F408310

General Info

Members Datasets Scaffolds Average Seq Length
326 201 295 232

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10046693|Ga0157378_100466934
Length 282
Sequence MLKFIDTVGAAIAGIKDGSTVMIGGFGNAGQPFELIDALLDSGATDLTVVNNNAGQGDQGLALLIKEGRVRKMICSFPRQSDSWHFDAKYKAGEIELELVPQGNLAERIRAAGAGIGGFFTPTGYGTMLAEGKHTRFLDGKWQVFETPIHADVALIKALKADGKGNLVYRKTARNFGTIMAAAAKHTIVQVSEIVPTGALDPENVVTPGIYVNSIVKVAGHEDPNVNNTLGTRRSRAARGAGHRSRLVREPRHRPAHARLQLPHRRAEHHPPYGERDARDGP

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
3 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
4 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
5 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
6 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
7 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
9 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
10 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
11 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
12 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
13 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
14 2808606394 Promicromonospora sp. C35 Isolate Unclassified
15 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
16 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
17 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
18 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
19 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
20 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
21 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
22 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
23 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
24 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
25 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
26 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
27 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
98 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
200 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
201 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 0
Isolates 9.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.28
Nodule 0.31
Rhizoplane 3.07
Rhizosphere 78.53
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000401 3300002705 Bacteria 27216
2 JGI25152J39213_1002708 3300002773 Bacteria 6476
3 Ga0055524_1000331 3300003775 Bacteria 43988
4 Ga0055534_1000031 3300003784 Bacteria 120517
5 Ga0070667_100277958 3300005367 Bacteria 1503
6 Ga0070714_100116602 3300005435 Bacteria 2371
7 Ga0070663_100264529 3300005455 Bacteria 1365
8 Ga0070684_100155333 3300005535 Bacteria 2074
9 Ga0070672_100252331 3300005543 Bacteria 1486
10 Ga0068855_100095534 3300005563 Bacteria 3425
11 Ga0081455_10146863 3300005937 Bacteria 1823
12 Ga0070717_10085265 3300006028 Bacteria 2658
13 Ga0075363_100019977 3300006048 Bacteria 3355
14 Ga0075432_10043293 3300006058 Bacteria 1577
15 Ga0075367_10026268 3300006178 Bacteria 3301
16 Ga0075366_10006817 3300006195 Bacteria 6282
17 Ga0075370_10020335 3300006353 Bacteria 3626
18 Ga0075430_100348992 3300006846 Bacteria 1222
19 Ga0105244_10010864 3300009036 Bacteria 5496
20 Ga0105243_10008571 3300009148 Bacteria 7845
21 Ga0105242_10815515 3300009176 Bacteria 925
22 Ga0105246_10009607 3300011119 Bacteria 5961
23 Ga0105246_10239307 3300011119 Bacteria 1434
24 Ga0157370_10108784 3300013104 Bacteria 2592
25 Ga0157370_10329618 3300013104 Bacteria 1408
26 Ga0157369_10119591 3300013105 Bacteria 2795
27 Ga0157369_10309602 3300013105 Bacteria 1642
28 Ga0157378_10046693 3300013297 Bacteria 3849
29 Ga0163162_10234806 3300013306 Bacteria 1964
30 Ga0207425_1008958 3300025245 Bacteria 2521
31 Ga0209759_1000077 3300025256 Bacteria 175706
32 Ga0209129_1000130 3300025258 Bacteria 128065
33 Ga0209565_1000072 3300025263 Bacteria 164988
34 Ga0209673_1057566 3300025273 Bacteria 989
35 Ga0209675_1000049 3300025291 Bacteria 215042
36 Ga0209025_1000364 3300025294 Bacteria 96280
37 Ga0209564_1000130 3300025295 Bacteria 194399
38 Ga0209256_1000126 3300025299 Bacteria 165242
39 Ga0209051_1008385 3300025303 Bacteria 5476
40 Ga0209051_1009433 3300025303 Bacteria 5032
41 Ga0207655_1006782 3300025728 Bacteria 7532
42 Ga0207664_10040412 3300025929 Bacteria 3627
43 Ga0207691_10248845 3300025940 Bacteria 1535
44 Ga0207691_10344075 3300025940 Bacteria 1276
45 Ga0207667_10245779 3300025949 Bacteria 1831
46 Ga0207658_10038677 3300025986 Bacteria 3439
47 Ga0207678_10157554 3300026067 Bacteria 1939
48 Ga0207428_10061018 3300027907 Bacteria 2987
49 Ga0307408_100004011 3300031548 Bacteria 10037
50 Ga0307408_100014809 3300031548 Bacteria 5185
51 Ga0307408_100018230 3300031548 Bacteria 4711
52 Ga0307408_100058366 3300031548 Bacteria 2805
53 Ga0307408_100064202 3300031548 Bacteria 2688
54 Ga0307408_100110060 3300031548 Bacteria 2114
55 Ga0307408_100135344 3300031548 Bacteria 1927
56 Ga0307408_100201876 3300031548 Bacteria 1610
57 Ga0307408_100219799 3300031548 Bacteria 1549
58 Ga0307408_100231004 3300031548 Bacteria 1515
59 Ga0307408_100328651 3300031548 Bacteria 1290
60 Ga0307408_100330784 3300031548 Bacteria 1286
61 Ga0307408_100365014 3300031548 Bacteria 1229
62 Ga0307408_100387034 3300031548 Bacteria 1197
63 Ga0307408_100647506 3300031548 Bacteria 944
64 Ga0307405_10000995 3300031731 Bacteria 11415
65 Ga0307405_10006523 3300031731 Bacteria 5747
66 Ga0307405_10009328 3300031731 Bacteria 5024
67 Ga0307405_10020827 3300031731 Bacteria 3672
68 Ga0307405_10049485 3300031731 Bacteria 2598
69 Ga0307405_10201926 3300031731 Bacteria 1444
70 Ga0307405_10265046 3300031731 Bacteria 1285
71 Ga0307405_10371958 3300031731 Bacteria 1109
72 Ga0307405_10524927 3300031731 Bacteria 953
73 Ga0307405_10649505 3300031731 Bacteria 867
74 Ga0307405_10730414 3300031731 Bacteria 823
75 Ga0307413_10013606 3300031824 Bacteria 4097
76 Ga0307413_10018039 3300031824 Bacteria 3692
77 Ga0307413_10033517 3300031824 Bacteria 2925
78 Ga0307413_10038233 3300031824 Bacteria 2779
79 Ga0307413_10070642 3300031824 Bacteria 2197
80 Ga0307413_10199297 3300031824 Bacteria 1444
81 Ga0307413_10300464 3300031824 Bacteria 1217
82 Ga0307413_10338520 3300031824 Bacteria 1156
83 Ga0307410_10004241 3300031852 Bacteria 7375
84 Ga0307410_10060274 3300031852 Bacteria 2593
85 Ga0307410_10070808 3300031852 Bacteria 2417
86 Ga0307410_10087743 3300031852 Bacteria 2201
87 Ga0307410_10097830 3300031852 Bacteria 2097
88 Ga0307410_10172370 3300031852 Bacteria 1631
89 Ga0307410_10357685 3300031852 Bacteria 1168
90 Ga0307410_10390034 3300031852 Bacteria 1122
91 Ga0307406_10022234 3300031901 Bacteria 3760
92 Ga0307406_10116881 3300031901 Bacteria 1846
93 Ga0307407_10019788 3300031903 Bacteria 3434
94 Ga0307407_10049194 3300031903 Bacteria 2404
95 Ga0307407_10101833 3300031903 Bacteria 1784
96 Ga0307407_10115531 3300031903 Bacteria 1692
97 Ga0307407_10315331 3300031903 Bacteria 1095
98 Ga0307407_10578726 3300031903 Bacteria 833
99 Ga0307412_10005817 3300031911 Bacteria 6935
100 Ga0307412_10007813 3300031911 Bacteria 6086
101 Ga0307412_10016854 3300031911 Bacteria 4363
102 Ga0307412_10023185 3300031911 Bacteria 3816
103 Ga0307412_10029237 3300031911 Bacteria 3457
104 Ga0307412_10049274 3300031911 Bacteria 2774
105 Ga0307412_10049928 3300031911 Bacteria 2758
106 Ga0307412_10074361 3300031911 Bacteria 2328
107 Ga0307412_10203443 3300031911 Bacteria 1505
108 Ga0307412_10396112 3300031911 Bacteria 1122
109 Ga0307412_10654912 3300031911 Bacteria 896
110 Ga0307409_100000970 3300031995 Bacteria 13388
111 Ga0307409_100029816 3300031995 Bacteria 3911
112 Ga0307409_100131697 3300031995 Bacteria 2138
113 Ga0307409_100164229 3300031995 Bacteria 1946
114 Ga0307409_100196182 3300031995 Bacteria 1802
115 Ga0307409_100303920 3300031995 Bacteria 1485
116 Ga0307409_100465529 3300031995 Bacteria 1223
117 Ga0307409_100954595 3300031995 Bacteria 873
118 Ga0307416_100023739 3300032002 Bacteria 4458
119 Ga0307416_100026238 3300032002 Bacteria 4289
120 Ga0307416_100036294 3300032002 Bacteria 3778
121 Ga0307416_100120770 3300032002 Bacteria 2334
122 Ga0307416_100182962 3300032002 Bacteria 1966
123 Ga0307416_100183322 3300032002 Bacteria 1964
124 Ga0307416_100205136 3300032002 Bacteria 1874
125 Ga0307416_100226240 3300032002 Bacteria 1799
126 Ga0307416_100390556 3300032002 Bacteria 1425
127 Ga0307416_100411615 3300032002 Bacteria 1393
128 Ga0307416_100459884 3300032002 Bacteria 1327
129 Ga0307411_10059965 3300032005 Bacteria 2524
130 Ga0307415_100065651 3300032126 Bacteria 2529
131 Ga0307415_100125818 3300032126 Bacteria 1931
132 Ga0307415_100142123 3300032126 Bacteria 1835
133 Ga0307415_100412455 3300032126 Bacteria 1156
134 Ga0307415_100613498 3300032126 Bacteria 970
135 Ga0307507_10026751 3300033179 Bacteria 6206
136 Ga0373945_0103993 3300035116 Bacteria 1114
137 Ga0373943_0025233 3300035170 Bacteria 2778
138 Ga0373935_0025775 3300035692 Bacteria 3624
139 Ga0373927_0144616 3300035695 Bacteria 1556
140 Ga0373933_0383276 3300035724 Bacteria 916
141 Ga0373947_0102234 3300035725 Bacteria 1802
142 Ga0373925_0129614 3300037068 Bacteria 1965
143 Ga0395899_0008495 3300037312 Bacteria 7911
144 Ga0395899_0049364 3300037312 Bacteria 3128
145 Ga0395900_0016476 3300037418 Bacteria 7537
146 Ga0395900_0096684 3300037418 Bacteria 3034
147 Ga0395898_0096044 3300037466 Bacteria 2847
148 Ga0395898_0130992 3300037466 Bacteria 2402
149 Ga0395898_0266865 3300037466 Bacteria 1633
150 Ga0436364_0220245 3300037853 Bacteria 2691
151 Ga0395901_0179363 3300038443 Bacteria 2221
152 Ga0395901_0329005 3300038443 Bacteria 1580
153 Ga0439438_049524 3300041405 Bacteria 1072
154 Ga0439466_0001849 3300041411 Bacteria 8313
155 Ga0439433_0000174 3300041999 Bacteria 10109
156 Ga0439433_0018526 3300041999 Bacteria 1550
157 Ga0439442_000251 3300042002 Bacteria 13066
158 Ga0439442_000737 3300042002 Bacteria 6857
159 Ga0439442_000901 3300042002 Bacteria 6118
160 Ga0439449_0006701 3300042007 Bacteria 4396
161 Ga0439449_0013166 3300042007 Bacteria 3112
162 Ga0439452_037082 3300042010 Bacteria 1164
163 Ga0439462_0000045 3300042015 Bacteria 17499
164 Ga0439462_0006710 3300042015 Bacteria 2871
165 Ga0450920_000333 3300042122 Bacteria 7199
166 Ga0450920_000344 3300042122 Bacteria 7121
167 Ga0450920_006255 3300042122 Bacteria 2137
168 Ga0450920_013102 3300042122 Bacteria 1560
169 Ga0450907_000232 3300042146 Bacteria 19464
170 Ga0450907_000639 3300042146 Bacteria 9249
171 Ga0450908_006077 3300042184 Bacteria 2303
172 Ga0450909_002347 3300042185 Bacteria 2683
173 Ga0439434_0000012 3300042435 Bacteria 46644
174 Ga0439434_0000834 3300042435 Bacteria 8890
175 Ga0450918_000695 3300042531 Bacteria 7121
176 Ga0450918_001397 3300042531 Bacteria 4820
177 Ga0466970_0248776 3300044765 Bacteria 996
178 Ga0495590_0005675 3300046457 Bacteria 4910
179 Ga0495629_0000020 3300046459 Bacteria 155818
180 Ga0495651_0041927 3300046462 Bacteria 3555
181 Ga0495653_0000663 3300046463 Bacteria 26268
182 Ga0495650_0019170 3300046471 Bacteria 3378
183 Ga0495650_0067221 3300046471 Bacteria 1416
184 Ga0495580_0015753 3300046472 Bacteria 5695
185 Ga0495580_0027418 3300046472 Bacteria 4144
186 Ga0495582_0207239 3300046473 Bacteria 1120
187 Ga0495605_0021619 3300046474 Bacteria 3404
188 Ga0495639_0079665 3300046475 Bacteria 1524
189 Ga0495664_0011390 3300046477 Bacteria 5013
190 Ga0495664_0057207 3300046477 Bacteria 2320
191 Ga0495594_0436057 3300046499 Bacteria 745
192 Ga0495583_0002745 3300046506 Bacteria 14565
193 Ga0495606_0020305 3300046507 Bacteria 4902
194 Ga0495620_0002288 3300046515 Bacteria 11088
195 Ga0495628_0006595 3300046516 Bacteria 10130
196 Ga0495628_0050116 3300046516 Bacteria 3304
197 Ga0495630_0149902 3300046517 Bacteria 1774
198 Ga0495648_0053599 3300046524 Bacteria 2442
199 Ga0495666_0057972 3300046526 Bacteria 1854
200 Ga0495665_0000160 3300046531 Bacteria 33594
201 Ga0495665_0095692 3300046531 Bacteria 1559
202 Ga0495586_0000286 3300046535 Bacteria 32176
203 Ga0495587_0006877 3300046536 Bacteria 7393
204 Ga0495609_0042309 3300046538 Bacteria 2046
205 Ga0495645_0000355 3300046543 Bacteria 31940
206 Ga0495667_0003756 3300046559 Bacteria 10210
207 Ga0495656_0025556 3300046615 Bacteria 2342
208 Ga0495635_0246326 3300046663 Bacteria 1205
209 Ga0495659_0021329 3300046664 Bacteria 2182
210 Ga0495588_0053852 3300046674 Bacteria 2075
211 Ga0495657_0064553 3300046675 Bacteria 2411
212 Ga0495599_0043186 3300046678 Bacteria 2828
213 Ga0495623_0005123 3300046679 Bacteria 8602
214 Ga0495613_0056940 3300046689 Bacteria 2870
215 Ga0495624_0014241 3300046690 Bacteria 5400
216 Ga0495670_0001738 3300046691 Bacteria 10726
217 Ga0495671_0018131 3300046692 Bacteria 3739
218 Ga0495649_0154487 3300046694 Bacteria 1204
219 Ga0495589_0056703 3300046794 Bacteria 1928
220 Ga0495600_0254411 3300046809 Bacteria 1117
221 Ga0495604_0002712 3300047317 Bacteria 14201
222 Ga0495604_0313889 3300047317 Bacteria 1049
223 Ga0495674_0007149 3300047319 Bacteria 10679
224 Ga0495674_0119487 3300047319 Bacteria 2227
225 Ga0495672_0000920 3300047320 Bacteria 30767
226 Ga0495672_0053630 3300047320 Bacteria 2361
227 Ga0495676_0053099 3300047321 Bacteria 3232
228 Ga0495680_0059326 3300047322 Bacteria 2954
229 Ga0495683_0012312 3300047323 Bacteria 4495
230 Ga0495675_0015726 3300047444 Bacteria 4784
231 Ga0495675_0019065 3300047444 Bacteria 4357
232 Ga0495679_000144 3300047446 Bacteria 64609
233 Ga0495686_0000076 3300047472 Bacteria 206039
234 Ga0495686_0045230 3300047472 Bacteria 2785
235 Ga0495686_0105559 3300047472 Bacteria 1695
236 Ga0495686_0185424 3300047472 Bacteria 1203
237 Ga0495602_0105782 3300048088 Bacteria 2298
238 Ga0495626_0018154 3300048091 Bacteria 3539
239 Ga0496103_0022626 3300048906 Bacteria 3784
240 Ga0496103_0079022 3300048906 Bacteria 2066
241 Ga0496105_0165169 3300048908 Bacteria 1816
242 Ga0496105_0166113 3300048908 Bacteria 1811
243 Ga0496107_0002875 3300048910 Bacteria 11381
244 Ga0496108_0153818 3300048911 Bacteria 1986
245 Ga0496109_0201582 3300048912 Bacteria 1871
246 Ga0496112_0146128 3300048915 Bacteria 2333
247 Ga0496115_0309429 3300048918 Bacteria 1294
248 Ga0496116_0042557 3300048919 Bacteria 3103
249 Ga0496118_0054950 3300048921 Bacteria 3010
250 Ga0496121_0025753 3300048924 Bacteria 5569
251 Ga0496122_0002381 3300048925 Bacteria 26910
252 Ga0496122_0099615 3300048925 Bacteria 1947
253 Ga0496123_0035917 3300048926 Bacteria 3524
254 Ga0496123_0038897 3300048926 Bacteria 3335
255 Ga0496124_0005966 3300048927 Bacteria 13456
256 Ga0496125_0000359 3300048928 Bacteria 86115
257 Ga0496125_0004558 3300048928 Bacteria 15894
258 Ga0496126_0000230 3300048929 Bacteria 120323
259 Ga0496126_0051346 3300048929 Bacteria 3754
260 Ga0495682_0031717 3300049460 Bacteria 1952
261 Ga0501032_0009399 3300049569 Bacteria 7082
262 Ga0501032_0041169 3300049569 Bacteria 3138
263 Ga0501032_0236579 3300049569 Bacteria 1187
264 Ga0501034_0000038 3300049571 Bacteria 237795
265 Ga0501034_0000070 3300049571 Bacteria 180933
266 Ga0501034_0508489 3300049571 Bacteria 1118
267 Ga0501036_0015155 3300049572 Bacteria 6438
268 Ga0501036_0591617 3300049572 Bacteria 921
269 Ga0501037_0086742 3300049573 Bacteria 2265
270 Ga0501037_0109584 3300049573 Bacteria 1989
271 Ga0501037_0225947 3300049573 Bacteria 1315
272 Ga0501038_0101095 3300049574 Bacteria 2400
273 Ga0501038_0119493 3300049574 Bacteria 2175
274 Ga0501039_0011205 3300049575 Bacteria 6832
275 Ga0501043_0078642 3300049579 Bacteria 2591
276 Ga0501043_0240104 3300049579 Bacteria 1397
277 Ga0501067_0037451 3300049583 Bacteria 2694
278 Ga0501069_0105834 3300049585 Bacteria 1599
279 Ga0501073_0037342 3300049589 Bacteria 3450
280 Ga0501075_0198079 3300049591 Bacteria 1532
281 Ga0501075_0312890 3300049591 Bacteria 1197
282 Ga0501080_0345304 3300049742 Bacteria 1345
283 Ga0501265_015343 3300049762 Bacteria 983
284 Ga0501044_0628439 3300049823 Bacteria 965
285 nmdc:mga03683_106011_c1 3300050489 Bacteria 1239
286 nmdc:mga03n38_48861_c1 3300050490 Bacteria 1879
287 nmdc:mga00v17_41700_c1 3300050491 Bacteria 2758
288 nmdc:mga0yw44_92232_c1 3300050492 Bacteria 1917
289 nmdc:mga0k408_9809_c1 3300050493 Bacteria 5172
290 nmdc:mga06z11_28077_c1 3300050494 Bacteria 2697
291 nmdc:mga04h51_26089_c1 3300050495 Bacteria 1804
292 nmdc:mga07m45_2540_c1 3300050496 Bacteria 8572
293 Ga0495655_0065081 3300053083 Bacteria 1005
294 Ga0500618_023565 3300053125 Bacteria 1489
295 Ga0500616_0001341 3300053153 Bacteria 24116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2600254933 2600376143 223
2 iso_pu_bacteria 2816332305 2817508501 223
3 iso_pu_bacteria 8056875544 8056879760 223
4 iso_pu_bacteria 8057345674 8057349415 223
5 3300005435 Ga0070714_100116602 Ga0070714_1001166022 225
6 3300006028 Ga0070717_10085265 Ga0070717_100852654 225
7 3300013306 Ga0163162_10234806 Ga0163162_102348062 225
8 3300025929 Ga0207664_10040412 Ga0207664_100404123 225
9 3300009148 Ga0105243_10008571 Ga0105243_100085717 226
10 3300011119 Ga0105246_10239307 Ga0105246_102393072 226
11 3300031995 Ga0307409_100029816 Ga0307409_1000298163 226
12 3300009036 Ga0105244_10010864 Ga0105244_100108648 227
13 3300011119 Ga0105246_10009607 Ga0105246_100096073 227
14 3300013104 Ga0157370_10108784 Ga0157370_101087843 227
15 3300013105 Ga0157369_10119591 Ga0157369_101195912 227
16 3300013105 Ga0157369_10309602 Ga0157369_103096022 227
17 3300025303 Ga0209051_1008385 Ga0209051_10083852 227
18 3300025728 Ga0207655_1006782 Ga0207655_10067824 227
19 3300025940 Ga0207691_10344075 Ga0207691_103440752 227
20 3300031548 Ga0307408_100014809 Ga0307408_1000148092 227
21 3300031731 Ga0307405_10006523 Ga0307405_100065237 227
22 3300031731 Ga0307405_10201926 Ga0307405_102019261 227
23 3300031731 Ga0307405_10730414 Ga0307405_107304141 227
24 3300031903 Ga0307407_10578726 Ga0307407_105787261 227
25 3300031911 Ga0307412_10049928 Ga0307412_100499283 227
26 3300032002 Ga0307416_100026238 Ga0307416_1000262383 227
27 3300032002 Ga0307416_100411615 Ga0307416_1004116152 227
28 3300048925 Ga0496122_0002381 Ga0496122_0002381_16942_17655 227
29 3300048925 Ga0496122_0099615 Ga0496122_0099615_541_1248 227
30 3300048926 Ga0496123_0035917 Ga0496123_0035917_92_805 227
31 3300048926 Ga0496123_0038897 Ga0496123_0038897_806_1513 227
32 3300048928 Ga0496125_0000359 Ga0496125_0000359_69129_69836 227
33 3300049571 Ga0501034_0508489 Ga0501034_0508489_396_1082 227
34 3300053083 Ga0495655_0065081 Ga0495655_0065081_244_930 227
35 3300053125 Ga0500618_023565 Ga0500618_023565_87_794 227
36 3300053153 Ga0500616_0001341 Ga0500616_0001341_22354_23067 227
37 iso_pu_bacteria 2537561592 2537897724 227
38 iso_pu_bacteria 2885192300 2885192966 227
39 3300009176 Ga0105242_10815515 Ga0105242_108155152 228
40 3300025303 Ga0209051_1009433 Ga0209051_10094333 228
41 3300031731 Ga0307405_10265046 Ga0307405_102650462 228
42 3300031911 Ga0307412_10396112 Ga0307412_103961122 228
43 3300032002 Ga0307416_100226240 Ga0307416_1002262402 228
44 3300042122 Ga0450920_006255 Ga0450920_006255_1260_1946 228
45 3300042122 Ga0450920_013102 Ga0450920_013102_222_908 228
46 3300049569 Ga0501032_0009399 Ga0501032_0009399_1227_1913 228
47 3300049571 Ga0501034_0000038 Ga0501034_0000038_16427_17113 228
48 3300049571 Ga0501034_0000070 Ga0501034_0000070_131831_132517 228
49 3300049573 Ga0501037_0225947 Ga0501037_0225947_40_726 228
50 3300049574 Ga0501038_0119493 Ga0501038_0119493_462_1148 228
51 3300049579 Ga0501043_0078642 Ga0501043_0078642_1267_1953 228
52 3300049589 Ga0501073_0037342 Ga0501073_0037342_2018_2704 228
53 3300049823 Ga0501044_0628439 Ga0501044_0628439_111_797 228
54 iso_pu_bacteria 2738543027 2739325411 228
55 iso_pu_bacteria 2758568621 2760625877 228
56 iso_pu_bacteria 2808606366 2808877131 228
57 iso_pu_bacteria 2919391150 2919392708 228
58 3300005937 Ga0081455_10146863 Ga0081455_101468632 229
59 3300006048 Ga0075363_100019977 Ga0075363_1000199773 229
60 3300006058 Ga0075432_10043293 Ga0075432_100432932 229
61 3300006178 Ga0075367_10026268 Ga0075367_100262683 229
62 3300006195 Ga0075366_10006817 Ga0075366_100068174 229
63 3300006353 Ga0075370_10020335 Ga0075370_100203353 229
64 3300013104 Ga0157370_10329618 Ga0157370_103296181 229
65 3300027907 Ga0207428_10061018 Ga0207428_100610183 229
66 3300031548 Ga0307408_100004011 Ga0307408_1000040119 229
67 3300031548 Ga0307408_100058366 Ga0307408_1000583663 229
68 3300031731 Ga0307405_10524927 Ga0307405_105249272 229
69 3300031824 Ga0307413_10300464 Ga0307413_103004642 229
70 3300031852 Ga0307410_10070808 Ga0307410_100708083 229
71 3300031903 Ga0307407_10315331 Ga0307407_103153312 229
72 3300031911 Ga0307412_10016854 Ga0307412_100168543 229
73 3300031911 Ga0307412_10203443 Ga0307412_102034432 229
74 3300031995 Ga0307409_100131697 Ga0307409_1001316972 229
75 3300031995 Ga0307409_100164229 Ga0307409_1001642292 229
76 3300032002 Ga0307416_100182962 Ga0307416_1001829622 229
77 3300032002 Ga0307416_100459884 Ga0307416_1004598842 229
78 3300037312 Ga0395899_0008495 Ga0395899_0008495_5779_6468 229
79 3300037312 Ga0395899_0049364 Ga0395899_0049364_2124_2813 229
80 3300037418 Ga0395900_0016476 Ga0395900_0016476_5248_5937 229
81 3300037466 Ga0395898_0096044 Ga0395898_0096044_802_1491 229
82 3300037466 Ga0395898_0266865 Ga0395898_0266865_526_1215 229
83 3300042002 Ga0439442_000901 Ga0439442_000901_1532_2221 229
84 3300046499 Ga0495594_0436057 Ga0495594_0436057_26_715 229
85 3300046615 Ga0495656_0025556 Ga0495656_0025556_343_1032 229
86 3300046664 Ga0495659_0021329 Ga0495659_0021329_242_931 229
87 3300046674 Ga0495588_0053852 Ga0495588_0053852_661_1350 229
88 3300046691 Ga0495670_0001738 Ga0495670_0001738_7466_8155 229
89 3300049572 Ga0501036_0591617 Ga0501036_0591617_173_865 229
90 3300049585 Ga0501069_0105834 Ga0501069_0105834_521_1213 229
91 3300049591 Ga0501075_0198079 Ga0501075_0198079_349_1041 229
92 3300049742 Ga0501080_0345304 Ga0501080_0345304_78_770 229
93 3300050489 nmdc:mga03683_106011_c1 nmdc:mga03683_106011_c1_283_972 229
94 3300050490 nmdc:mga03n38_48861_c1 nmdc:mga03n38_48861_c1_628_1317 229
95 3300050491 nmdc:mga00v17_41700_c1 nmdc:mga00v17_41700_c1_1112_1801 229
96 3300050492 nmdc:mga0yw44_92232_c1 nmdc:mga0yw44_92232_c1_1178_1867 229
97 3300050493 nmdc:mga0k408_9809_c1 nmdc:mga0k408_9809_c1_2262_2951 229
98 3300050494 nmdc:mga06z11_28077_c1 nmdc:mga06z11_28077_c1_490_1179 229
99 3300050495 nmdc:mga04h51_26089_c1 nmdc:mga04h51_26089_c1_536_1225 229
100 3300050496 nmdc:mga07m45_2540_c1 nmdc:mga07m45_2540_c1_1606_2295 229
101 iso_pu_bacteria 2690315906 2691511916 229
102 iso_pu_bacteria 2775506735 2775657162 229
103 iso_pu_bacteria 2808606357 2808829091 229
104 iso_pu_bacteria 2808606360 2808850316 229
105 iso_pu_bacteria 2808606370 2808893330 229
106 iso_pu_bacteria 2808606371 2808898594 229
107 iso_pu_bacteria 2811994871 2812319169 229
108 iso_pu_bacteria 2857740372 2857744086 229
109 iso_pu_bacteria 2904497146 2904498884 229
110 iso_pu_bacteria 2932422444 2932425647 229
111 iso_pu_bacteria 2945920336 2945922823 229
112 iso_pu_bacteria 2945956166 2945956309 229
113 iso_pu_bacteria 2946037020 2946041484 229
114 iso_pu_bacteria 2946059875 2946060755 229
115 iso_pu_bacteria 2953998280 2954000662 229
116 iso_pu_bacteria 2953998280 2954002687 229
117 3300002773 JGI25152J39213_1002708 JGI25152J39213_10027082 230
118 3300005455 Ga0070663_100264529 Ga0070663_1002645292 230
119 3300025245 Ga0207425_1008958 Ga0207425_10089583 230
120 3300025258 Ga0209129_1000130 Ga0209129_100013078 230
121 3300025294 Ga0209025_1000364 Ga0209025_100036448 230
122 3300026067 Ga0207678_10157554 Ga0207678_101575542 230
123 3300031548 Ga0307408_100231004 Ga0307408_1002310041 230
124 3300031852 Ga0307410_10004241 Ga0307410_100042418 230
125 3300031903 Ga0307407_10101833 Ga0307407_101018332 230
126 3300031911 Ga0307412_10074361 Ga0307412_100743613 230
127 3300031995 Ga0307409_100000970 Ga0307409_1000009708 230
128 3300032002 Ga0307416_100036294 Ga0307416_1000362943 230
129 3300032126 Ga0307415_100142123 Ga0307415_1001421232 230
130 3300033179 Ga0307507_10026751 Ga0307507_100267515 230
131 3300041405 Ga0439438_049524 Ga0439438_049524_90_782 230
132 3300041411 Ga0439466_0001849 Ga0439466_0001849_6190_6882 230
133 3300041999 Ga0439433_0000174 Ga0439433_0000174_5791_6483 230
134 3300042002 Ga0439442_000737 Ga0439442_000737_2428_3120 230
135 3300042007 Ga0439449_0006701 Ga0439449_0006701_1570_2262 230
136 3300042010 Ga0439452_037082 Ga0439452_037082_386_1078 230
137 3300042015 Ga0439462_0000045 Ga0439462_0000045_13093_13785 230
138 3300042122 Ga0450920_000333 Ga0450920_000333_2929_3621 230
139 3300042146 Ga0450907_000639 Ga0450907_000639_2099_2791 230
140 3300042184 Ga0450908_006077 Ga0450908_006077_1442_2134 230
141 3300042185 Ga0450909_002347 Ga0450909_002347_1466_2158 230
142 3300042435 Ga0439434_0000834 Ga0439434_0000834_3812_4504 230
143 3300042531 Ga0450918_000695 Ga0450918_000695_1466_2158 230
144 3300046471 Ga0495650_0067221 Ga0495650_0067221_312_1016 230
145 3300046472 Ga0495580_0015753 Ga0495580_0015753_4417_5121 230
146 3300046477 Ga0495664_0057207 Ga0495664_0057207_1344_2048 230
147 3300046516 Ga0495628_0006595 Ga0495628_0006595_3165_3890 230
148 3300047319 Ga0495674_0007149 Ga0495674_0007149_6158_6862 230
149 3300047320 Ga0495672_0000920 Ga0495672_0000920_13427_14131 230
150 3300047472 Ga0495686_0000076 Ga0495686_0000076_98326_99018 230
151 3300047472 Ga0495686_0185424 Ga0495686_0185424_115_819 230
152 3300048908 Ga0496105_0165169 Ga0496105_0165169_255_947 230
153 3300048918 Ga0496115_0309429 Ga0496115_0309429_10_798 230
154 3300048929 Ga0496126_0000230 Ga0496126_0000230_103669_104436 230
155 3300049591 Ga0501075_0312890 Ga0501075_0312890_294_989 230
156 iso_pu_bacteria 2758568522 2760307629 230
157 iso_pu_bacteria 2773857921 2774846946 230
158 3300005535 Ga0070684_100155333 Ga0070684_1001553332 231
159 3300031548 Ga0307408_100328651 Ga0307408_1003286512 231
160 3300031548 Ga0307408_100387034 Ga0307408_1003870342 231
161 3300031548 Ga0307408_100647506 Ga0307408_1006475062 231
162 3300031731 Ga0307405_10049485 Ga0307405_100494853 231
163 3300031824 Ga0307413_10018039 Ga0307413_100180393 231
164 3300031852 Ga0307410_10060274 Ga0307410_100602742 231
165 3300031852 Ga0307410_10097830 Ga0307410_100978302 231
166 3300032002 Ga0307416_100183322 Ga0307416_1001833222 231
167 3300032002 Ga0307416_100390556 Ga0307416_1003905562 231
168 3300032126 Ga0307415_100412455 Ga0307415_1004124552 231
169 3300032126 Ga0307415_100613498 Ga0307415_1006134982 231
170 3300042002 Ga0439442_000251 Ga0439442_000251_7277_7972 231
171 3300042007 Ga0439449_0013166 Ga0439449_0013166_632_1327 231
172 3300042122 Ga0450920_000344 Ga0450920_000344_5095_5790 231
173 3300042146 Ga0450907_000232 Ga0450907_000232_9343_10038 231
174 3300042435 Ga0439434_0000012 Ga0439434_0000012_9283_9978 231
175 3300042531 Ga0450918_001397 Ga0450918_001397_2803_3498 231
176 3300044765 Ga0466970_0248776 Ga0466970_0248776_194_889 231
177 3300049569 Ga0501032_0041169 Ga0501032_0041169_2131_2826 231
178 3300049572 Ga0501036_0015155 Ga0501036_0015155_292_987 231
179 3300049574 Ga0501038_0101095 Ga0501038_0101095_181_876 231
180 3300049575 Ga0501039_0011205 Ga0501039_0011205_1870_2565 231
181 3300049579 Ga0501043_0240104 Ga0501043_0240104_290_985 231
182 3300049583 Ga0501067_0037451 Ga0501067_0037451_749_1447 231
183 iso_pu_bacteria 2808606394 2809030896 231
184 iso_pu_bacteria 2900634093 2900638624 231
185 iso_pu_bacteria 642555113 642615406 231
186 3300031548 Ga0307408_100018230 Ga0307408_1000182302 232
187 3300031548 Ga0307408_100064202 Ga0307408_1000642023 232
188 3300031548 Ga0307408_100219799 Ga0307408_1002197992 232
189 3300031731 Ga0307405_10000995 Ga0307405_100009959 232
190 3300031731 Ga0307405_10009328 Ga0307405_100093285 232
191 3300031824 Ga0307413_10013606 Ga0307413_100136062 232
192 3300031824 Ga0307413_10038233 Ga0307413_100382333 232
193 3300031824 Ga0307413_10199297 Ga0307413_101992971 232
194 3300031852 Ga0307410_10172370 Ga0307410_101723702 232
195 3300031903 Ga0307407_10019788 Ga0307407_100197883 232
196 3300031911 Ga0307412_10005817 Ga0307412_100058175 232
197 3300031911 Ga0307412_10029237 Ga0307412_100292373 232
198 3300031911 Ga0307412_10049274 Ga0307412_100492742 232
199 3300031911 Ga0307412_10654912 Ga0307412_106549122 232
200 3300031995 Ga0307409_100196182 Ga0307409_1001961823 232
201 3300031995 Ga0307409_100303920 Ga0307409_1003039202 232
202 3300032005 Ga0307411_10059965 Ga0307411_100599653 232
203 3300035116 Ga0373945_0103993 Ga0373945_0103993_214_912 232
204 3300035170 Ga0373943_0025233 Ga0373943_0025233_700_1398 232
205 3300035692 Ga0373935_0025775 Ga0373935_0025775_2381_3079 232
206 3300035695 Ga0373927_0144616 Ga0373927_0144616_184_882 232
207 3300035724 Ga0373933_0383276 Ga0373933_0383276_195_893 232
208 3300035725 Ga0373947_0102234 Ga0373947_0102234_413_1111 232
209 3300037068 Ga0373925_0129614 Ga0373925_0129614_811_1509 232
210 3300037853 Ga0436364_0220245 Ga0436364_0220245_650_1351 232
211 3300048906 Ga0496103_0022626 Ga0496103_0022626_2190_2888 232
212 3300048911 Ga0496108_0153818 Ga0496108_0153818_271_969 232
213 3300005543 Ga0070672_100252331 Ga0070672_1002523312 233
214 3300006846 Ga0075430_100348992 Ga0075430_1003489922 233
215 3300025940 Ga0207691_10248845 Ga0207691_102488452 233
216 3300031548 Ga0307408_100110060 Ga0307408_1001100602 233
217 3300031548 Ga0307408_100135344 Ga0307408_1001353442 233
218 3300031548 Ga0307408_100201876 Ga0307408_1002018762 233
219 3300031548 Ga0307408_100330784 Ga0307408_1003307842 233
220 3300031548 Ga0307408_100365014 Ga0307408_1003650142 233
221 3300031731 Ga0307405_10020827 Ga0307405_100208272 233
222 3300031731 Ga0307405_10371958 Ga0307405_103719582 233
223 3300031731 Ga0307405_10649505 Ga0307405_106495052 233
224 3300031824 Ga0307413_10033517 Ga0307413_100335174 233
225 3300031824 Ga0307413_10070642 Ga0307413_100706423 233
226 3300031852 Ga0307410_10087743 Ga0307410_100877432 233
227 3300031852 Ga0307410_10357685 Ga0307410_103576851 233
228 3300031852 Ga0307410_10390034 Ga0307410_103900342 233
229 3300031901 Ga0307406_10022234 Ga0307406_100222341 233
230 3300031901 Ga0307406_10116881 Ga0307406_101168813 233
231 3300031903 Ga0307407_10049194 Ga0307407_100491942 233
232 3300031903 Ga0307407_10115531 Ga0307407_101155312 233
233 3300031911 Ga0307412_10007813 Ga0307412_100078133 233
234 3300031911 Ga0307412_10023185 Ga0307412_100231854 233
235 3300031995 Ga0307409_100465529 Ga0307409_1004655292 233
236 3300031995 Ga0307409_100954595 Ga0307409_1009545952 233
237 3300032002 Ga0307416_100023739 Ga0307416_1000237393 233
238 3300032002 Ga0307416_100120770 Ga0307416_1001207703 233
239 3300032002 Ga0307416_100205136 Ga0307416_1002051363 233
240 3300032126 Ga0307415_100065651 Ga0307415_1000656513 233
241 3300032126 Ga0307415_100125818 Ga0307415_1001258182 233
242 3300038443 Ga0395901_0179363 Ga0395901_0179363_266_970 233
243 3300041999 Ga0439433_0018526 Ga0439433_0018526_641_1342 233
244 3300042015 Ga0439462_0006710 Ga0439462_0006710_722_1423 233
245 3300046472 Ga0495580_0027418 Ga0495580_0027418_1629_2330 233
246 3300046475 Ga0495639_0079665 Ga0495639_0079665_424_1125 233
247 3300046477 Ga0495664_0011390 Ga0495664_0011390_3117_3818 233
248 3300046517 Ga0495630_0149902 Ga0495630_0149902_369_1070 233
249 3300046531 Ga0495665_0000160 Ga0495665_0000160_28539_29240 233
250 3300046535 Ga0495586_0000286 Ga0495586_0000286_2579_3280 233
251 3300046536 Ga0495587_0006877 Ga0495587_0006877_4336_5037 233
252 3300046543 Ga0495645_0000355 Ga0495645_0000355_21642_22343 233
253 3300046559 Ga0495667_0003756 Ga0495667_0003756_4126_4827 233
254 3300046663 Ga0495635_0246326 Ga0495635_0246326_307_1008 233
255 3300046675 Ga0495657_0064553 Ga0495657_0064553_1271_1972 233
256 3300047317 Ga0495604_0313889 Ga0495604_0313889_188_889 233
257 3300047444 Ga0495675_0015726 Ga0495675_0015726_2265_2966 233
258 3300048906 Ga0496103_0079022 Ga0496103_0079022_172_873 233
259 3300048908 Ga0496105_0166113 Ga0496105_0166113_1066_1767 233
260 3300048910 Ga0496107_0002875 Ga0496107_0002875_10518_11219 233
261 3300048912 Ga0496109_0201582 Ga0496109_0201582_338_1039 233
262 3300048915 Ga0496112_0146128 Ga0496112_0146128_91_792 233
263 3300048927 Ga0496124_0005966 Ga0496124_0005966_2168_2869 233
264 3300048928 Ga0496125_0004558 Ga0496125_0004558_9791_10492 233
265 3300048929 Ga0496126_0051346 Ga0496126_0051346_2416_3117 233
266 3300049569 Ga0501032_0236579 Ga0501032_0236579_215_916 233
267 3300049573 Ga0501037_0086742 Ga0501037_0086742_1551_2255 233
268 3300049573 Ga0501037_0109584 Ga0501037_0109584_201_902 233
269 3300049762 Ga0501265_015343 Ga0501265_015343_156_857 233
270 3300003775 Ga0055524_1000331 Ga0055524_100033130 234
271 3300003784 Ga0055534_1000031 Ga0055534_100003133 234
272 3300005563 Ga0068855_100095534 Ga0068855_1000955345 234
273 3300013297 Ga0157378_10046693 Ga0157378_100466934 234
274 3300025263 Ga0209565_1000072 Ga0209565_100007272 234
275 3300025273 Ga0209673_1057566 Ga0209673_10575661 234
276 3300025291 Ga0209675_1000049 Ga0209675_1000049110 234
277 3300025295 Ga0209564_1000130 Ga0209564_100013071 234
278 3300025299 Ga0209256_1000126 Ga0209256_100012671 234
279 3300025949 Ga0207667_10245779 Ga0207667_102457792 234
280 3300031824 Ga0307413_10338520 Ga0307413_103385201 234
281 3300037418 Ga0395900_0096684 Ga0395900_0096684_530_1237 234
282 3300037466 Ga0395898_0130992 Ga0395898_0130992_1164_1871 234
283 3300038443 Ga0395901_0329005 Ga0395901_0329005_500_1207 234
284 3300047472 Ga0495686_0045230 Ga0495686_0045230_1342_2046 234
285 3300002705 JGI25156J39149_1000401 JGI25156J39149_10004014 235
286 3300005367 Ga0070667_100277958 Ga0070667_1002779582 235
287 3300025256 Ga0209759_1000077 Ga0209759_1000077152 235
288 3300025986 Ga0207658_10038677 Ga0207658_100386773 235
289 3300046457 Ga0495590_0005675 Ga0495590_0005675_2897_3604 235
290 3300046459 Ga0495629_0000020 Ga0495629_0000020_9836_10543 235
291 3300046462 Ga0495651_0041927 Ga0495651_0041927_2144_2851 235
292 3300046463 Ga0495653_0000663 Ga0495653_0000663_19620_20327 235
293 3300046471 Ga0495650_0019170 Ga0495650_0019170_2266_2973 235
294 3300046473 Ga0495582_0207239 Ga0495582_0207239_218_925 235
295 3300046474 Ga0495605_0021619 Ga0495605_0021619_1856_2563 235
296 3300046506 Ga0495583_0002745 Ga0495583_0002745_9341_10048 235
297 3300046507 Ga0495606_0020305 Ga0495606_0020305_1583_2290 235
298 3300046515 Ga0495620_0002288 Ga0495620_0002288_10256_10963 235
299 3300046516 Ga0495628_0050116 Ga0495628_0050116_1937_2644 235
300 3300046524 Ga0495648_0053599 Ga0495648_0053599_276_983 235
301 3300046526 Ga0495666_0057972 Ga0495666_0057972_897_1604 235
302 3300046531 Ga0495665_0095692 Ga0495665_0095692_533_1240 235
303 3300046538 Ga0495609_0042309 Ga0495609_0042309_532_1239 235
304 3300046678 Ga0495599_0043186 Ga0495599_0043186_1456_2163 235
305 3300046679 Ga0495623_0005123 Ga0495623_0005123_1848_2555 235
306 3300046689 Ga0495613_0056940 Ga0495613_0056940_1317_2024 235
307 3300046690 Ga0495624_0014241 Ga0495624_0014241_2976_3683 235
308 3300046692 Ga0495671_0018131 Ga0495671_0018131_2677_3384 235
309 3300046694 Ga0495649_0154487 Ga0495649_0154487_204_911 235
310 3300046794 Ga0495589_0056703 Ga0495589_0056703_268_975 235
311 3300046809 Ga0495600_0254411 Ga0495600_0254411_251_958 235
312 3300047317 Ga0495604_0002712 Ga0495604_0002712_11320_12027 235
313 3300047319 Ga0495674_0119487 Ga0495674_0119487_62_769 235
314 3300047320 Ga0495672_0053630 Ga0495672_0053630_209_916 235
315 3300047321 Ga0495676_0053099 Ga0495676_0053099_1778_2485 235
316 3300047322 Ga0495680_0059326 Ga0495680_0059326_665_1372 235
317 3300047323 Ga0495683_0012312 Ga0495683_0012312_3017_3724 235
318 3300047444 Ga0495675_0019065 Ga0495675_0019065_1609_2316 235
319 3300047446 Ga0495679_000144 Ga0495679_000144_50922_51629 235
320 3300047472 Ga0495686_0105559 Ga0495686_0105559_421_1128 235
321 3300048088 Ga0495602_0105782 Ga0495602_0105782_1456_2163 235
322 3300048091 Ga0495626_0018154 Ga0495626_0018154_1858_2565 235
323 3300048919 Ga0496116_0042557 Ga0496116_0042557_570_1277 235
324 3300048921 Ga0496118_0054950 Ga0496118_0054950_299_1006 235
325 3300048924 Ga0496121_0025753 Ga0496121_0025753_3345_4052 235
326 3300049460 Ga0495682_0031717 Ga0495682_0031717_327_1034 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

218

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rrl-assembly1.cif.gz_A complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695 0.9705 3 219
4kgb-assembly1.cif.gz_B structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.9675 4 219
3cdk-assembly1.cif.gz_C crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.9673 3 221
4kgb-assembly1.cif.gz_A structure of succinyl-coa: 3-ketoacid coa transferase from drosophila melanogaster 0.967 4 219
3dlx-assembly1.cif.gz_B crystal structure of human 3-oxoacid coa transferase 1 0.9661 4 218
ID Description Score Start End Superfamily
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9646 3 219 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9576 4 219 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9559 3 219 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.955 2 221 3.40.1080.10
af_Q4E2P8_5_264_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9484 2 219 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A0K8QCL8-F1-model_v4 3-oxoadipate CoA-transferase subunit A 0.9951 147 219 GO:0008410
AF-A0A1Y3LAV9-F1-model_v4 3-oxoadipate CoA-transferase (EC 2.8.3.6) 0.9943 1 219 GO:0042952
GO:0047569
AF-A0A8B0S3F2-F1-model_v4 deleted 0.994 1 219
AF-D4GN25-F1-model_v4 PcaI 0.9939 1 221 GO:0008410
AF-A0A7X9X574-F1-model_v4 3-oxoacid CoA-transferase subunit A 0.9937 1 218 GO:0008410

Feature Viewer

pLDDT pTM Quality
90.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map