300047444 Bacteria 35246
274 Ga0495675_0075959 3300047444 Bacteria 2117
275 Ga0495684_0014290 3300047471 Bacteria 6110
276 Ga0495684_0054691 3300047471 Bacteria 3044
277 Ga0495684_0086267 3300047471 Bacteria 2379
278 Ga0495593_0045304 3300047673 Bacteria 2348
279 Ga0495602_0000065 3300048088 Bacteria 104080
280 Ga0495602_0034752 3300048088 Bacteria 4709
281 Ga0495614_0052179 3300048089 Bacteria 1753
282 Ga0496102_0423596 3300048905 Unclassified 1250
283 Ga0496103_0279469 3300048906 Unclassified 1074
284 Ga0496104_0119702 3300048907 Unclassified 2528
285 Ga0496105_0306787 3300048908 Unclassified 1275
286 Ga0496110_0022773 3300048913 Bacteria 5323
287 Ga0496111_0424702 3300048914 Bacteria 982
288 Ga0496113_0268922 3300048916 Unclassified 1362
289 Ga0496114_0037889 3300048917 Bacteria 3989
290 Ga0496115_0093699 3300048918 Bacteria 2456
291 Ga0501036_0165002 3300049572 Bacteria 1867
292 Ga0501037_0119097 3300049573 Bacteria 1899
293 Ga0501038_0129031 3300049574 Bacteria 2078
294 Ga0501039_0087841 3300049575 Bacteria 2422
295 Ga0501040_0048260 3300049576 Bacteria 2910
296 Ga0501042_0008217 3300049578 Bacteria 6878
297 Ga0501046_0039816 3300049580 Bacteria 3760
298 Ga0501047_0013102 3300049581 Bacteria 7852
299 Ga0501047_0034456 3300049581 Bacteria 4889
300 Ga0501048_0153973 3300049582 Bacteria 1626
301 Ga0501072_0255785 3300049588 Bacteria 1394
302 Ga0501073_0009726 3300049589 Bacteria 7082
303 Ga0501074_0050166 3300049590 Bacteria 3012
304 Ga0501074_0087527 3300049590 Bacteria 2231
305 Ga0501079_0159728 3300049741 Bacteria 1757
306 Ga0501081_0021459 3300049743 Bacteria 4310
307 Ga0501044_0063362 3300049823 Bacteria 3777
308 Ga0501045_0077903 3300049824 Bacteria 2443
309 nmdc:mga06r32_331609_c1 3300050510 Bacteria 1506
310 nmdc:mga08x19_108475_c1 3300050514 Bacteria 1849
311 Ga0495601_0040021 3300053077 Bacteria 2936
312 Ga0495612_0024207 3300053078 Bacteria 2438
313 Ga0495595_0000597 3300053084 Bacteria 13766
314 Ga0495595_0012380 3300053084 Bacteria 3586
315 Ga0500655_049759 3300053133 Bacteria 834
316 Ga0500577_0047868 3300053142 Bacteria 1591
317 Ga0587077_043219 3300059493 Unclassified 913
318 Ga0587086_020398 3300059507 Unclassified 900
319 Ga0587115_022144 3300059626 Unclassified 893
320 Ga0587079_042952 3300059647 Unclassified 920
321 Ga0530510_0021458 3300061734 Bacteria 4595
322 Ga0530510_0281313 3300061734 Bacteria 1243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0112176 Ga0395900_0112176_1409_1954 179
2 3300045976 Ga0466967_0142653 Ga0466967_0142653_17_592 188
3 3300022467 Ga0224712_10093988 Ga0224712_100939882 196
4 3300005336 Ga0070680_100070131 Ga0070680_1000701312 203
5 3300025917 Ga0207660_10189496 Ga0207660_101894963 203
6 3300035170 Ga0373943_0140612 Ga0373943_0140612_345_1082 203
7 3300037068 Ga0373925_0064771 Ga0373925_0064771_50_787 203
8 3300046477 Ga0495664_0016818 Ga0495664_0016818_3105_3842 203
9 3300046517 Ga0495630_0282121 Ga0495630_0282121_201_938 203
10 3300046529 Ga0495652_0241325 Ga0495652_0241325_258_995 203
11 3300046543 Ga0495645_0096985 Ga0495645_0096985_240_977 203
12 3300047319 Ga0495674_0044712 Ga0495674_0044712_980_1717 203
13 3300035692 Ga0373935_0115238 Ga0373935_0115238_711_1448 204
14 3300046533 Ga0495640_0125858 Ga0495640_0125858_52_789 205
15 iso_pu_bacteria 3002998708 3003000115 206
16 3300021388 Ga0213875_10159171 Ga0213875_101591712 207
17 3300037853 Ga0436364_0451842 Ga0436364_0451842_229_924 207
18 3300021388 Ga0213875_10000129 Ga0213875_1000012918 208
19 3300059493 Ga0587077_043219 Ga0587077_043219_101_880 208
20 3300059626 Ga0587115_022144 Ga0587115_022144_101_880 208
21 3300059647 Ga0587079_042952 Ga0587079_042952_108_887 208
22 3300025915 Ga0207693_10083464 Ga0207693_100834643 209
23 3300037466 Ga0395898_0078378 Ga0395898_0078378_249_926 209
24 3300037471 Ga0395905_0057391 Ga0395905_0057391_1757_2434 209
25 3300038443 Ga0395901_0147768 Ga0395901_0147768_1038_1715 209
26 3300053084 Ga0495595_0012380 Ga0495595_0012380_653_1402 209
27 3300005435 Ga0070714_100000163 Ga0070714_10000016340 210
28 3300005436 Ga0070713_100056705 Ga0070713_1000567055 210
29 3300005614 Ga0068856_100211973 Ga0068856_1002119732 210
30 3300024225 Ga0224572_1006583 Ga0224572_10065833 210
31 3300025928 Ga0207700_10044926 Ga0207700_100449265 210
32 3300025929 Ga0207664_10001071 Ga0207664_100010719 210
33 3300025904 Ga0207647_10041444 Ga0207647_100414442 211
34 3300031852 Ga0307410_10096255 Ga0307410_100962553 211
35 3300031901 Ga0307406_10229485 Ga0307406_102294851 211
36 3300031995 Ga0307409_100264481 Ga0307409_1002644812 211
37 3300035111 Ga0373923_0008519 Ga0373923_0008519_1154_1903 211
38 3300035117 Ga0373953_0033777 Ga0373953_0033777_1048_1797 211
39 3300035118 Ga0373954_0012340 Ga0373954_0012340_2886_3647 211
40 3300036401 Ga0373937_0064872 Ga0373937_0064872_846_1607 211
41 3300046459 Ga0495629_0139865 Ga0495629_0139865_255_1016 211
42 3300048905 Ga0496102_0423596 Ga0496102_0423596_231_881 211
43 3300048906 Ga0496103_0279469 Ga0496103_0279469_48_698 211
44 3300048907 Ga0496104_0119702 Ga0496104_0119702_1820_2470 211
45 3300048908 Ga0496105_0306787 Ga0496105_0306787_453_1103 211
46 3300048913 Ga0496110_0022773 Ga0496110_0022773_4511_5161 211
47 3300048916 Ga0496113_0268922 Ga0496113_0268922_191_841 211
48 3300048917 Ga0496114_0037889 Ga0496114_0037889_3289_3939 211
49 3300048918 Ga0496115_0093699 Ga0496115_0093699_1557_2207 211
50 3300005327 Ga0070658_10004366 Ga0070658_100043666 212
51 3300005336 Ga0070680_100245706 Ga0070680_1002457063 212
52 3300006844 Ga0075428_100258644 Ga0075428_1002586444 212
53 3300009147 Ga0114129_10146873 Ga0114129_101468734 212
54 3300020070 Ga0206356_10868564 Ga0206356_108685643 212
55 3300020081 Ga0206354_11461454 Ga0206354_114614543 212
56 3300022467 Ga0224712_10068663 Ga0224712_100686633 212
57 3300025909 Ga0207705_10003633 Ga0207705_100036335 212
58 3300025917 Ga0207660_10144328 Ga0207660_101443283 212
59 3300025928 Ga0207700_10008397 Ga0207700_100083978 212
60 3300031824 Ga0307413_10014634 Ga0307413_100146343 212
61 3300031911 Ga0307412_10060950 Ga0307412_100609504 212
62 3300035119 Ga0373956_0013013 Ga0373956_0013013_388_1137 212
63 3300035410 Ga0373924_0052552 Ga0373924_0052552_48_785 212
64 3300044694 Ga0466963_0036150 Ga0466963_0036150_2421_3068 212
65 3300044842 Ga0466957_0158585 Ga0466957_0158585_190_879 212
66 3300045049 Ga0466959_0390028 Ga0466959_0390028_29_673 212
67 3300045836 Ga0466958_0061049 Ga0466958_0061049_886_1533 212
68 3300046462 Ga0495651_0032413 Ga0495651_0032413_3079_3816 212
69 3300046511 Ga0495608_0063052 Ga0495608_0063052_251_988 212
70 3300046559 Ga0495667_0030332 Ga0495667_0030332_1602_2351 212
71 3300046663 Ga0495635_0056326 Ga0495635_0056326_1788_2537 212
72 3300046680 Ga0495646_0070249 Ga0495646_0070249_973_1722 212
73 3300046690 Ga0495624_0068963 Ga0495624_0068963_553_1302 212
74 3300046809 Ga0495600_0018569 Ga0495600_0018569_1051_1788 212
75 3300005530 Ga0070679_100042111 Ga0070679_1000421112 213
76 3300025921 Ga0207652_10058279 Ga0207652_100582792 213
77 3300035086 Ga0373934_0000032 Ga0373934_0000032_28983_29624 213
78 3300035086 Ga0373934_0007982 Ga0373934_0007982_463_1104 213
79 3300035086 Ga0373934_0016843 Ga0373934_0016843_1029_1670 213
80 3300035111 Ga0373923_0003121 Ga0373923_0003121_3171_3812 213
81 3300035111 Ga0373923_0036785 Ga0373923_0036785_246_887 213
82 3300035117 Ga0373953_0004740 Ga0373953_0004740_2943_3584 213
83 3300035118 Ga0373954_0006952 Ga0373954_0006952_41_682 213
84 3300035119 Ga0373956_0000533 Ga0373956_0000533_1922_2563 213
85 3300035119 Ga0373956_0021732 Ga0373956_0021732_1031_1672 213
86 3300035120 Ga0373957_0000080 Ga0373957_0000080_13929_14570 213
87 3300035172 Ga0373955_0000015 Ga0373955_0000015_39074_39715 213
88 3300035172 Ga0373955_0082199 Ga0373955_0082199_491_1132 213
89 3300035410 Ga0373924_0000273 Ga0373924_0000273_4093_4734 213
90 3300035724 Ga0373933_0000004 Ga0373933_0000004_101878_102519 213
91 3300035724 Ga0373933_0076554 Ga0373933_0076554_79_720 213
92 3300035724 Ga0373933_0206955 Ga0373933_0206955_216_857 213
93 3300036401 Ga0373937_0000012 Ga0373937_0000012_61113_61754 213
94 3300046454 Ga0495592_0000227 Ga0495592_0000227_25871_26512 213
95 3300046462 Ga0495651_0000020 Ga0495651_0000020_17800_18441 213
96 3300046462 Ga0495651_0010452 Ga0495651_0010452_3533_4174 213
97 3300046462 Ga0495651_0142239 Ga0495651_0142239_601_1242 213
98 3300046463 Ga0495653_0000828 Ga0495653_0000828_20911_21552 213
99 3300046511 Ga0495608_0000015 Ga0495608_0000015_101984_102625 213
100 3300046511 Ga0495608_0032959 Ga0495608_0032959_91_732 213
101 3300046516 Ga0495628_0071384 Ga0495628_0071384_1073_1714 213
102 3300046529 Ga0495652_0000074 Ga0495652_0000074_65530_66171 213
103 3300046536 Ga0495587_0000085 Ga0495587_0000085_45856_46497 213
104 3300046536 Ga0495587_0247324 Ga0495587_0247324_162_803 213
105 3300046559 Ga0495667_0000033 Ga0495667_0000033_41520_42161 213
106 3300046559 Ga0495667_0039980 Ga0495667_0039980_1404_2045 213
107 3300046675 Ga0495657_0001020 Ga0495657_0001020_4269_4910 213
108 3300046675 Ga0495657_0042308 Ga0495657_0042308_573_1214 213
109 3300046675 Ga0495657_0113282 Ga0495657_0113282_799_1440 213
110 3300046678 Ga0495599_0000018 Ga0495599_0000018_102378_103019 213
111 3300046678 Ga0495599_0009768 Ga0495599_0009768_2535_3176 213
112 3300046679 Ga0495623_0000075 Ga0495623_0000075_54039_54680 213
113 3300046679 Ga0495623_0073714 Ga0495623_0073714_1206_1847 213
114 3300046680 Ga0495646_0001864 Ga0495646_0001864_4234_4875 213
115 3300046809 Ga0495600_0004171 Ga0495600_0004171_6370_7011 213
116 3300046809 Ga0495600_0065690 Ga0495600_0065690_1293_1934 213
117 3300047317 Ga0495604_0000025 Ga0495604_0000025_41254_41895 213
118 3300047317 Ga0495604_0087625 Ga0495604_0087625_1519_2160 213
119 3300047322 Ga0495680_0000015 Ga0495680_0000015_41361_42002 213
120 3300047322 Ga0495680_0021161 Ga0495680_0021161_2535_3176 213
121 3300047444 Ga0495675_0000304 Ga0495675_0000304_31364_32005 213
122 3300047444 Ga0495675_0075959 Ga0495675_0075959_81_722 213
123 3300048088 Ga0495602_0000065 Ga0495602_0000065_41346_41987 213
124 3300048088 Ga0495602_0034752 Ga0495602_0034752_3880_4521 213
125 3300049581 Ga0501047_0034456 Ga0501047_0034456_2743_3390 213
126 3300053084 Ga0495595_0000597 Ga0495595_0000597_11383_12024 213
127 3300059507 Ga0587086_020398 Ga0587086_020398_75_869 213
128 iso_pu_bacteria 2558860280 2559422460 213
129 iso_pu_bacteria 2891554331 2891560971 213
130 3300005435 Ga0070714_100280173 Ga0070714_1002801733 214
131 3300020070 Ga0206356_11908530 Ga0206356_119085303 214
132 3300020077 Ga0206351_10143192 Ga0206351_101431923 214
133 3300021358 Ga0213873_10000186 Ga0213873_100001868 214
134 3300022467 Ga0224712_10001818 Ga0224712_100018186 214
135 3300025929 Ga0207664_10396211 Ga0207664_103962111 214
136 3300030888 Ga0265769_100001 Ga0265769_10000113 214
137 3300039453 Ga0436362_0982748 Ga0436362_0982748_6985_7791 214
138 3300061734 Ga0530510_0281313 Ga0530510_0281313_481_1125 214
139 3300025925 Ga0207650_10363895 Ga0207650_103638952 215
140 3300049572 Ga0501036_0165002 Ga0501036_0165002_1029_1676 215
141 3300049574 Ga0501038_0129031 Ga0501038_0129031_643_1290 215
142 3300049575 Ga0501039_0087841 Ga0501039_0087841_947_1594 215
143 3300049576 Ga0501040_0048260 Ga0501040_0048260_1323_1970 215
144 3300049580 Ga0501046_0039816 Ga0501046_0039816_2585_3232 215
145 3300049582 Ga0501048_0153973 Ga0501048_0153973_655_1302 215
146 3300049588 Ga0501072_0255785 Ga0501072_0255785_367_1014 215
147 3300049590 Ga0501074_0087527 Ga0501074_0087527_1090_1737 215
148 3300049741 Ga0501079_0159728 Ga0501079_0159728_335_982 215
149 3300049743 Ga0501081_0021459 Ga0501081_0021459_1010_1657 215
150 3300049824 Ga0501045_0077903 Ga0501045_0077903_787_1434 215
151 3300053133 Ga0500655_049759 Ga0500655_049759_136_783 215
152 3300053142 Ga0500577_0047868 Ga0500577_0047868_416_1063 215
153 3300061734 Ga0530510_0021458 Ga0530510_0021458_2076_2723 215
154 3300005844 Ga0068862_100446609 Ga0068862_1004466092 216
155 3300017792 Ga0163161_10325631 Ga0163161_103256312 216
156 3300046514 Ga0495618_0140431 Ga0495618_0140431_217_867 216
157 3300046517 Ga0495630_0517050 Ga0495630_0517050_213_863 216
158 3300046533 Ga0495640_0214722 Ga0495640_0214722_90_740 216
159 3300046536 Ga0495587_0048774 Ga0495587_0048774_57_749 216
160 3300049573 Ga0501037_0119097 Ga0501037_0119097_167_862 216
161 3300049578 Ga0501042_0008217 Ga0501042_0008217_1198_1893 216
162 3300049581 Ga0501047_0013102 Ga0501047_0013102_5825_6520 216
163 3300049589 Ga0501073_0009726 Ga0501073_0009726_915_1610 216
164 3300049590 Ga0501074_0050166 Ga0501074_0050166_1137_1832 216
165 3300049823 Ga0501044_0063362 Ga0501044_0063362_922_1617 216
166 iso_pu_bacteria 2891395885 2891400203 216
167 3300003320 rootH2_10084999 rootH2_100849992 217
168 3300003323 rootH1_10124329 rootH1_101243294 217
169 3300003373 JGI25407J50210_10000833 JGI25407J50210_100008335 217
170 3300005328 Ga0070676_10264935 Ga0070676_102649352 217
171 3300005354 Ga0070675_100047747 Ga0070675_1000477475 217
172 3300005539 Ga0068853_100103386 Ga0068853_1001033864 217
173 3300005578 Ga0068854_100076718 Ga0068854_1000767184 217
174 3300005981 Ga0081538_10000212 Ga0081538_1000021237 217
175 3300009094 Ga0111539_10391018 Ga0111539_103910182 217
176 3300014969 Ga0157376_11311698 Ga0157376_113116981 217
177 3300025940 Ga0207691_10045018 Ga0207691_100450184 217
178 3300025981 Ga0207640_10063899 Ga0207640_100638992 217
179 3300026041 Ga0207639_10190813 Ga0207639_101908133 217
180 3300026142 Ga0207698_10200771 Ga0207698_102007712 217
181 3300037068 Ga0373925_0076966 Ga0373925_0076966_1315_1968 217
182 3300005434 Ga0070709_10285196 Ga0070709_102851962 218
183 3300005435 Ga0070714_100004509 Ga0070714_10000450911 218
184 3300005468 Ga0070707_100046334 Ga0070707_1000463344 218
185 3300005471 Ga0070698_100029353 Ga0070698_1000293532 218
186 3300005614 Ga0068856_100357297 Ga0068856_1003572972 218
187 3300006175 Ga0070712_100609903 Ga0070712_1006099032 218
188 3300025898 Ga0207692_10011707 Ga0207692_100117072 218
189 3300025906 Ga0207699_10068996 Ga0207699_100689962 218
190 3300025906 Ga0207699_10190074 Ga0207699_101900743 218
191 3300025910 Ga0207684_10070031 Ga0207684_100700314 218
192 3300025916 Ga0207663_10295018 Ga0207663_102950182 218
193 3300025928 Ga0207700_10103401 Ga0207700_101034013 218
194 3300025929 Ga0207664_10090973 Ga0207664_100909734 218
195 3300025939 Ga0207665_10131467 Ga0207665_101314672 218
196 3300026078 Ga0207702_10392200 Ga0207702_103922003 218
197 3300035083 Ga0373926_0001004 Ga0373926_0001004_1912_2595 218
198 3300035089 Ga0373944_0006255 Ga0373944_0006255_572_1255 218
199 3300035113 Ga0373936_0000482 Ga0373936_0000482_12238_12921 218
200 3300035116 Ga0373945_0000485 Ga0373945_0000485_1913_2596 218
201 3300035170 Ga0373943_0014761 Ga0373943_0014761_830_1513 218
202 3300035171 Ga0373946_0002015 Ga0373946_0002015_1869_2552 218
203 3300035692 Ga0373935_0003807 Ga0373935_0003807_1242_1925 218
204 3300035692 Ga0373935_0088136 Ga0373935_0088136_886_1578 218
205 3300035695 Ga0373927_0002270 Ga0373927_0002270_1716_2399 218
206 3300035725 Ga0373947_0009607 Ga0373947_0009607_1867_2550 218
207 3300036401 Ga0373937_0378462 Ga0373937_0378462_524_1207 218
208 3300037068 Ga0373925_0045325 Ga0373925_0045325_1488_2171 218
209 3300037068 Ga0373925_0063329 Ga0373925_0063329_54_719 218
210 3300037068 Ga0373925_0293496 Ga0373925_0293496_280_957 218
211 3300046454 Ga0495592_0060290 Ga0495592_0060290_340_1032 218
212 3300046459 Ga0495629_0205101 Ga0495629_0205101_27_710 218
213 3300046461 Ga0495641_0090324 Ga0495641_0090324_553_1236 218
214 3300046463 Ga0495653_0015253 Ga0495653_0015253_5063_5746 218
215 3300046473 Ga0495582_0021305 Ga0495582_0021305_2781_3464 218
216 3300046476 Ga0495662_0027556 Ga0495662_0027556_1848_2531 218
217 3300046476 Ga0495662_0056693 Ga0495662_0056693_177_857 218
218 3300046477 Ga0495664_0028425 Ga0495664_0028425_1869_2552 218
219 3300046514 Ga0495618_0285860 Ga0495618_0285860_90_782 218
220 3300046516 Ga0495628_0110770 Ga0495628_0110770_1356_2048 218
221 3300046517 Ga0495630_0111063 Ga0495630_0111063_893_1576 218
222 3300046529 Ga0495652_0035058 Ga0495652_0035058_2394_3077 218
223 3300046531 Ga0495665_0028246 Ga0495665_0028246_711_1394 218
224 3300046536 Ga0495587_0202139 Ga0495587_0202139_247_924 218
225 3300046559 Ga0495667_0044382 Ga0495667_0044382_677_1360 218
226 3300046642 Ga0495634_0072421 Ga0495634_0072421_760_1443 218
227 3300046663 Ga0495635_0000658 Ga0495635_0000658_20527_21210 218
228 3300046675 Ga0495657_0094320 Ga0495657_0094320_1166_1882 218
229 3300046678 Ga0495599_0036981 Ga0495599_0036981_832_1515 218
230 3300046678 Ga0495599_0104391 Ga0495599_0104391_848_1513 218
231 3300046690 Ga0495624_0035552 Ga0495624_0035552_1970_2653 218
232 3300046809 Ga0495600_0130438 Ga0495600_0130438_476_1192 218
233 3300047315 Ga0495581_0015967 Ga0495581_0015967_1839_2522 218
234 3300047317 Ga0495604_0115749 Ga0495604_0115749_188_871 218
235 3300047319 Ga0495674_0088142 Ga0495674_0088142_1651_2343 218
236 3300047319 Ga0495674_0175583 Ga0495674_0175583_164_847 218
237 3300047319 Ga0495674_0387688 Ga0495674_0387688_42_707 218
238 3300047321 Ga0495676_0035969 Ga0495676_0035969_1598_2281 218
239 3300047322 Ga0495680_0150464 Ga0495680_0150464_581_1264 218
240 3300047322 Ga0495680_0495847 Ga0495680_0495847_91_783 218
241 3300047471 Ga0495684_0054691 Ga0495684_0054691_599_1282 218
242 3300047673 Ga0495593_0045304 Ga0495593_0045304_1058_1741 218
243 3300048089 Ga0495614_0052179 Ga0495614_0052179_551_1234 218
244 3300048914 Ga0496111_0424702 Ga0496111_0424702_83_796 218
245 3300020069 Ga0197907_10951335 Ga0197907_109513352 219
246 3300031548 Ga0307408_100045417 Ga0307408_1000454173 219
247 3300031731 Ga0307405_10039915 Ga0307405_100399155 219
248 3300031901 Ga0307406_10039468 Ga0307406_100394683 219
249 3300031995 Ga0307409_100069896 Ga0307409_1000698962 219
250 3300032002 Ga0307416_100041689 Ga0307416_1000416895 219
251 3300032004 Ga0307414_10369031 Ga0307414_103690311 219
252 3300032126 Ga0307415_100023754 Ga0307415_1000237545 219
253 3300044706 Ga0466964_0275348 Ga0466964_0275348_62_811 219
254 3300045049 Ga0466959_0220635 Ga0466959_0220635_497_1156 219
255 3300047471 Ga0495684_0086267 Ga0495684_0086267_1629_2309 219
256 3300053077 Ga0495601_0040021 Ga0495601_0040021_535_1215 219
257 3300005437 Ga0070710_10030164 Ga0070710_100301642 220
258 3300005445 Ga0070708_100047160 Ga0070708_1000471601 220
259 3300005467 Ga0070706_100068637 Ga0070706_1000686373 220
260 3300005471 Ga0070698_100014944 Ga0070698_1000149448 220
261 3300006847 Ga0075431_100853271 Ga0075431_1008532712 220
262 3300025910 Ga0207684_10455954 Ga0207684_104559542 220
263 3300025922 Ga0207646_10028915 Ga0207646_100289151 220
264 3300031901 Ga0307406_10127083 Ga0307406_101270833 220
265 3300031901 Ga0307406_10275818 Ga0307406_102758183 220
266 3300032002 Ga0307416_100035417 Ga0307416_1000354173 220
267 3300032126 Ga0307415_100564795 Ga0307415_1005647952 220
268 3300050510 nmdc:mga06r32_331609_c1 nmdc:mga06r32_331609_c1_200_871 220
269 3300005435 Ga0070714_100056404 Ga0070714_1000564045 221
270 3300005436 Ga0070713_100192759 Ga0070713_1001927593 221
271 3300005436 Ga0070713_100225770 Ga0070713_1002257702 221
272 3300005468 Ga0070707_100047441 Ga0070707_1000474416 221
273 3300005471 Ga0070698_100026343 Ga0070698_1000263434 221
274 3300005536 Ga0070697_100013829 Ga0070697_1000138298 221
275 3300006028 Ga0070717_10193141 Ga0070717_101931412 221
276 3300025922 Ga0207646_10274234 Ga0207646_102742341 221
277 3300025929 Ga0207664_10674737 Ga0207664_106747372 221
278 3300038443 Ga0395901_0241988 Ga0395901_0241988_65_748 221
279 3300031548 Ga0307408_100147376 Ga0307408_1001473763 222
280 3300031731 Ga0307405_10047414 Ga0307405_100474144 222
281 3300031824 Ga0307413_10007121 Ga0307413_100071217 222
282 3300031852 Ga0307410_10004986 Ga0307410_1000498610 222
283 3300031901 Ga0307406_10043441 Ga0307406_100434414 222
284 3300031903 Ga0307407_10020090 Ga0307407_100200907 222
285 3300031911 Ga0307412_10138387 Ga0307412_101383873 222
286 3300031995 Ga0307409_100052762 Ga0307409_1000527625 222
287 3300032002 Ga0307416_100200567 Ga0307416_1002005673 222
288 3300032004 Ga0307414_10022997 Ga0307414_100229973 222
289 3300032005 Ga0307411_10119527 Ga0307411_101195272 222
290 3300005618 Ga0068864_100182083 Ga0068864_1001820833 223
291 3300005985 Ga0081539_10022930 Ga0081539_100229302 223
292 3300006028 Ga0070717_10211385 Ga0070717_102113854 223
293 3300021384 Ga0213876_10287369 Ga0213876_102873692 223
294 3300025924 Ga0207694_10080096 Ga0207694_100800964 223
295 3300025928 Ga0207700_10045917 Ga0207700_100459172 223
296 3300025929 Ga0207664_10140340 Ga0207664_101403403 223
297 3300026116 Ga0207674_10193226 Ga0207674_101932263 223
298 3300035117 Ga0373953_0026214 Ga0373953_0026214_1320_2024 223
299 3300035118 Ga0373954_0053385 Ga0373954_0053385_85_789 223
300 3300035172 Ga0373955_0355560 Ga0373955_0355560_42_746 223
301 3300035724 Ga0373933_0032192 Ga0373933_0032192_695_1399 223
302 3300037068 Ga0373925_0419977 Ga0373925_0419977_130_831 223
303 3300044694 Ga0466963_0077349 Ga0466963_0077349_1142_1846 223
304 3300046462 Ga0495651_0001466 Ga0495651_0001466_17009_17713 223
305 3300046463 Ga0495653_0154556 Ga0495653_0154556_431_1135 223
306 3300046473 Ga0495582_0084939 Ga0495582_0084939_1020_1724 223
307 3300046476 Ga0495662_0084037 Ga0495662_0084037_822_1526 223
308 3300046514 Ga0495618_0012812 Ga0495618_0012812_414_1118 223
309 3300046516 Ga0495628_0201255 Ga0495628_0201255_521_1225 223
310 3300046536 Ga0495587_0075566 Ga0495587_0075566_173_889 223
311 3300046543 Ga0495645_0092650 Ga0495645_0092650_946_1650 223
312 3300046559 Ga0495667_0021699 Ga0495667_0021699_1321_2025 223
313 3300046642 Ga0495634_0015344 Ga0495634_0015344_2052_2753 223
314 3300046678 Ga0495599_0008209 Ga0495599_0008209_4722_5426 223
315 3300046680 Ga0495646_0029459 Ga0495646_0029459_2463_3167 223
316 3300046809 Ga0495600_0029448 Ga0495600_0029448_1826_2530 223
317 3300047471 Ga0495684_0014290 Ga0495684_0014290_1593_2297 223
318 3300050514 nmdc:mga08x19_108475_c1 nmdc:mga08x19_108475_c1_16_717 223
319 3300053078 Ga0495612_0024207 Ga0495612_0024207_951_1655 223
320 3300020081 Ga0206354_11415301 Ga0206354_114153013 224
321 3300021388 Ga0213875_10002623 Ga0213875_100026234 224
322 3300021388 Ga0213875_10005210 Ga0213875_100052106 224
323 3300037853 Ga0436364_0590382 Ga0436364_0590382_25620_26408 224
324 3300003203 JGI25406J46586_10009466 JGI25406J46586_100094662 226
325 3300005985 Ga0081539_10000179 Ga0081539_1000017956 226
326 3300030522 Ga0307512_10017534 Ga0307512_100175347 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

65

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u6n-assembly1.cif.gz_A crystal structure of escherichia coli diaa 0.9281 29 216
1tk9-assembly1.cif.gz_D crystal structure of phosphoheptose isomerase 1 0.913 26 214
5by2-assembly1.cif.gz_A sedoheptulose 7-phosphate isomerase from colwellia psychrerythraea strain 34h 0.9093 25 212
4u6n-assembly1.cif.gz_A crystal structure of escherichia coli diaa 0.9007 29 216
3bjz-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa phosphoheptose isomerase 0.8935 27 212
ID Description Score Start End Superfamily
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8933 26 212 3.40.50.10490
3trjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8852 25 212 3.40.50.10490
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8795 26 212 3.40.50.10490
2i2wB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8643 30 216 3.40.50.10490
3trjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8625 25 212 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A7J9VH22-F1-model_v4 SIS domain-containing protein 0.9767 34 217 GO:0097367
GO:1901135
AF-A0A1I6DAS0-F1-model_v4 D-sedoheptulose 7-phosphate isomerase 0.9657 63 218 GO:0016853
GO:0097367
GO:1901135
AF-A0A5S4FRX4-F1-model_v4 SIS domain-containing protein 0.965 42 212 GO:0097367
GO:1901135
AF-A0A4Y8PFS8-F1-model_v4 SIS domain-containing protein 0.9618 35 212 GO:0097367
GO:1901135
AF-A0A4Y3WJG5-F1-model_v4 SIS domain-containing protein 0.9612 63 214 GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
85.8 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map