F408283

General Info

Members Datasets Scaffolds Average Seq Length
326 234 273 310

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10009873|Ga0105243_100098733
Length 361
Sequence MKWRPLGSTWMEKPASCGAVAVIGILRGELFAGRTKPCEQLNWDRNRILPSINSPSGALPARFRRERLLIVGCGDVGQRVARDLRGRMQLVALTSSADRVGALRAAGIRPLAGNLDDAATLHRLAGIATRVLHLAPPARDGGAAWWRDQRTTELARALRLRSLPSAFVYGSTSGVYGDCGGARVDETRGVRPDTPRSHRRVDAERAVRWLGRSAGVRASILRIPGIYAPDRENGTPRGRLQRGTPVLRREDDVYTSHIHADDLARACIAALFRGKPQRIVHASDDTELRMGDYVDLAADLYGMPRPPRVARGDAERQLPLQLLSFMGESRRLDNTRLKRELRVRLAHPTVHTGLREQTEPR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2643221717 Acidovorax sp. Root267 Isolate Unclassified
18 2721755523 Delftia sp. HK171 Isolate Unclassified
19 2738541277 Variovorax sp. GV051 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
28 2842733646 Variovorax sp. R-72446 Isolate Unclassified
29 2842747753 Variovorax sp. R-72060 Isolate Unclassified
30 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
31 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
32 2885198086 Variovorax sp. 679 Isolate Unclassified
33 2885211737 Variovorax sp. 553 Isolate Unclassified
34 2899924645 Variovorax sp. 369 Isolate Unclassified
35 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
36 2904456579 Variovorax sp. 2002 Isolate Unclassified
37 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
38 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
39 2928037797 Variovorax sp. 1126 Isolate Unclassified
40 2928044640 Variovorax sp. 1128 Isolate Unclassified
41 2928051484 Variovorax sp. 1133 Isolate Unclassified
42 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
43 2928070936 Variovorax gossypii 1167 Isolate Unclassified
44 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2929520902 Variovorax beijingensis 502 Isolate Unclassified
47 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
48 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
49 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
50 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
51 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
52 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
53 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
54 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
101 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
125 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
126 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
127 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
150 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
151 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
152 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
153 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
160 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
161 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
162 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
163 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
166 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
167 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
221 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.74
Metatranscriptomes 0
Isolates 16.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.17
Nodule 3.07
Rhizoplane 4.6
Rhizosphere 52.76
Stem 0
Stem Tuber 0
Unclassified 18.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1010392 3300002987 Bacteria 2371
2 JGI25151J46595_10004441 3300003187 Bacteria 7424
3 rootH1_10033343 3300003316 Bacteria 2033
4 Ga0055537_1000134 3300003773 Bacteria 56046
5 Ga0055536_1004046 3300003781 Bacteria 7636
6 Ga0055536_1004595 3300003781 Bacteria 6997
7 Ga0055536_1005794 3300003781 Bacteria 5951
8 Ga0055534_1000088 3300003784 Bacteria 72004
9 Ga0055528_1000630 3300003790 Bacteria 26033
10 Ga0055530_10000962 3300003791 Bacteria 23389
11 Ga0055540_1003193 3300003792 Bacteria 8057
12 Ga0055540_1003446 3300003792 Bacteria 7640
13 Ga0055540_1003915 3300003792 Bacteria 6977
14 Ga0055540_1010504 3300003792 Bacteria 3075
15 Ga0055531_10002924 3300003794 Bacteria 11120
16 Ga0055531_10017143 3300003794 Bacteria 3075
17 Ga0070658_10056540 3300005327 Bacteria 3189
18 Ga0070658_10057385 3300005327 Bacteria 3167
19 Ga0068869_100048359 3300005334 Bacteria 3075
20 Ga0070661_100001209 3300005344 Bacteria 18186
21 Ga0070669_100051332 3300005353 Bacteria 3014
22 Ga0070674_100052553 3300005356 Bacteria 2811
23 Ga0070663_100000774 3300005455 Bacteria 17411
24 Ga0070662_100007874 3300005457 Bacteria 6923
25 Ga0070665_100445119 3300005548 Bacteria 1305
26 Ga0068855_100217592 3300005563 Bacteria 2144
27 Ga0068866_10044406 3300005718 Bacteria 2223
28 Ga0068862_100014783 3300005844 Bacteria 6483
29 Ga0075365_10006046 3300006038 Bacteria 6610
30 Ga0075363_100085926 3300006048 Bacteria 1726
31 Ga0075364_10043582 3300006051 Bacteria 2918
32 Ga0075362_10027041 3300006177 Bacteria 2454
33 Ga0075366_10209811 3300006195 Bacteria 1185
34 Ga0075370_10002395 3300006353 Bacteria 8682
35 Ga0075370_10015852 3300006353 Bacteria 4044
36 Ga0075370_10034773 3300006353 Bacteria 2825
37 Ga0075370_10041742 3300006353 Bacteria 2590
38 Ga0075370_10051530 3300006353 Bacteria 2335
39 Ga0075370_10134326 3300006353 Bacteria 1445
40 Ga0079104_1000003 3300006946 Bacteria 468966
41 Ga0079104_1020990 3300006946 Bacteria 1786
42 Ga0099826_10000018 3300006948 Bacteria 198330
43 Ga0099826_10001370 3300006948 Bacteria 14497
44 Ga0099826_10136696 3300006948 Bacteria 1422
45 Ga0105251_10036365 3300009011 Bacteria 2424
46 Ga0105250_10004976 3300009092 Bacteria 6025
47 Ga0105243_10006758 3300009148 Bacteria 8850
48 Ga0105243_10009873 3300009148 Bacteria 7260
49 Ga0105243_10159691 3300009148 Bacteria 1942
50 Ga0105242_10000453 3300009176 Bacteria 32663
51 Ga0105237_10079879 3300009545 Bacteria 3261
52 Ga0105238_10244427 3300009551 Bacteria 1772
53 Ga0105239_10264654 3300010375 Bacteria 1933
54 Ga0105246_10136704 3300011119 Bacteria 1838
55 Ga0157373_10016632 3300013100 Bacteria 5361
56 Ga0157373_10037888 3300013100 Bacteria 3455
57 Ga0157375_10077575 3300013308 Bacteria 3353
58 Ga0157375_10158919 3300013308 Bacteria 2401
59 Ga0182008_10000215 3300014497 Bacteria 45361
60 Ga0182008_10002427 3300014497 Bacteria 11696
61 Ga0182008_10006865 3300014497 Bacteria 6333
62 Ga0157379_10140126 3300014968 Bacteria 2180
63 Ga0182006_1001570 3300015261 Bacteria 13642
64 Ga0182007_10001908 3300015262 Bacteria 10838
65 Ga0182007_10003300 3300015262 Bacteria 7652
66 Ga0183362_10005 3300015683 Bacteria 437616
67 Ga0163161_10006815 3300017792 Bacteria 7900
68 Ga0163161_10011660 3300017792 Bacteria 6100
69 Ga0163161_10086621 3300017792 Bacteria 2312
70 Ga0163161_10107920 3300017792 Bacteria 2078
71 Ga0163161_10192237 3300017792 Bacteria 1570
72 Ga0213872_10002681 3300021361 Bacteria 10298
73 Ga0209129_1001116 3300025258 Bacteria 15622
74 Ga0209565_1000046 3300025263 Bacteria 226073
75 Ga0209673_1000058 3300025273 Bacteria 269028
76 Ga0209130_1003501 3300025284 Bacteria 6597
77 Ga0209675_1000010 3300025291 Bacteria 541927
78 Ga0209675_1005746 3300025291 Bacteria 5118
79 Ga0209676_1000098 3300025292 Bacteria 234305
80 Ga0209676_1000173 3300025292 Bacteria 153411
81 Ga0209676_1020024 3300025292 Bacteria 2285
82 Ga0209025_1000122 3300025294 Bacteria 206064
83 Ga0209025_1012938 3300025294 Bacteria 5293
84 Ga0209025_1061019 3300025294 Bacteria 1410
85 Ga0209050_1000554 3300025298 Bacteria 61514
86 Ga0209050_1005757 3300025298 Bacteria 7642
87 Ga0209051_1000159 3300025303 Bacteria 126836
88 Ga0209051_1000282 3300025303 Bacteria 82787
89 Ga0209051_1000597 3300025303 Bacteria 42565
90 Ga0209257_1004288 3300025304 Bacteria 11233
91 Ga0209257_1008289 3300025304 Bacteria 5960
92 Ga0207655_1002725 3300025728 Bacteria 13806
93 Ga0207705_10206256 3300025909 Bacteria 1490
94 Ga0207671_10066936 3300025914 Bacteria 2674
95 Ga0207709_10000032 3300025935 Bacteria 324478
96 Ga0207709_10000285 3300025935 Bacteria 57630
97 Ga0207709_10004960 3300025935 Bacteria 7618
98 Ga0207709_10259102 3300025935 Bacteria 1274
99 Ga0207679_10147488 3300025945 Bacteria 1910
100 Ga0207639_10127323 3300026041 Bacteria 2102
101 Ga0207639_10143263 3300026041 Bacteria 1994
102 Ga0207678_10000966 3300026067 Bacteria 26297
103 Ga0207683_10091590 3300026121 Bacteria 2708
104 Ga0207683_10278309 3300026121 Bacteria 1529
105 Ga0209281_1000002 3300027111 Bacteria 1924012
106 Ga0209281_1008444 3300027111 Bacteria 2500
107 Ga0209282_1000052 3300027666 Bacteria 104317
108 Ga0209282_1058694 3300027666 Bacteria 2156
109 Ga0209966_1000074 3300027695 Bacteria 43833
110 Ga0209998_10024201 3300027717 Bacteria 1316
111 Ga0268265_10020589 3300028380 Bacteria 4605
112 Ga0307515_10000040 3300028794 Bacteria 322704
113 Ga0307515_10000084 3300028794 Bacteria 221434
114 Ga0316177_1112288 3300030731 Bacteria 3326
115 Ga0316179_1021560 3300030734 Bacteria 3244
116 Ga0316178_1115282 3300030735 Bacteria 1894
117 Ga0316180_1114504 3300030736 Bacteria 2393
118 Ga0316183_1017668 3300030742 Bacteria 4244
119 Ga0316181_1024157 3300030744 Bacteria 1881
120 Ga0265330_10035666 3300031235 Bacteria 2218
121 Ga0265327_10077123 3300031251 Bacteria 1654
122 Ga0307408_100000163 3300031548 Bacteria 73974
123 Ga0307514_10001454 3300031649 Bacteria 28895
124 Ga0307514_10004257 3300031649 Bacteria 13227
125 Ga0307514_10009122 3300031649 Bacteria 8372
126 Ga0265314_10001065 3300031711 Bacteria 31865
127 Ga0307405_10027631 3300031731 Bacteria 3292
128 Ga0307405_10195424 3300031731 Bacteria 1464
129 Ga0307405_10276619 3300031731 Bacteria 1261
130 Ga0307406_10000827 3300031901 Bacteria 17399
131 Ga0307406_10001422 3300031901 Bacteria 13270
132 Ga0307406_10027909 3300031901 Bacteria 3406
133 Ga0307406_10164419 3300031901 Bacteria 1599
134 Ga0307412_10045307 3300031911 Bacteria 2874
135 Ga0307412_10230950 3300031911 Bacteria 1424
136 Ga0307416_100421546 3300032002 Bacteria 1379
137 Ga0307411_10105205 3300032005 Bacteria 2006
138 Ga0373931_0001877 3300035691 Bacteria 9171
139 Ga0395900_0000947 3300037418 Bacteria 37852
140 Ga0395900_0021862 3300037418 Bacteria 6540
141 Ga0395898_0019705 3300037466 Bacteria 6861
142 Ga0395905_0009989 3300037471 Bacteria 9251
143 Ga0395905_0131117 3300037471 Bacteria 2357
144 Ga0395905_0553562 3300037471 Bacteria 1051
145 Ga0395905_0652514 3300037471 Bacteria 954
146 Ga0436361_0233191 3300039447 Bacteria 3712
147 Ga0436361_0791332 3300039447 Bacteria 14502
148 Ga0439436_0000382 3300041404 Bacteria 11010
149 Ga0439436_0007890 3300041404 Bacteria 3269
150 Ga0439436_0062276 3300041404 Bacteria 1044
151 Ga0439438_019873 3300041405 Bacteria 1892
152 Ga0439439_0008626 3300041406 Bacteria 2411
153 Ga0439466_0001231 3300041411 Bacteria 9960
154 Ga0451797_1425456 3300041453 Bacteria 958
155 Ga0439431_0002185 3300041997 Bacteria 4313
156 Ga0439431_0042415 3300041997 Bacteria 1162
157 Ga0439433_0008293 3300041999 Bacteria 2250
158 Ga0439445_0000223 3300042004 Bacteria 10550
159 Ga0439432_000760 3300042006 Bacteria 12070
160 Ga0439449_0000209 3300042007 Bacteria 20674
161 Ga0439449_0001293 3300042007 Bacteria 9802
162 Ga0439449_0009346 3300042007 Bacteria 3716
163 Ga0439452_019246 3300042010 Bacteria 1808
164 Ga0439455_0015989 3300042012 Bacteria 1731
165 Ga0439457_003028 3300042014 Bacteria 4666
166 Ga0439462_0004857 3300042015 Bacteria 3298
167 Ga0439462_0006045 3300042015 Bacteria 2997
168 Ga0450897_000798 3300042128 Bacteria 1910
169 Ga0450896_001023 3300042133 Bacteria 3270
170 Ga0450899_010210 3300042135 Bacteria 1041
171 Ga0450906_002150 3300042145 Bacteria 4311
172 Ga0450910_014791 3300042147 Bacteria 1144
173 Ga0439446_0008003 3300042156 Bacteria 2793
174 Ga0450908_016499 3300042184 Bacteria 1317
175 Ga0450909_001630 3300042185 Bacteria 3136
176 Ga0439434_0013180 3300042435 Bacteria 2452
177 Ga0451577_0000166 3300042876 Bacteria 145166
178 Ga0451577_0031882 3300042876 Bacteria 4752
179 Ga0466972_0001085 3300044658 Bacteria 13048
180 Ga0453683_0067387 3300044673 Bacteria 2238
181 Ga0466965_0006409 3300044683 Bacteria 5343
182 Ga0466965_0021682 3300044683 Bacteria 3094
183 Ga0453684_0000187 3300044712 Bacteria 272378
184 Ga0453684_0063411 3300044712 Bacteria 4727
185 Ga0466957_0093821 3300044842 Bacteria 1884
186 Ga0451576_0001582 3300045051 Bacteria 38269
187 Ga0451576_0001766 3300045051 Bacteria 35473
188 Ga0451576_0033049 3300045051 Bacteria 5500
189 Ga0495627_009143 3300046453 Bacteria 3658
190 Ga0495605_0086801 3300046474 Bacteria 1455
191 Ga0495639_0129971 3300046475 Bacteria 1205
192 Ga0495584_0029295 3300046491 Bacteria 2790
193 Ga0495596_0012021 3300046500 Bacteria 3715
194 Ga0495607_0027544 3300046501 Bacteria 3512
195 Ga0495610_0006580 3300046512 Bacteria 7942
196 Ga0495610_0023490 3300046512 Bacteria 3350
197 Ga0495616_0019277 3300046513 Bacteria 3724
198 Ga0495620_0046818 3300046515 Bacteria 1865
199 Ga0495631_0013618 3300046518 Bacteria 3943
200 Ga0495637_0001872 3300046520 Bacteria 12011
201 Ga0495654_0137757 3300046530 Bacteria 1090
202 Ga0495609_0024525 3300046538 Bacteria 2766
203 Ga0495645_0300868 3300046543 Bacteria 1048
204 Ga0495656_0000087 3300046615 Bacteria 40520
205 Ga0495656_0034907 3300046615 Bacteria 2063
206 Ga0495625_0000245 3300046660 Bacteria 85443
207 Ga0495625_0090850 3300046660 Bacteria 2111
208 Ga0495635_0406642 3300046663 Bacteria 904
209 Ga0495661_0001291 3300046665 Bacteria 21427
210 Ga0495661_0065981 3300046665 Bacteria 2131
211 Ga0495588_0070231 3300046674 Bacteria 1820
212 Ga0495671_0056086 3300046692 Bacteria 1950
213 Ga0495649_0060352 3300046694 Bacteria 2040
214 Ga0495589_0114736 3300046794 Bacteria 1299
215 Ga0495672_0071769 3300047320 Bacteria 1958
216 Ga0495685_029400 3300047447 Bacteria 1889
217 Ga0495681_0001112 3300047470 Bacteria 20391
218 Ga0496100_0033638 3300048903 Bacteria 3209
219 Ga0496101_0006112 3300048904 Bacteria 7732
220 Ga0496103_0005799 3300048906 Bacteria 7375
221 Ga0496104_0005753 3300048907 Bacteria 10852
222 Ga0496105_0118560 3300048908 Bacteria 2183
223 Ga0496106_0108110 3300048909 Bacteria 2163
224 Ga0496108_0664927 3300048911 Bacteria 905
225 Ga0496110_0083045 3300048913 Bacteria 2857
226 Ga0496111_0103348 3300048914 Bacteria 2095
227 Ga0496113_0231709 3300048916 Bacteria 1473
228 Ga0496113_0414566 3300048916 Bacteria 1082
229 Ga0496116_0014094 3300048919 Bacteria 6402
230 Ga0496116_0067529 3300048919 Bacteria 2283
231 Ga0496117_0028471 3300048920 Bacteria 4326
232 Ga0496117_0097041 3300048920 Bacteria 1878
233 Ga0496117_0099098 3300048920 Bacteria 1850
234 Ga0496118_0068993 3300048921 Bacteria 2563
235 Ga0496121_0134346 3300048924 Bacteria 1845
236 Ga0496122_0000063 3300048925 Bacteria 241378
237 Ga0496122_0092053 3300048925 Bacteria 2062
238 Ga0496122_0196253 3300048925 Bacteria 1185
239 Ga0496123_0000045 3300048926 Bacteria 249294
240 Ga0496123_0067447 3300048926 Bacteria 2259
241 Ga0496123_0091147 3300048926 Bacteria 1809
242 Ga0496124_0112944 3300048927 Bacteria 2184
243 Ga0496124_0149473 3300048927 Bacteria 1834
244 Ga0496125_0018461 3300048928 Bacteria 6624
245 Ga0496125_0106147 3300048928 Bacteria 2051
246 Ga0496126_0033593 3300048929 Bacteria 4824
247 Ga0496126_0253852 3300048929 Bacteria 1464
248 Ga0501034_0358414 3300049571 Bacteria 1386
249 Ga0501265_000479 3300049762 Bacteria 4215
250 Ga0501266_000388 3300049763 Bacteria 5898
251 nmdc:mga03683_26711_c1 3300050489 Bacteria 2280
252 nmdc:mga03n38_73271_c1 3300050490 Bacteria 1590
253 nmdc:mga03n38_8091_c2 3300050490 Bacteria 3383
254 nmdc:mga00v17_34157_c1 3300050491 Bacteria 3018
255 nmdc:mga00v17_80267_c1 3300050491 Bacteria 2036
256 nmdc:mga0yw44_11043_c1 3300050492 Bacteria 4640
257 nmdc:mga0yw44_12112_c1 3300050492 Bacteria 4483
258 nmdc:mga0k408_11327_c1 3300050493 Bacteria 4853
259 nmdc:mga0k408_120722_c1 3300050493 Bacteria 1552
260 nmdc:mga0k408_14507_c1 3300050493 Bacteria 4344
261 nmdc:mga0k408_22756_c2 3300050493 Bacteria 3085
262 nmdc:mga0k408_9437_c1 3300050493 Bacteria 5257
263 nmdc:mga06z11_109462_c1 3300050494 Bacteria 1528
264 nmdc:mga06z11_149577_c1 3300050494 Bacteria 1326
265 nmdc:mga06z11_48007_c1 3300050494 Bacteria 2171
266 nmdc:mga07m45_2078_c1 3300050496 Bacteria 9300
267 nmdc:mga07m45_2521_c1 3300050496 Bacteria 8595
268 nmdc:mga0sz30_57946_c1 3300050516 Bacteria 1651
269 Ga0500610_0003003 3300053079 Bacteria 6366
270 Ga0500594_0020515 3300053118 Bacteria 1650
271 Ga0500607_004599 3300053121 Bacteria 9423
272 Ga0500627_0001087 3300053158 Bacteria 7417
273 Ga0500634_0017015 3300053161 Bacteria 3888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_1425456 Ga0451797_1425456_177_914 244
2 iso_pu_bacteria 2643221570 2643868675 264
3 iso_pu_bacteria 2643221652 2644295804 264
4 iso_pu_bacteria 2885192300 2885194767 264
5 3300046615 Ga0495656_0000087 Ga0495656_0000087_5969_6772 267
6 3300041404 Ga0439436_0000382 Ga0439436_0000382_3402_4208 268
7 3300041411 Ga0439466_0001231 Ga0439466_0001231_1608_2414 268
8 3300041997 Ga0439431_0002185 Ga0439431_0002185_505_1311 268
9 3300041997 Ga0439431_0042415 Ga0439431_0042415_344_1150 268
10 3300041999 Ga0439433_0008293 Ga0439433_0008293_890_1696 268
11 3300042004 Ga0439445_0000223 Ga0439445_0000223_6761_7567 268
12 3300042006 Ga0439432_000760 Ga0439432_000760_2493_3299 268
13 3300042007 Ga0439449_0000209 Ga0439449_0000209_9269_10075 268
14 3300042010 Ga0439452_019246 Ga0439452_019246_354_1160 268
15 3300042014 Ga0439457_003028 Ga0439457_003028_1807_2613 268
16 3300042015 Ga0439462_0004857 Ga0439462_0004857_591_1397 268
17 3300042156 Ga0439446_0008003 Ga0439446_0008003_952_1758 268
18 3300046663 Ga0495635_0406642 Ga0495635_0406642_20_832 269
19 3300046530 Ga0495654_0137757 Ga0495654_0137757_262_1074 270
20 3300048911 Ga0496108_0664927 Ga0496108_0664927_12_830 272
21 iso_pu_bacteria 2738543013 2739248074 277
22 3300014497 Ga0182008_10002427 Ga0182008_100024275 279
23 3300015262 Ga0182007_10001908 Ga0182007_100019084 279
24 3300046475 Ga0495639_0129971 Ga0495639_0129971_11_853 279
25 3300005718 Ga0068866_10044406 Ga0068866_100444062 280
26 3300005334 Ga0068869_100048359 Ga0068869_1000483593 281
27 3300028794 Ga0307515_10000084 Ga0307515_1000008441 285
28 3300031649 Ga0307514_10001454 Ga0307514_1000145419 285
29 3300006195 Ga0075366_10209811 Ga0075366_102098112 286
30 3300006353 Ga0075370_10041742 Ga0075370_100417422 286
31 3300013308 Ga0157375_10077575 Ga0157375_100775753 289
32 3300014968 Ga0157379_10140126 Ga0157379_101401262 289
33 3300046543 Ga0495645_0300868 Ga0495645_0300868_135_1007 289
34 3300046615 Ga0495656_0034907 Ga0495656_0034907_814_1686 289
35 3300048903 Ga0496100_0033638 Ga0496100_0033638_503_1375 289
36 3300048904 Ga0496101_0006112 Ga0496101_0006112_3061_3933 289
37 3300048906 Ga0496103_0005799 Ga0496103_0005799_4449_5321 289
38 3300048907 Ga0496104_0005753 Ga0496104_0005753_2496_3368 289
39 3300048908 Ga0496105_0118560 Ga0496105_0118560_376_1248 289
40 3300048909 Ga0496106_0108110 Ga0496106_0108110_503_1375 289
41 3300048914 Ga0496111_0103348 Ga0496111_0103348_893_1765 289
42 3300003316 rootH1_10033343 rootH1_100333432 290
43 3300005327 Ga0070658_10056540 Ga0070658_100565405 290
44 3300005353 Ga0070669_100051332 Ga0070669_1000513322 290
45 3300005563 Ga0068855_100217592 Ga0068855_1002175921 290
46 3300013308 Ga0157375_10158919 Ga0157375_101589192 290
47 3300010375 Ga0105239_10264654 Ga0105239_102646542 291
48 3300025914 Ga0207671_10066936 Ga0207671_100669362 291
49 3300026041 Ga0207639_10143263 Ga0207639_101432632 291
50 iso_pu_bacteria 2643221611 2644071096 291
51 3300009092 Ga0105250_10004976 Ga0105250_100049763 292
52 3300042007 Ga0439449_0001293 Ga0439449_0001293_104_997 292
53 3300044658 Ga0466972_0001085 Ga0466972_0001085_6862_7743 292
54 3300044683 Ga0466965_0021682 Ga0466965_0021682_507_1388 292
55 3300048928 Ga0496125_0106147 Ga0496125_0106147_1091_1969 292
56 3300025909 Ga0207705_10206256 Ga0207705_102062562 293
57 3300005455 Ga0070663_100000774 Ga0070663_1000007749 294
58 3300006353 Ga0075370_10051530 Ga0075370_100515301 294
59 3300026067 Ga0207678_10000966 Ga0207678_1000096611 294
60 3300027695 Ga0209966_1000074 Ga0209966_100007425 294
61 3300027717 Ga0209998_10024201 Ga0209998_100242012 294
62 3300037471 Ga0395905_0553562 Ga0395905_0553562_139_1026 294
63 iso_pu_bacteria 2738541277 2738719207 294
64 iso_pu_bacteria 2738543019 2739281969 294
65 3300046491 Ga0495584_0029295 Ga0495584_0029295_441_1373 295
66 3300046518 Ga0495631_0013618 Ga0495631_0013618_2014_2946 295
67 3300046665 Ga0495661_0001291 Ga0495661_0001291_18969_19901 295
68 3300047470 Ga0495681_0001112 Ga0495681_0001112_18950_19882 295
69 3300048916 Ga0496113_0414566 Ga0496113_0414566_65_955 295
70 iso_pu_bacteria 2547132374 2548497651 295
71 iso_pu_bacteria 2643221644 2644246342 295
72 iso_pu_bacteria 2643221717 2644649607 295
73 3300003792 Ga0055540_1003193 Ga0055540_10031937 296
74 3300025303 Ga0209051_1000159 Ga0209051_100015913 296
75 3300035691 Ga0373931_0001877 Ga0373931_0001877_3708_4604 297
76 3300037471 Ga0395905_0652514 Ga0395905_0652514_34_942 297
77 3300050516 nmdc:mga0sz30_57946_c1 nmdc:mga0sz30_57946_c1_675_1613 297
78 3300026041 Ga0207639_10127323 Ga0207639_101273232 298
79 3300031649 Ga0307514_10004257 Ga0307514_100042575 298
80 3300037418 Ga0395900_0000947 Ga0395900_0000947_2950_3849 298
81 3300037418 Ga0395900_0021862 Ga0395900_0021862_3536_4432 298
82 3300037466 Ga0395898_0019705 Ga0395898_0019705_2199_3098 298
83 3300037471 Ga0395905_0131117 Ga0395905_0131117_1290_2189 298
84 3300041404 Ga0439436_0062276 Ga0439436_0062276_108_1004 298
85 3300049571 Ga0501034_0358414 Ga0501034_0358414_228_1145 298
86 3300005344 Ga0070661_100001209 Ga0070661_10000120918 299
87 3300006946 Ga0079104_1000003 Ga0079104_1000003203 299
88 3300025935 Ga0207709_10000032 Ga0207709_1000003293 299
89 3300025945 Ga0207679_10147488 Ga0207679_101474882 299
90 3300027111 Ga0209281_1000002 Ga0209281_10000021419 299
91 3300032002 Ga0307416_100421546 Ga0307416_1004215462 299
92 iso_pu_bacteria 2919704043 2919706360 299
93 3300006948 Ga0099826_10000018 Ga0099826_1000001858 300
94 3300009011 Ga0105251_10036365 Ga0105251_100363652 300
95 3300025291 Ga0209675_1005746 Ga0209675_10057466 300
96 3300025294 Ga0209025_1061019 Ga0209025_10610192 300
97 3300025298 Ga0209050_1005757 Ga0209050_10057575 300
98 3300027666 Ga0209282_1000052 Ga0209282_100005238 300
99 3300046474 Ga0495605_0086801 Ga0495605_0086801_382_1410 300
100 3300046500 Ga0495596_0012021 Ga0495596_0012021_2324_3352 300
101 3300046501 Ga0495607_0027544 Ga0495607_0027544_302_1330 300
102 3300046512 Ga0495610_0006580 Ga0495610_0006580_258_1286 300
103 3300046513 Ga0495616_0019277 Ga0495616_0019277_337_1365 300
104 3300046538 Ga0495609_0024525 Ga0495609_0024525_1487_2515 300
105 3300046665 Ga0495661_0065981 Ga0495661_0065981_393_1421 300
106 3300046692 Ga0495671_0056086 Ga0495671_0056086_305_1333 300
107 3300046694 Ga0495649_0060352 Ga0495649_0060352_246_1274 300
108 3300046794 Ga0495589_0114736 Ga0495589_0114736_158_1186 300
109 3300047320 Ga0495672_0071769 Ga0495672_0071769_280_1308 300
110 3300047447 Ga0495685_029400 Ga0495685_029400_341_1369 300
111 3300048919 Ga0496116_0014094 Ga0496116_0014094_337_1365 300
112 3300048920 Ga0496117_0028471 Ga0496117_0028471_799_1701 300
113 3300048924 Ga0496121_0134346 Ga0496121_0134346_403_1431 300
114 3300048925 Ga0496122_0092053 Ga0496122_0092053_663_1691 300
115 3300048925 Ga0496122_0196253 Ga0496122_0196253_90_992 300
116 3300048926 Ga0496123_0067447 Ga0496123_0067447_547_1575 300
117 3300048926 Ga0496123_0091147 Ga0496123_0091147_111_1013 300
118 3300048928 Ga0496125_0018461 Ga0496125_0018461_3977_4888 300
119 3300048929 Ga0496126_0033593 Ga0496126_0033593_1194_2105 300
120 3300048929 Ga0496126_0253852 Ga0496126_0253852_390_1418 300
121 3300049762 Ga0501265_000479 Ga0501265_000479_2042_2977 301
122 3300037471 Ga0395905_0009989 Ga0395905_0009989_5877_6932 303
123 iso_pu_bacteria 2643221596 2643991046 303
124 3300031235 Ga0265330_10035666 Ga0265330_100356662 304
125 3300031251 Ga0265327_10077123 Ga0265327_100771232 304
126 3300031711 Ga0265314_10001065 Ga0265314_1000106529 304
127 3300039447 Ga0436361_0233191 Ga0436361_0233191_1316_2293 304
128 iso_pu_bacteria 2990710928 2990711426 304
129 iso_pu_bacteria 2842733646 2842734217 305
130 iso_pu_bacteria 2842747753 2842749522 305
131 3300014497 Ga0182008_10000215 Ga0182008_1000021523 306
132 3300021361 Ga0213872_10002681 Ga0213872_100026812 306
133 3300039447 Ga0436361_0791332 Ga0436361_0791332_6997_7938 306
134 3300044842 Ga0466957_0093821 Ga0466957_0093821_263_1228 306
135 3300045051 Ga0451576_0001582 Ga0451576_0001582_11098_12018 306
136 iso_pu_bacteria 2643221628 2644162291 306
137 iso_pu_bacteria 2643221672 2644396293 306
138 iso_pu_bacteria 2881101125 2881102969 306
139 iso_pu_bacteria 2899924645 2899927660 306
140 iso_pu_bacteria 2919462493 2919462833 306
141 iso_pu_bacteria 2928051484 2928051699 306
142 iso_pu_bacteria 2928070936 2928073077 306
143 iso_pu_bacteria 2945909444 2945913806 306
144 iso_pu_bacteria 2945945610 2945949370 306
145 iso_pu_bacteria 2945972063 2945973415 306
146 iso_pu_bacteria 2945984333 2945990795 306
147 3300025284 Ga0209130_1003501 Ga0209130_10035017 307
148 3300025292 Ga0209676_1020024 Ga0209676_10200243 307
149 3300028794 Ga0307515_10000040 Ga0307515_10000040310 307
150 3300031731 Ga0307405_10195424 Ga0307405_101954241 307
151 3300031901 Ga0307406_10164419 Ga0307406_101644192 307
152 3300032005 Ga0307411_10105205 Ga0307411_101052052 307
153 3300041404 Ga0439436_0007890 Ga0439436_0007890_1150_2073 307
154 3300041405 Ga0439438_019873 Ga0439438_019873_263_1186 307
155 3300041406 Ga0439439_0008626 Ga0439439_0008626_449_1372 307
156 3300042007 Ga0439449_0009346 Ga0439449_0009346_333_1256 307
157 3300042015 Ga0439462_0006045 Ga0439462_0006045_21_944 307
158 3300042128 Ga0450897_000798 Ga0450897_000798_194_1117 307
159 3300042133 Ga0450896_001023 Ga0450896_001023_2315_3238 307
160 3300042135 Ga0450899_010210 Ga0450899_010210_43_966 307
161 3300042145 Ga0450906_002150 Ga0450906_002150_2456_3379 307
162 3300042147 Ga0450910_014791 Ga0450910_014791_44_967 307
163 3300042184 Ga0450908_016499 Ga0450908_016499_336_1259 307
164 3300042185 Ga0450909_001630 Ga0450909_001630_40_963 307
165 3300042435 Ga0439434_0013180 Ga0439434_0013180_217_1140 307
166 3300042876 Ga0451577_0031882 Ga0451577_0031882_2446_3396 307
167 3300044673 Ga0453683_0067387 Ga0453683_0067387_45_995 307
168 3300044683 Ga0466965_0006409 Ga0466965_0006409_3164_4087 307
169 3300044712 Ga0453684_0063411 Ga0453684_0063411_1809_2759 307
170 3300045051 Ga0451576_0001766 Ga0451576_0001766_31860_32810 307
171 3300050493 nmdc:mga0k408_120722_c1 nmdc:mga0k408_120722_c1_322_1380 307
172 3300050493 nmdc:mga0k408_22756_c2 nmdc:mga0k408_22756_c2_1558_2523 307
173 3300050493 nmdc:mga0k408_9437_c1 nmdc:mga0k408_9437_c1_2866_3831 307
174 3300050494 nmdc:mga06z11_48007_c1 nmdc:mga06z11_48007_c1_1080_2138 307
175 3300050496 nmdc:mga07m45_2521_c1 nmdc:mga07m45_2521_c1_5126_6091 307
176 iso_pu_bacteria 2643221609 2644060978 307
177 iso_pu_bacteria 2643221683 2644464731 307
178 iso_pu_bacteria 2721755523 2722885116 307
179 iso_pu_bacteria 2738543012 2739246795 307
180 iso_pu_bacteria 2816332133 2816471489 307
181 3300005548 Ga0070665_100445119 Ga0070665_1004451192 308
182 3300017792 Ga0163161_10107920 Ga0163161_101079202 308
183 3300045051 Ga0451576_0033049 Ga0451576_0033049_579_1505 308
184 3300048913 Ga0496110_0083045 Ga0496110_0083045_383_1312 308
185 3300048916 Ga0496113_0231709 Ga0496113_0231709_355_1284 308
186 iso_pu_bacteria 2842718218 2842721200 308
187 iso_pu_bacteria 2904449895 2904450639 308
188 iso_pu_bacteria 2904456579 2904459861 308
189 iso_pu_bacteria 2929160207 2929161796 308
190 iso_pu_bacteria 2929520902 2929521356 308
191 3300005356 Ga0070674_100052553 Ga0070674_1000525533 309
192 3300006353 Ga0075370_10002395 Ga0075370_100023952 309
193 3300006946 Ga0079104_1020990 Ga0079104_10209902 309
194 3300009176 Ga0105242_10000453 Ga0105242_1000045319 309
195 3300015683 Ga0183362_10005 Ga0183362_10005414 309
196 3300017792 Ga0163161_10086621 Ga0163161_100866212 309
197 3300025935 Ga0207709_10259102 Ga0207709_102591022 309
198 3300026121 Ga0207683_10091590 Ga0207683_100915902 309
199 3300027111 Ga0209281_1008444 Ga0209281_10084442 309
200 3300027666 Ga0209282_1058694 Ga0209282_10586942 309
201 3300031911 Ga0307412_10045307 Ga0307412_100453073 309
202 3300048925 Ga0496122_0000063 Ga0496122_0000063_87614_88585 309
203 3300048926 Ga0496123_0000045 Ga0496123_0000045_138039_139010 309
204 3300048927 Ga0496124_0149473 Ga0496124_0149473_720_1691 309
205 3300050490 nmdc:mga03n38_73271_c1 nmdc:mga03n38_73271_c1_33_998 309
206 3300050491 nmdc:mga00v17_34157_c1 nmdc:mga00v17_34157_c1_1388_2419 309
207 3300050492 nmdc:mga0yw44_12112_c1 nmdc:mga0yw44_12112_c1_670_1638 309
208 3300050493 nmdc:mga0k408_14507_c1 nmdc:mga0k408_14507_c1_1533_2498 309
209 3300050494 nmdc:mga06z11_149577_c1 nmdc:mga06z11_149577_c1_176_1141 309
210 3300053118 Ga0500594_0020515 Ga0500594_0020515_534_1505 309
211 iso_pu_bacteria 2513020051 2513227683 309
212 iso_pu_bacteria 2599185214 2599625685 309
213 iso_pu_bacteria 2599185226 2599673698 309
214 iso_pu_bacteria 2599185227 2599683368 309
215 iso_pu_bacteria 2599185229 2599695144 309
216 iso_pu_bacteria 2643221658 2644324444 309
217 iso_pu_bacteria 2818991446 2819599707 309
218 iso_pu_bacteria 2831265667 2831271696 309
219 iso_pu_bacteria 2838054893 2838055609 309
220 iso_pu_bacteria 2885198086 2885200857 309
221 iso_pu_bacteria 2885211737 2885214360 309
222 iso_pu_bacteria 2928037797 2928042063 309
223 iso_pu_bacteria 2928044640 2928049627 309
224 iso_pu_bacteria 2928064002 2928065610 309
225 iso_pu_bacteria 2928084124 2928086864 309
226 iso_pu_bacteria 2954767861 2954770978 309
227 3300003773 Ga0055537_1000134 Ga0055537_100013413 310
228 3300003781 Ga0055536_1004046 Ga0055536_10040463 310
229 3300003784 Ga0055534_1000088 Ga0055534_100008813 310
230 3300003790 Ga0055528_1000630 Ga0055528_100063012 310
231 3300003792 Ga0055540_1003446 Ga0055540_10034467 310
232 3300003794 Ga0055531_10002924 Ga0055531_100029247 310
233 3300005844 Ga0068862_100014783 Ga0068862_1000147836 310
234 3300006038 Ga0075365_10006046 Ga0075365_100060467 310
235 3300006048 Ga0075363_100085926 Ga0075363_1000859262 310
236 3300006051 Ga0075364_10043582 Ga0075364_100435824 310
237 3300006177 Ga0075362_10027041 Ga0075362_100270412 310
238 3300006353 Ga0075370_10134326 Ga0075370_101343262 310
239 3300006948 Ga0099826_10001370 Ga0099826_100013709 310
240 3300006948 Ga0099826_10136696 Ga0099826_101366963 310
241 3300009148 Ga0105243_10159691 Ga0105243_101596914 310
242 3300011119 Ga0105246_10136704 Ga0105246_101367042 310
243 3300017792 Ga0163161_10006815 Ga0163161_100068153 310
244 3300017792 Ga0163161_10011660 Ga0163161_100116605 310
245 3300025258 Ga0209129_1001116 Ga0209129_10011164 310
246 3300025263 Ga0209565_1000046 Ga0209565_1000046142 310
247 3300025273 Ga0209673_1000058 Ga0209673_100005848 310
248 3300025291 Ga0209675_1000010 Ga0209675_1000010217 310
249 3300025292 Ga0209676_1000098 Ga0209676_1000098187 310
250 3300025294 Ga0209025_1000122 Ga0209025_100012214 310
251 3300025294 Ga0209025_1012938 Ga0209025_10129382 310
252 3300025298 Ga0209050_1000554 Ga0209050_100055459 310
253 3300025303 Ga0209051_1000597 Ga0209051_10005975 310
254 3300025304 Ga0209257_1004288 Ga0209257_10042886 310
255 3300028380 Ga0268265_10020589 Ga0268265_100205892 310
256 3300030731 Ga0316177_1112288 Ga0316177_11122885 310
257 3300030734 Ga0316179_1021560 Ga0316179_10215602 310
258 3300030735 Ga0316178_1115282 Ga0316178_11152823 310
259 3300030736 Ga0316180_1114504 Ga0316180_11145042 310
260 3300030742 Ga0316183_1017668 Ga0316183_10176683 310
261 3300031649 Ga0307514_10009122 Ga0307514_100091226 310
262 3300031731 Ga0307405_10276619 Ga0307405_102766192 310
263 3300031901 Ga0307406_10001422 Ga0307406_100014225 310
264 3300031901 Ga0307406_10027909 Ga0307406_100279094 310
265 3300031911 Ga0307412_10230950 Ga0307412_102309502 310
266 3300042876 Ga0451577_0000166 Ga0451577_0000166_26576_27565 310
267 3300044712 Ga0453684_0000187 Ga0453684_0000187_241304_242293 310
268 3300046453 Ga0495627_009143 Ga0495627_009143_107_1132 310
269 3300046512 Ga0495610_0023490 Ga0495610_0023490_1619_2644 310
270 3300046515 Ga0495620_0046818 Ga0495620_0046818_309_1241 310
271 3300046520 Ga0495637_0001872 Ga0495637_0001872_3059_4084 310
272 3300046660 Ga0495625_0000245 Ga0495625_0000245_75493_76527 310
273 3300046660 Ga0495625_0090850 Ga0495625_0090850_691_1716 310
274 3300046674 Ga0495588_0070231 Ga0495588_0070231_554_1486 310
275 3300048920 Ga0496117_0099098 Ga0496117_0099098_841_1773 310
276 3300048927 Ga0496124_0112944 Ga0496124_0112944_1052_1984 310
277 3300050489 nmdc:mga03683_26711_c1 nmdc:mga03683_26711_c1_1247_2263 310
278 3300050490 nmdc:mga03n38_8091_c2 nmdc:mga03n38_8091_c2_915_1931 310
279 3300050491 nmdc:mga00v17_80267_c1 nmdc:mga00v17_80267_c1_605_1621 310
280 3300050492 nmdc:mga0yw44_11043_c1 nmdc:mga0yw44_11043_c1_1126_2142 310
281 3300050493 nmdc:mga0k408_11327_c1 nmdc:mga0k408_11327_c1_3702_4718 310
282 3300050494 nmdc:mga06z11_109462_c1 nmdc:mga06z11_109462_c1_27_959 310
283 3300050496 nmdc:mga07m45_2078_c1 nmdc:mga07m45_2078_c1_5121_6053 310
284 3300053079 Ga0500610_0003003 Ga0500610_0003003_12_1037 310
285 3300053121 Ga0500607_004599 Ga0500607_004599_5822_6796 310
286 3300053158 Ga0500627_0001087 Ga0500627_0001087_4371_5396 310
287 3300053161 Ga0500634_0017015 Ga0500634_0017015_2115_3140 310
288 iso_pu_bacteria 2974320154 2974324176 310
289 3300003781 Ga0055536_1004595 Ga0055536_10045956 311
290 3300003792 Ga0055540_1003915 Ga0055540_10039153 311
291 3300009148 Ga0105243_10006758 Ga0105243_100067583 311
292 3300025292 Ga0209676_1000173 Ga0209676_1000173143 311
293 3300025303 Ga0209051_1000282 Ga0209051_100028289 311
294 3300025304 Ga0209257_1008289 Ga0209257_10082895 311
295 3300025935 Ga0207709_10000285 Ga0207709_100002853 311
296 3300031731 Ga0307405_10027631 Ga0307405_100276313 311
297 3300003187 JGI25151J46595_10004441 JGI25151J46595_100044417 312
298 3300005327 Ga0070658_10057385 Ga0070658_100573853 312
299 3300026121 Ga0207683_10278309 Ga0207683_102783092 312
300 3300031548 Ga0307408_100000163 Ga0307408_10000016363 312
301 3300031901 Ga0307406_10000827 Ga0307406_1000082711 312
302 3300049763 Ga0501266_000388 Ga0501266_000388_4350_5435 312
303 3300002987 JGI25159J45721_1010392 JGI25159J45721_10103923 313
304 3300003781 Ga0055536_1005794 Ga0055536_10057945 313
305 3300003791 Ga0055530_10000962 Ga0055530_100009627 313
306 3300003792 Ga0055540_1010504 Ga0055540_10105042 313
307 3300003794 Ga0055531_10017143 Ga0055531_100171432 313
308 3300005457 Ga0070662_100007874 Ga0070662_1000078747 313
309 3300006353 Ga0075370_10015852 Ga0075370_100158522 313
310 3300006353 Ga0075370_10034773 Ga0075370_100347732 313
311 3300009148 Ga0105243_10009873 Ga0105243_100098733 313
312 3300009545 Ga0105237_10079879 Ga0105237_100798792 313
313 3300009551 Ga0105238_10244427 Ga0105238_102444271 313
314 3300013100 Ga0157373_10016632 Ga0157373_100166323 313
315 3300013100 Ga0157373_10037888 Ga0157373_100378881 313
316 3300014497 Ga0182008_10006865 Ga0182008_100068658 313
317 3300015261 Ga0182006_1001570 Ga0182006_10015707 313
318 3300015262 Ga0182007_10003300 Ga0182007_100033007 313
319 3300017792 Ga0163161_10192237 Ga0163161_101922372 313
320 3300025728 Ga0207655_1002725 Ga0207655_100272514 313
321 3300025935 Ga0207709_10004960 Ga0207709_100049607 313
322 3300030744 Ga0316181_1024157 Ga0316181_10241571 313
323 3300042012 Ga0439455_0015989 Ga0439455_0015989_64_1005 313
324 3300048919 Ga0496116_0067529 Ga0496116_0067529_240_1325 313
325 3300048920 Ga0496117_0097041 Ga0496117_0097041_243_1328 313
326 3300048921 Ga0496118_0068993 Ga0496118_0068993_1270_2355 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

68

134

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

68

282

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ius-assembly1.cif.gz_A the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.8568 18 306
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.85 18 307
3ius-assembly2.cif.gz_B the structure of a functionally unknown conserved protein from silicibacter pomeroyi dss 0.847 18 307
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8407 18 307
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8304 18 307
ID Description Score Start End Superfamily
af_Q8VZB1_86_348_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8578 19 306 3.40.50.720
af_Q54L85_1_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8439 18 306 3.40.50.720
af_Q8VZB1_86_348_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8397 19 306 3.40.50.720
af_P75821_1_335_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8372 19 307 3.40.50.720
3iusB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8354 18 307 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2H0NLZ1-F1-model_v4 NAD(P)-dependent oxidoreductase 0.978 18 304 GO:0004029
GO:0005737
AF-A0A5C7KBI5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9762 18 306 GO:0004029
GO:0005737
AF-V2JIN2-F1-model_v4 NAD-dependent dehydratase 0.968 152 308 GO:0004029
GO:0005737
AF-A0A2H0NLZ1-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9678 18 304 GO:0004029
GO:0005737
AF-A0A4Y9RHU8-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9668 62 307 GO:0004029
GO:0005737
GO:0009058

Feature Viewer

pLDDT pTM Quality
90.44 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map