F408229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 214 | 325 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1002305|Ga0081540_100230513 |
| Length | 395 |
| Sequence | LRRYVGSFAATPCNTLAPTLDAVSQARRAADDARTDGAATPDVRLVDLMRRFADVVAVDAVSLDIARGEFFTLLGPSGSGKTTTLRLVAGFDQPDGGRIELAGADVTSRPPYARDVNTVFQDYALFPHMTVLQNVEYGLRVRRVARDERRRRAEEALAMVRLEGYGARKPAQLSGGQRQRVALARAIVNRPRVLLLDEPLGALDLKLRQEMQTELKRIQGEVGITFVYVTHDQEEALTMSDRLAVFNRGRIEQVGTPAEVYEHPANEFVAGFVGVSNVVERDGRRFTIRPEKVRLLDDGEPGDGLHVESGTVRDVAYVGMVTRYTVELDRGGELQVVRQNLETSSQQAQELRGRRVRVAWHEAQTFAIGRAQAGPASAAHVGRSGTRQDEEEERP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 129 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 147 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 148 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 149 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.66 |
| Rhizosphere | 88.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10002140 | 3300001991 | Bacteria | 2915 |
| 2 | JGI24738J21930_10008228 | 3300002075 | Bacteria | 2375 |
| 3 | JGI24744J21845_10001083 | 3300002077 | Bacteria | 5273 |
| 4 | Ga0070658_10021571 | 3300005327 | Bacteria | 5162 |
| 5 | Ga0070683_100001314 | 3300005329 | Bacteria | 18922 |
| 6 | Ga0070683_100002720 | 3300005329 | Bacteria | 14119 |
| 7 | Ga0070683_100215284 | 3300005329 | Bacteria | 1825 |
| 8 | Ga0070677_10079015 | 3300005333 | Bacteria | 1403 |
| 9 | Ga0070682_100149845 | 3300005337 | Bacteria | 1599 |
| 10 | Ga0070660_100005101 | 3300005339 | Bacteria | 9070 |
| 11 | Ga0070691_10019897 | 3300005341 | Bacteria | 3098 |
| 12 | Ga0070687_100112640 | 3300005343 | Bacteria | 1542 |
| 13 | Ga0070661_100185640 | 3300005344 | Bacteria | 1584 |
| 14 | Ga0070692_10198849 | 3300005345 | Bacteria | 1172 |
| 15 | Ga0070668_100129114 | 3300005347 | Bacteria | 2027 |
| 16 | Ga0070675_100036789 | 3300005354 | Bacteria | 3985 |
| 17 | Ga0070671_100116020 | 3300005355 | Bacteria | 2251 |
| 18 | Ga0070674_100220603 | 3300005356 | Bacteria | 1475 |
| 19 | Ga0070673_100088733 | 3300005364 | Bacteria | 2523 |
| 20 | Ga0070673_100150073 | 3300005364 | Bacteria | 1973 |
| 21 | Ga0070659_100045519 | 3300005366 | Bacteria | 3437 |
| 22 | Ga0070659_100185812 | 3300005366 | Bacteria | 1707 |
| 23 | Ga0070659_100189685 | 3300005366 | Bacteria | 1689 |
| 24 | Ga0070667_100187530 | 3300005367 | Bacteria | 1831 |
| 25 | Ga0070667_100232689 | 3300005367 | Bacteria | 1643 |
| 26 | Ga0070713_100057202 | 3300005436 | Bacteria | 3246 |
| 27 | Ga0070701_10004998 | 3300005438 | Bacteria | 5434 |
| 28 | Ga0070700_100002344 | 3300005441 | Bacteria | 9640 |
| 29 | Ga0070700_100282021 | 3300005441 | Bacteria | 1205 |
| 30 | Ga0070708_100000274 | 3300005445 | Bacteria | 38511 |
| 31 | Ga0070678_100000442 | 3300005456 | Bacteria | 19620 |
| 32 | Ga0070681_10023661 | 3300005458 | Bacteria | 6181 |
| 33 | Ga0070685_10003169 | 3300005466 | Bacteria | 8367 |
| 34 | Ga0070706_100096847 | 3300005467 | Bacteria | 2740 |
| 35 | Ga0070698_100123179 | 3300005471 | Bacteria | 2551 |
| 36 | Ga0070698_100146382 | 3300005471 | Bacteria | 2311 |
| 37 | Ga0070698_100151371 | 3300005471 | Bacteria | 2268 |
| 38 | Ga0070699_100079796 | 3300005518 | Bacteria | 2851 |
| 39 | Ga0070679_100142179 | 3300005530 | Bacteria | 2378 |
| 40 | Ga0070679_100288855 | 3300005530 | Bacteria | 1591 |
| 41 | Ga0070684_100021842 | 3300005535 | Bacteria | 5332 |
| 42 | Ga0070684_100035231 | 3300005535 | Bacteria | 4283 |
| 43 | Ga0068853_100008817 | 3300005539 | Bacteria | 8111 |
| 44 | Ga0070672_100031722 | 3300005543 | Bacteria | 3980 |
| 45 | Ga0070686_100002207 | 3300005544 | Bacteria | 10761 |
| 46 | Ga0070693_100024550 | 3300005547 | Bacteria | 3234 |
| 47 | Ga0070704_100085349 | 3300005549 | Bacteria | 2336 |
| 48 | Ga0068855_100171078 | 3300005563 | Bacteria | 2460 |
| 49 | Ga0068855_100325645 | 3300005563 | Bacteria | 1697 |
| 50 | Ga0068857_100051260 | 3300005577 | Bacteria | 3661 |
| 51 | Ga0068857_100112830 | 3300005577 | Bacteria | 2444 |
| 52 | Ga0068854_100079368 | 3300005578 | Bacteria | 2419 |
| 53 | Ga0068856_100005584 | 3300005614 | Bacteria | 12384 |
| 54 | Ga0070702_100029409 | 3300005615 | Bacteria | 2987 |
| 55 | Ga0068852_100013729 | 3300005616 | Bacteria | 6208 |
| 56 | Ga0068852_100172123 | 3300005616 | Bacteria | 2031 |
| 57 | Ga0068859_100178537 | 3300005617 | Bacteria | 2206 |
| 58 | Ga0068859_100294916 | 3300005617 | Bacteria | 1715 |
| 59 | Ga0068866_10003564 | 3300005718 | Bacteria | 6373 |
| 60 | Ga0068866_10042259 | 3300005718 | Bacteria | 2267 |
| 61 | Ga0068851_10021310 | 3300005834 | Bacteria | 3146 |
| 62 | Ga0068860_100148798 | 3300005843 | Bacteria | 2254 |
| 63 | Ga0068860_100345953 | 3300005843 | Bacteria | 1462 |
| 64 | Ga0081455_10053793 | 3300005937 | Bacteria | 3437 |
| 65 | Ga0081540_1002305 | 3300005983 | Bacteria | 15660 |
| 66 | Ga0081540_1013801 | 3300005983 | Bacteria | 5227 |
| 67 | Ga0081539_10004748 | 3300005985 | Bacteria | 14682 |
| 68 | Ga0081539_10005570 | 3300005985 | Bacteria | 12744 |
| 69 | Ga0081539_10051734 | 3300005985 | Bacteria | 2312 |
| 70 | Ga0070715_10027437 | 3300006163 | Bacteria | 2275 |
| 71 | Ga0075431_100031487 | 3300006847 | Bacteria | 5464 |
| 72 | Ga0075431_100187875 | 3300006847 | Bacteria | 2118 |
| 73 | Ga0075433_10077746 | 3300006852 | Bacteria | 2923 |
| 74 | Ga0075434_100069923 | 3300006871 | Bacteria | 3500 |
| 75 | Ga0068865_100009066 | 3300006881 | Bacteria | 6154 |
| 76 | Ga0075436_100002820 | 3300006914 | Bacteria | 11907 |
| 77 | Ga0097620_100178530 | 3300006931 | Bacteria | 2206 |
| 78 | Ga0097620_100294908 | 3300006931 | Bacteria | 1715 |
| 79 | Ga0075435_100001334 | 3300007076 | Bacteria | 15854 |
| 80 | Ga0105240_10161054 | 3300009093 | Bacteria | 2665 |
| 81 | Ga0111539_10018782 | 3300009094 | Bacteria | 8555 |
| 82 | Ga0105245_10005239 | 3300009098 | Bacteria | 11393 |
| 83 | Ga0105245_10528546 | 3300009098 | Bacteria | 1199 |
| 84 | Ga0114129_10001697 | 3300009147 | Bacteria | 30038 |
| 85 | Ga0114129_10005080 | 3300009147 | Bacteria | 18523 |
| 86 | Ga0114129_10177886 | 3300009147 | Bacteria | 2897 |
| 87 | Ga0105243_10009361 | 3300009148 | Bacteria | 7465 |
| 88 | Ga0105243_10012002 | 3300009148 | Bacteria | 6549 |
| 89 | Ga0105243_10033694 | 3300009148 | Bacteria | 3961 |
| 90 | Ga0105241_10037354 | 3300009174 | Bacteria | 3658 |
| 91 | Ga0105242_10030369 | 3300009176 | Bacteria | 4314 |
| 92 | Ga0105242_10145308 | 3300009176 | Bacteria | 2063 |
| 93 | Ga0105248_10109754 | 3300009177 | Bacteria | 3111 |
| 94 | Ga0105238_10279701 | 3300009551 | Bacteria | 1650 |
| 95 | Ga0105249_10000948 | 3300009553 | Bacteria | 25660 |
| 96 | Ga0105249_10087232 | 3300009553 | Bacteria | 2911 |
| 97 | Ga0105249_10121344 | 3300009553 | Bacteria | 2484 |
| 98 | Ga0105239_10105117 | 3300010375 | Bacteria | 3126 |
| 99 | Ga0157369_10040115 | 3300013105 | Bacteria | 5113 |
| 100 | Ga0157369_10127166 | 3300013105 | Bacteria | 2701 |
| 101 | Ga0157374_10066243 | 3300013296 | Bacteria | 3394 |
| 102 | Ga0157378_10225101 | 3300013297 | Bacteria | 1785 |
| 103 | Ga0163162_10157998 | 3300013306 | Bacteria | 2388 |
| 104 | Ga0157372_10297677 | 3300013307 | Bacteria | 1877 |
| 105 | Ga0157372_10567538 | 3300013307 | Bacteria | 1323 |
| 106 | Ga0163163_10193980 | 3300014325 | Bacteria | 2079 |
| 107 | Ga0163163_10236924 | 3300014325 | Bacteria | 1874 |
| 108 | Ga0157380_10009040 | 3300014326 | Bacteria | 7118 |
| 109 | Ga0157380_10020199 | 3300014326 | Bacteria | 4977 |
| 110 | Ga0157380_10034922 | 3300014326 | Bacteria | 3880 |
| 111 | Ga0157376_10016665 | 3300014969 | Bacteria | 5585 |
| 112 | Ga0163161_10022677 | 3300017792 | Bacteria | 4422 |
| 113 | Ga0206356_10895433 | 3300020070 | Bacteria | 2526 |
| 114 | Ga0207656_10042450 | 3300025321 | Bacteria | 1935 |
| 115 | Ga0207688_10033230 | 3300025901 | Bacteria | 2853 |
| 116 | Ga0207685_10001630 | 3300025905 | Bacteria | 4813 |
| 117 | Ga0207645_10036701 | 3300025907 | Bacteria | 3147 |
| 118 | Ga0207643_10003044 | 3300025908 | Bacteria | 9011 |
| 119 | Ga0207705_10050254 | 3300025909 | Bacteria | 3001 |
| 120 | Ga0207705_10079690 | 3300025909 | Bacteria | 2385 |
| 121 | Ga0207707_10104569 | 3300025912 | Bacteria | 2474 |
| 122 | Ga0207695_10077245 | 3300025913 | Bacteria | 3383 |
| 123 | Ga0207671_10071136 | 3300025914 | Bacteria | 2594 |
| 124 | Ga0207671_10187270 | 3300025914 | Bacteria | 1613 |
| 125 | Ga0207662_10149361 | 3300025918 | Bacteria | 1485 |
| 126 | Ga0207657_10000046 | 3300025919 | Bacteria | 113887 |
| 127 | Ga0207657_10007888 | 3300025919 | Bacteria | 10860 |
| 128 | Ga0207649_10204433 | 3300025920 | Bacteria | 1397 |
| 129 | Ga0207652_10104095 | 3300025921 | Bacteria | 2510 |
| 130 | Ga0207694_10040965 | 3300025924 | Bacteria | 3568 |
| 131 | Ga0207659_10188379 | 3300025926 | Bacteria | 1640 |
| 132 | Ga0207687_10063597 | 3300025927 | Bacteria | 2613 |
| 133 | Ga0207687_10309667 | 3300025927 | Bacteria | 1275 |
| 134 | Ga0207644_10073525 | 3300025931 | Bacteria | 2507 |
| 135 | Ga0207690_10220788 | 3300025932 | Bacteria | 1450 |
| 136 | Ga0207706_10011233 | 3300025933 | Bacteria | 8166 |
| 137 | Ga0207686_10122144 | 3300025934 | Bacteria | 1774 |
| 138 | Ga0207709_10002743 | 3300025935 | Bacteria | 10857 |
| 139 | Ga0207709_10019249 | 3300025935 | Bacteria | 3834 |
| 140 | Ga0207704_10061730 | 3300025938 | Bacteria | 2327 |
| 141 | Ga0207665_10026255 | 3300025939 | Bacteria | 3845 |
| 142 | Ga0207691_10006210 | 3300025940 | Bacteria | 11542 |
| 143 | Ga0207691_10027491 | 3300025940 | Bacteria | 5332 |
| 144 | Ga0207661_10002079 | 3300025944 | Bacteria | 13773 |
| 145 | Ga0207661_10064207 | 3300025944 | Bacteria | 2975 |
| 146 | Ga0207679_10172353 | 3300025945 | Bacteria | 1783 |
| 147 | Ga0207712_10010539 | 3300025961 | Bacteria | 5868 |
| 148 | Ga0207712_10080197 | 3300025961 | Bacteria | 2373 |
| 149 | Ga0207712_10334613 | 3300025961 | Bacteria | 1254 |
| 150 | Ga0207640_10069177 | 3300025981 | Bacteria | 2369 |
| 151 | Ga0207658_10159965 | 3300025986 | Bacteria | 1845 |
| 152 | Ga0207677_10247377 | 3300026023 | Bacteria | 1446 |
| 153 | Ga0207677_10315403 | 3300026023 | Bacteria | 1297 |
| 154 | Ga0207703_10090226 | 3300026035 | Bacteria | 2575 |
| 155 | Ga0207678_10104692 | 3300026067 | Bacteria | 2415 |
| 156 | Ga0207708_10000564 | 3300026075 | Bacteria | 28643 |
| 157 | Ga0207708_10031362 | 3300026075 | Bacteria | 4034 |
| 158 | Ga0207708_10222942 | 3300026075 | Bacteria | 1511 |
| 159 | Ga0207702_10104974 | 3300026078 | Bacteria | 2502 |
| 160 | Ga0207641_10028632 | 3300026088 | Bacteria | 4604 |
| 161 | Ga0207648_10061197 | 3300026089 | Bacteria | 3283 |
| 162 | Ga0207674_10062896 | 3300026116 | Bacteria | 3748 |
| 163 | Ga0207675_100018916 | 3300026118 | Bacteria | 6430 |
| 164 | Ga0207675_100076994 | 3300026118 | Bacteria | 3124 |
| 165 | Ga0207683_10000251 | 3300026121 | Bacteria | 47816 |
| 166 | Ga0207683_10022439 | 3300026121 | Bacteria | 5419 |
| 167 | Ga0207683_10036927 | 3300026121 | Bacteria | 4255 |
| 168 | Ga0207428_10096939 | 3300027907 | Bacteria | 2283 |
| 169 | Ga0268266_10495447 | 3300028379 | Bacteria | 1166 |
| 170 | Ga0265319_1030465 | 3300028563 | Bacteria | 1887 |
| 171 | Ga0307405_10165238 | 3300031731 | Bacteria | 1572 |
| 172 | Ga0307413_10115225 | 3300031824 | Bacteria | 1808 |
| 173 | Ga0307407_10026476 | 3300031903 | Bacteria | 3072 |
| 174 | Ga0307409_100012598 | 3300031995 | Bacteria | 5396 |
| 175 | Ga0307416_100051619 | 3300032002 | Bacteria | 3286 |
| 176 | Ga0307415_100122867 | 3300032126 | Bacteria | 1950 |
| 177 | Ga0307507_10001261 | 3300033179 | Bacteria | 56658 |
| 178 | Ga0373948_0004852 | 3300034817 | Bacteria | 2149 |
| 179 | Ga0373952_0021533 | 3300035092 | Bacteria | 1362 |
| 180 | Ga0373941_0011213 | 3300035115 | Bacteria | 2311 |
| 181 | Ga0373953_0089742 | 3300035117 | Bacteria | 1285 |
| 182 | Ga0373954_0078446 | 3300035118 | Bacteria | 1576 |
| 183 | Ga0373943_0009233 | 3300035170 | Bacteria | 4419 |
| 184 | Ga0373955_0071067 | 3300035172 | Bacteria | 1946 |
| 185 | Ga0373931_0105791 | 3300035691 | Bacteria | 1589 |
| 186 | Ga0373935_0019638 | 3300035692 | Bacteria | 4120 |
| 187 | Ga0373947_0011160 | 3300035725 | Bacteria | 5158 |
| 188 | Ga0373925_0015963 | 3300037068 | Bacteria | 5437 |
| 189 | Ga0395899_0093024 | 3300037312 | Bacteria | 2182 |
| 190 | Ga0395900_0005855 | 3300037418 | Bacteria | 12833 |
| 191 | Ga0395900_0104876 | 3300037418 | Bacteria | 2904 |
| 192 | Ga0395898_0004625 | 3300037466 | Bacteria | 15019 |
| 193 | Ga0395898_0006779 | 3300037466 | Bacteria | 12191 |
| 194 | Ga0395898_0102231 | 3300037466 | Bacteria | 2751 |
| 195 | Ga0395898_0227644 | 3300037466 | Bacteria | 1778 |
| 196 | Ga0395905_0010578 | 3300037471 | Bacteria | 8962 |
| 197 | Ga0395905_0012731 | 3300037471 | Bacteria | 8090 |
| 198 | Ga0395905_0069142 | 3300037471 | Bacteria | 3307 |
| 199 | Ga0395905_0204101 | 3300037471 | Bacteria | 1853 |
| 200 | Ga0395901_0012797 | 3300038443 | Bacteria | 8509 |
| 201 | Ga0395901_0023578 | 3300038443 | Bacteria | 6309 |
| 202 | Ga0395901_0048180 | 3300038443 | Bacteria | 4425 |
| 203 | Ga0395901_0116934 | 3300038443 | Bacteria | 2801 |
| 204 | Ga0395901_0145842 | 3300038443 | Bacteria | 2488 |
| 205 | Ga0439436_0028155 | 3300041404 | Bacteria | 1641 |
| 206 | Ga0439439_0000087 | 3300041406 | Bacteria | 12039 |
| 207 | Ga0439461_0007682 | 3300041410 | Bacteria | 1917 |
| 208 | Ga0439451_003236 | 3300042009 | Bacteria | 3306 |
| 209 | Ga0439434_0003263 | 3300042435 | Bacteria | 4763 |
| 210 | Ga0466969_0009763 | 3300044656 | Bacteria | 5087 |
| 211 | Ga0466972_0018788 | 3300044658 | Bacteria | 3454 |
| 212 | Ga0466961_0018128 | 3300044693 | Bacteria | 4527 |
| 213 | Ga0466963_0146214 | 3300044694 | Bacteria | 1640 |
| 214 | Ga0466957_0084343 | 3300044842 | Bacteria | 1983 |
| 215 | Ga0466958_0109113 | 3300045836 | Bacteria | 1727 |
| 216 | Ga0466967_0027207 | 3300045976 | Bacteria | 4754 |
| 217 | Ga0495603_0023321 | 3300046455 | Bacteria | 3747 |
| 218 | Ga0495603_0056934 | 3300046455 | Bacteria | 2313 |
| 219 | Ga0495641_0010751 | 3300046461 | Bacteria | 5271 |
| 220 | Ga0495641_0033609 | 3300046461 | Bacteria | 2433 |
| 221 | Ga0495641_0092106 | 3300046461 | Bacteria | 1354 |
| 222 | Ga0495651_0016022 | 3300046462 | Bacteria | 5806 |
| 223 | Ga0495651_0037952 | 3300046462 | Bacteria | 3751 |
| 224 | Ga0495653_0065443 | 3300046463 | Bacteria | 2736 |
| 225 | Ga0495653_0083043 | 3300046463 | Bacteria | 2363 |
| 226 | Ga0495580_0032931 | 3300046472 | Bacteria | 3735 |
| 227 | Ga0495582_0049844 | 3300046473 | Bacteria | 2306 |
| 228 | Ga0495582_0123464 | 3300046473 | Bacteria | 1460 |
| 229 | Ga0495582_0183755 | 3300046473 | Bacteria | 1192 |
| 230 | Ga0495639_0029892 | 3300046475 | Bacteria | 2420 |
| 231 | Ga0495594_0022597 | 3300046499 | Bacteria | 3365 |
| 232 | Ga0495608_0053763 | 3300046511 | Bacteria | 2663 |
| 233 | Ga0495618_0013969 | 3300046514 | Bacteria | 4888 |
| 234 | Ga0495618_0018469 | 3300046514 | Bacteria | 4280 |
| 235 | Ga0495630_0045795 | 3300046517 | Bacteria | 3269 |
| 236 | Ga0495630_0063714 | 3300046517 | Bacteria | 2769 |
| 237 | Ga0495652_0036251 | 3300046529 | Bacteria | 4290 |
| 238 | Ga0495665_0004788 | 3300046531 | Bacteria | 7306 |
| 239 | Ga0495665_0026306 | 3300046531 | Bacteria | 3125 |
| 240 | Ga0495667_0016585 | 3300046559 | Bacteria | 4973 |
| 241 | Ga0495667_0024844 | 3300046559 | Bacteria | 4035 |
| 242 | Ga0495634_0009466 | 3300046642 | Bacteria | 7184 |
| 243 | Ga0495635_0042341 | 3300046663 | Bacteria | 3144 |
| 244 | Ga0495657_0010398 | 3300046675 | Bacteria | 7003 |
| 245 | Ga0495623_0056889 | 3300046679 | Bacteria | 2461 |
| 246 | Ga0495623_0076315 | 3300046679 | Bacteria | 2079 |
| 247 | Ga0495646_0103975 | 3300046680 | Bacteria | 1624 |
| 248 | Ga0495613_0158008 | 3300046689 | Bacteria | 1614 |
| 249 | Ga0495624_0010277 | 3300046690 | Bacteria | 6449 |
| 250 | Ga0495600_0017148 | 3300046809 | Bacteria | 4604 |
| 251 | Ga0495600_0018934 | 3300046809 | Bacteria | 4394 |
| 252 | Ga0495604_0056021 | 3300047317 | Bacteria | 3036 |
| 253 | Ga0495674_0029762 | 3300047319 | Bacteria | 4969 |
| 254 | Ga0495674_0051031 | 3300047319 | Bacteria | 3647 |
| 255 | Ga0495674_0058158 | 3300047319 | Bacteria | 3381 |
| 256 | Ga0495674_0071511 | 3300047319 | Bacteria | 2994 |
| 257 | Ga0495674_0112463 | 3300047319 | Bacteria | 2307 |
| 258 | Ga0495676_0014280 | 3300047321 | Bacteria | 7107 |
| 259 | Ga0495676_0044963 | 3300047321 | Bacteria | 3599 |
| 260 | Ga0495676_0216931 | 3300047321 | Bacteria | 1320 |
| 261 | Ga0495680_0007877 | 3300047322 | Bacteria | 9723 |
| 262 | Ga0495680_0037526 | 3300047322 | Bacteria | 3880 |
| 263 | Ga0495675_0090345 | 3300047444 | Bacteria | 1922 |
| 264 | Ga0495593_0015042 | 3300047673 | Bacteria | 4395 |
| 265 | Ga0495602_0102606 | 3300048088 | Bacteria | 2343 |
| 266 | Ga0495626_0124974 | 3300048091 | Bacteria | 1103 |
| 267 | Ga0496100_0120685 | 3300048903 | Bacteria | 1833 |
| 268 | Ga0496101_0046973 | 3300048904 | Bacteria | 3098 |
| 269 | Ga0496102_0056599 | 3300048905 | Bacteria | 3577 |
| 270 | Ga0496102_0121501 | 3300048905 | Bacteria | 2440 |
| 271 | Ga0496104_0006666 | 3300048907 | Bacteria | 10162 |
| 272 | Ga0496104_0026154 | 3300048907 | Bacteria | 5384 |
| 273 | Ga0496104_0071041 | 3300048907 | Bacteria | 3310 |
| 274 | Ga0496104_0272734 | 3300048907 | Bacteria | 1604 |
| 275 | Ga0496105_0030571 | 3300048908 | Bacteria | 4412 |
| 276 | Ga0496107_0021094 | 3300048910 | Bacteria | 4603 |
| 277 | Ga0496107_0026680 | 3300048910 | Bacteria | 4097 |
| 278 | Ga0496108_0000428 | 3300048911 | Bacteria | 33965 |
| 279 | Ga0496108_0004518 | 3300048911 | Bacteria | 11209 |
| 280 | Ga0496108_0064901 | 3300048911 | Bacteria | 3076 |
| 281 | Ga0496108_0214107 | 3300048911 | Bacteria | 1673 |
| 282 | Ga0496109_0003640 | 3300048912 | Bacteria | 12876 |
| 283 | Ga0496109_0007847 | 3300048912 | Bacteria | 9041 |
| 284 | Ga0496109_0020585 | 3300048912 | Bacteria | 5827 |
| 285 | Ga0496109_0111403 | 3300048912 | Bacteria | 2545 |
| 286 | Ga0496109_0163403 | 3300048912 | Bacteria | 2086 |
| 287 | Ga0496109_0226048 | 3300048912 | Bacteria | 1760 |
| 288 | Ga0496110_0020384 | 3300048913 | Bacteria | 5599 |
| 289 | Ga0496110_0023269 | 3300048913 | Bacteria | 5267 |
| 290 | Ga0496110_0062049 | 3300048913 | Bacteria | 3300 |
| 291 | Ga0496110_0066163 | 3300048913 | Bacteria | 3196 |
| 292 | Ga0496110_0121336 | 3300048913 | Bacteria | 2355 |
| 293 | Ga0496110_0261565 | 3300048913 | Bacteria | 1575 |
| 294 | Ga0496110_0290596 | 3300048913 | Bacteria | 1489 |
| 295 | Ga0496111_0001255 | 3300048914 | Bacteria | 14197 |
| 296 | Ga0496111_0012674 | 3300048914 | Bacteria | 5713 |
| 297 | Ga0496111_0049390 | 3300048914 | Bacteria | 3033 |
| 298 | Ga0496111_0070565 | 3300048914 | Bacteria | 2541 |
| 299 | Ga0496112_0006452 | 3300048915 | Bacteria | 10296 |
| 300 | Ga0496112_0008148 | 3300048915 | Bacteria | 9364 |
| 301 | Ga0496112_0028553 | 3300048915 | Bacteria | 5386 |
| 302 | Ga0496113_0039383 | 3300048916 | Bacteria | 3479 |
| 303 | Ga0496114_0009353 | 3300048917 | Bacteria | 7778 |
| 304 | Ga0496114_0605336 | 3300048917 | Bacteria | 966 |
| 305 | Ga0501036_0103874 | 3300049572 | Bacteria | 2403 |
| 306 | Ga0501067_0103210 | 3300049583 | Bacteria | 1584 |
| 307 | Ga0501069_0190556 | 3300049585 | Bacteria | 1186 |
| 308 | Ga0501076_0107173 | 3300049592 | Bacteria | 2256 |
| 309 | Ga0501076_0259354 | 3300049592 | Bacteria | 1423 |
| 310 | Ga0501079_0255009 | 3300049741 | Bacteria | 1371 |
| 311 | Ga0501080_0040676 | 3300049742 | Bacteria | 4336 |
| 312 | Ga0501080_0084913 | 3300049742 | Bacteria | 2942 |
| 313 | Ga0501080_0227656 | 3300049742 | Bacteria | 1705 |
| 314 | nmdc:mga05p37_704420_c1 | 3300050507 | Bacteria | 1121 |
| 315 | nmdc:mga06r32_210909_c1 | 3300050510 | Bacteria | 1930 |
| 316 | nmdc:mga08y16_11103_c1 | 3300050511 | Bacteria | 9458 |
| 317 | nmdc:mga08y16_45293_c1 | 3300050511 | Bacteria | 4609 |
| 318 | nmdc:mga08y16_69489_c1 | 3300050511 | Bacteria | 3672 |
| 319 | nmdc:mga0n895_181108_c1 | 3300050512 | Bacteria | 2138 |
| 320 | nmdc:mga0n895_64254_c1 | 3300050512 | Bacteria | 3631 |
| 321 | nmdc:mga0rr50_6861_c1 | 3300050513 | Bacteria | 6980 |
| 322 | nmdc:mga08x19_1666_c1 | 3300050514 | Bacteria | 13702 |
| 323 | nmdc:mga0a205_7419_c1 | 3300050515 | Bacteria | 9932 |
| 324 | Ga0495595_0017967 | 3300053084 | Bacteria | 3049 |
| 325 | Ga0501084_0241150 | 3300054114 | Bacteria | 1526 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0605336 | Ga0496114_0605336_11_841 | 265 |
| 2 | 3300044694 | Ga0466963_0146214 | Ga0466963_0146214_55_1158 | 288 |
| 3 | 3300044842 | Ga0466957_0084343 | Ga0466957_0084343_66_1169 | 288 |
| 4 | 3300049742 | Ga0501080_0227656 | Ga0501080_0227656_97_990 | 297 |
| 5 | 3300006163 | Ga0070715_10027437 | Ga0070715_100274372 | 303 |
| 6 | 3300025905 | Ga0207685_10001630 | Ga0207685_100016302 | 303 |
| 7 | 3300048903 | Ga0496100_0120685 | Ga0496100_0120685_351_1424 | 303 |
| 8 | 3300048904 | Ga0496101_0046973 | Ga0496101_0046973_1192_2265 | 303 |
| 9 | 3300048905 | Ga0496102_0056599 | Ga0496102_0056599_1246_2319 | 303 |
| 10 | 3300048907 | Ga0496104_0026154 | Ga0496104_0026154_1983_3056 | 303 |
| 11 | 3300048908 | Ga0496105_0030571 | Ga0496105_0030571_3281_4354 | 303 |
| 12 | 3300048910 | Ga0496107_0026680 | Ga0496107_0026680_1173_2246 | 303 |
| 13 | 3300048911 | Ga0496108_0064901 | Ga0496108_0064901_1864_2937 | 303 |
| 14 | 3300048913 | Ga0496110_0062049 | Ga0496110_0062049_1710_2783 | 303 |
| 15 | 3300048914 | Ga0496111_0049390 | Ga0496111_0049390_1293_2366 | 303 |
| 16 | 3300048917 | Ga0496114_0009353 | Ga0496114_0009353_1083_2156 | 303 |
| 17 | 3300005616 | Ga0068852_100172123 | Ga0068852_1001721232 | 304 |
| 18 | 3300013105 | Ga0157369_10040115 | Ga0157369_100401151 | 305 |
| 19 | 3300026078 | Ga0207702_10104974 | Ga0207702_101049742 | 308 |
| 20 | 3300048912 | Ga0496109_0226048 | Ga0496109_0226048_522_1553 | 309 |
| 21 | 3300014325 | Ga0163163_10236924 | Ga0163163_102369242 | 310 |
| 22 | 3300048916 | Ga0496113_0039383 | Ga0496113_0039383_1789_2820 | 311 |
| 23 | 3300005985 | Ga0081539_10005570 | Ga0081539_1000557012 | 313 |
| 24 | 3300025945 | Ga0207679_10172353 | Ga0207679_101723532 | 313 |
| 25 | 3300005329 | Ga0070683_100215284 | Ga0070683_1002152842 | 315 |
| 26 | 3300005329 | Ga0070683_100001314 | Ga0070683_10000131417 | 316 |
| 27 | 3300005535 | Ga0070684_100021842 | Ga0070684_1000218426 | 316 |
| 28 | 3300005577 | Ga0068857_100051260 | Ga0068857_1000512604 | 316 |
| 29 | 3300025944 | Ga0207661_10002079 | Ga0207661_1000207912 | 316 |
| 30 | 3300026116 | Ga0207674_10062896 | Ga0207674_100628962 | 316 |
| 31 | 3300005327 | Ga0070658_10021571 | Ga0070658_100215712 | 320 |
| 32 | 3300005329 | Ga0070683_100002720 | Ga0070683_1000027206 | 320 |
| 33 | 3300005339 | Ga0070660_100005101 | Ga0070660_10000510111 | 320 |
| 34 | 3300005344 | Ga0070661_100185640 | Ga0070661_1001856402 | 320 |
| 35 | 3300005458 | Ga0070681_10023661 | Ga0070681_100236616 | 320 |
| 36 | 3300005530 | Ga0070679_100142179 | Ga0070679_1001421792 | 320 |
| 37 | 3300005535 | Ga0070684_100035231 | Ga0070684_1000352313 | 320 |
| 38 | 3300005563 | Ga0068855_100171078 | Ga0068855_1001710782 | 320 |
| 39 | 3300005577 | Ga0068857_100112830 | Ga0068857_1001128302 | 320 |
| 40 | 3300009093 | Ga0105240_10161054 | Ga0105240_101610543 | 320 |
| 41 | 3300013307 | Ga0157372_10297677 | Ga0157372_102976772 | 320 |
| 42 | 3300020070 | Ga0206356_10895433 | Ga0206356_108954332 | 320 |
| 43 | 3300025909 | Ga0207705_10050254 | Ga0207705_100502542 | 320 |
| 44 | 3300025919 | Ga0207657_10000046 | Ga0207657_10000046116 | 320 |
| 45 | 3300025921 | Ga0207652_10104095 | Ga0207652_101040952 | 320 |
| 46 | 3300035117 | Ga0373953_0089742 | Ga0373953_0089742_246_1229 | 321 |
| 47 | 3300035172 | Ga0373955_0071067 | Ga0373955_0071067_54_1037 | 321 |
| 48 | 3300046462 | Ga0495651_0016022 | Ga0495651_0016022_1541_2524 | 321 |
| 49 | 3300046463 | Ga0495653_0065443 | Ga0495653_0065443_1050_2033 | 321 |
| 50 | 3300046517 | Ga0495630_0045795 | Ga0495630_0045795_1568_2551 | 321 |
| 51 | 3300046529 | Ga0495652_0036251 | Ga0495652_0036251_1487_2470 | 321 |
| 52 | 3300046559 | Ga0495667_0016585 | Ga0495667_0016585_3754_4737 | 321 |
| 53 | 3300046663 | Ga0495635_0042341 | Ga0495635_0042341_1480_2463 | 321 |
| 54 | 3300046675 | Ga0495657_0010398 | Ga0495657_0010398_4597_5580 | 321 |
| 55 | 3300046679 | Ga0495623_0056889 | Ga0495623_0056889_812_1795 | 321 |
| 56 | 3300046809 | Ga0495600_0018934 | Ga0495600_0018934_2446_3429 | 321 |
| 57 | 3300047317 | Ga0495604_0056021 | Ga0495604_0056021_1681_2664 | 321 |
| 58 | 3300047319 | Ga0495674_0058158 | Ga0495674_0058158_187_1170 | 321 |
| 59 | 3300047322 | Ga0495680_0037526 | Ga0495680_0037526_2497_3480 | 321 |
| 60 | 3300047444 | Ga0495675_0090345 | Ga0495675_0090345_542_1525 | 321 |
| 61 | 3300048088 | Ga0495602_0102606 | Ga0495602_0102606_65_1048 | 321 |
| 62 | 3300053084 | Ga0495595_0017967 | Ga0495595_0017967_762_1745 | 321 |
| 63 | 3300028563 | Ga0265319_1030465 | Ga0265319_10304651 | 322 |
| 64 | 3300033179 | Ga0307507_10001261 | Ga0307507_1000126147 | 322 |
| 65 | 3300038443 | Ga0395901_0145842 | Ga0395901_0145842_1256_2248 | 322 |
| 66 | 3300046514 | Ga0495618_0013969 | Ga0495618_0013969_3721_4773 | 322 |
| 67 | 3300005617 | Ga0068859_100178537 | Ga0068859_1001785372 | 323 |
| 68 | 3300005983 | Ga0081540_1013801 | Ga0081540_10138012 | 323 |
| 69 | 3300006931 | Ga0097620_100178530 | Ga0097620_1001785302 | 323 |
| 70 | 3300048913 | Ga0496110_0290596 | Ga0496110_0290596_277_1290 | 323 |
| 71 | 3300005445 | Ga0070708_100000274 | Ga0070708_10000027419 | 324 |
| 72 | 3300005467 | Ga0070706_100096847 | Ga0070706_1000968473 | 324 |
| 73 | 3300005471 | Ga0070698_100123179 | Ga0070698_1001231794 | 324 |
| 74 | 3300025920 | Ga0207649_10204433 | Ga0207649_102044332 | 324 |
| 75 | 3300009553 | Ga0105249_10121344 | Ga0105249_101213444 | 325 |
| 76 | 3300025913 | Ga0207695_10077245 | Ga0207695_100772452 | 325 |
| 77 | 3300031731 | Ga0307405_10165238 | Ga0307405_101652382 | 325 |
| 78 | 3300041404 | Ga0439436_0028155 | Ga0439436_0028155_173_1207 | 325 |
| 79 | 3300041406 | Ga0439439_0000087 | Ga0439439_0000087_9941_10975 | 325 |
| 80 | 3300042435 | Ga0439434_0003263 | Ga0439434_0003263_26_1060 | 325 |
| 81 | 3300044658 | Ga0466972_0018788 | Ga0466972_0018788_1170_2231 | 326 |
| 82 | 3300049585 | Ga0501069_0190556 | Ga0501069_0190556_96_1115 | 326 |
| 83 | 3300049742 | Ga0501080_0040676 | Ga0501080_0040676_2025_3044 | 326 |
| 84 | 3300050507 | nmdc:mga05p37_704420_c1 | nmdc:mga05p37_704420_c1_15_1046 | 326 |
| 85 | 3300002077 | JGI24744J21845_10001083 | JGI24744J21845_100010832 | 327 |
| 86 | 3300005366 | Ga0070659_100045519 | Ga0070659_1000455193 | 327 |
| 87 | 3300005438 | Ga0070701_10004998 | Ga0070701_100049984 | 327 |
| 88 | 3300005441 | Ga0070700_100002344 | Ga0070700_1000023445 | 327 |
| 89 | 3300005456 | Ga0070678_100000442 | Ga0070678_10000044211 | 327 |
| 90 | 3300005539 | Ga0068853_100008817 | Ga0068853_1000088175 | 327 |
| 91 | 3300005544 | Ga0070686_100002207 | Ga0070686_1000022074 | 327 |
| 92 | 3300005614 | Ga0068856_100005584 | Ga0068856_1000055842 | 327 |
| 93 | 3300005616 | Ga0068852_100013729 | Ga0068852_1000137292 | 327 |
| 94 | 3300005718 | Ga0068866_10003564 | Ga0068866_100035645 | 327 |
| 95 | 3300009094 | Ga0111539_10018782 | Ga0111539_1001878210 | 327 |
| 96 | 3300009098 | Ga0105245_10528546 | Ga0105245_105285462 | 327 |
| 97 | 3300009147 | Ga0114129_10005080 | Ga0114129_1000508014 | 327 |
| 98 | 3300009148 | Ga0105243_10009361 | Ga0105243_100093614 | 327 |
| 99 | 3300009174 | Ga0105241_10037354 | Ga0105241_100373542 | 327 |
| 100 | 3300009553 | Ga0105249_10000948 | Ga0105249_1000094816 | 327 |
| 101 | 3300013297 | Ga0157378_10225101 | Ga0157378_102251012 | 327 |
| 102 | 3300014326 | Ga0157380_10009040 | Ga0157380_100090404 | 327 |
| 103 | 3300025914 | Ga0207671_10071136 | Ga0207671_100711362 | 327 |
| 104 | 3300025935 | Ga0207709_10002743 | Ga0207709_100027438 | 327 |
| 105 | 3300025961 | Ga0207712_10010539 | Ga0207712_100105395 | 327 |
| 106 | 3300026035 | Ga0207703_10090226 | Ga0207703_100902262 | 327 |
| 107 | 3300026075 | Ga0207708_10000564 | Ga0207708_100005645 | 327 |
| 108 | 3300026118 | Ga0207675_100076994 | Ga0207675_1000769942 | 327 |
| 109 | 3300026121 | Ga0207683_10000251 | Ga0207683_1000025134 | 327 |
| 110 | 3300050511 | nmdc:mga08y16_11103_c1 | nmdc:mga08y16_11103_c1_296_1312 | 327 |
| 111 | iso_pu_bacteria | 3000405567 | 3000409191 | 327 |
| 112 | 3300005985 | Ga0081539_10051734 | Ga0081539_100517342 | 328 |
| 113 | 3300037312 | Ga0395899_0093024 | Ga0395899_0093024_277_1278 | 328 |
| 114 | 3300046689 | Ga0495613_0158008 | Ga0495613_0158008_474_1493 | 328 |
| 115 | 3300047319 | Ga0495674_0071511 | Ga0495674_0071511_1223_2242 | 328 |
| 116 | 3300047322 | Ga0495680_0007877 | Ga0495680_0007877_4326_5345 | 328 |
| 117 | 3300049742 | Ga0501080_0084913 | Ga0501080_0084913_1053_2090 | 328 |
| 118 | 3300037418 | Ga0395900_0005855 | Ga0395900_0005855_10642_11643 | 329 |
| 119 | 3300037466 | Ga0395898_0102231 | Ga0395898_0102231_1213_2214 | 329 |
| 120 | 3300037471 | Ga0395905_0069142 | Ga0395905_0069142_1105_2106 | 329 |
| 121 | 3300038443 | Ga0395901_0116934 | Ga0395901_0116934_583_1584 | 329 |
| 122 | 3300048907 | Ga0496104_0071041 | Ga0496104_0071041_488_1528 | 329 |
| 123 | 3300048911 | Ga0496108_0004518 | Ga0496108_0004518_9228_10268 | 329 |
| 124 | 3300048912 | Ga0496109_0020585 | Ga0496109_0020585_3623_4663 | 329 |
| 125 | 3300048913 | Ga0496110_0066163 | Ga0496110_0066163_1894_2934 | 329 |
| 126 | 3300048914 | Ga0496111_0070565 | Ga0496111_0070565_1129_2169 | 329 |
| 127 | 3300048915 | Ga0496112_0028553 | Ga0496112_0028553_1916_2956 | 329 |
| 128 | 3300005355 | Ga0070671_100116020 | Ga0070671_1001160202 | 330 |
| 129 | 3300005367 | Ga0070667_100187530 | Ga0070667_1001875302 | 330 |
| 130 | 3300025961 | Ga0207712_10080197 | Ga0207712_100801972 | 330 |
| 131 | 3300025986 | Ga0207658_10159965 | Ga0207658_101599652 | 330 |
| 132 | 3300044656 | Ga0466969_0009763 | Ga0466969_0009763_3075_4199 | 330 |
| 133 | 3300044693 | Ga0466961_0018128 | Ga0466961_0018128_562_1686 | 330 |
| 134 | 3300045976 | Ga0466967_0027207 | Ga0466967_0027207_618_1682 | 330 |
| 135 | 3300005354 | Ga0070675_100036789 | Ga0070675_1000367892 | 331 |
| 136 | 3300005366 | Ga0070659_100185812 | Ga0070659_1001858122 | 331 |
| 137 | 3300005436 | Ga0070713_100057202 | Ga0070713_1000572023 | 331 |
| 138 | 3300005547 | Ga0070693_100024550 | Ga0070693_1000245503 | 331 |
| 139 | 3300006847 | Ga0075431_100031487 | Ga0075431_1000314875 | 331 |
| 140 | 3300006852 | Ga0075433_10077746 | Ga0075433_100777462 | 331 |
| 141 | 3300006871 | Ga0075434_100069923 | Ga0075434_1000699233 | 331 |
| 142 | 3300006914 | Ga0075436_100002820 | Ga0075436_1000028205 | 331 |
| 143 | 3300007076 | Ga0075435_100001334 | Ga0075435_10000133412 | 331 |
| 144 | 3300009147 | Ga0114129_10001697 | Ga0114129_1000169712 | 331 |
| 145 | 3300035118 | Ga0373954_0078446 | Ga0373954_0078446_338_1420 | 331 |
| 146 | 3300035170 | Ga0373943_0009233 | Ga0373943_0009233_2935_4017 | 331 |
| 147 | 3300035692 | Ga0373935_0019638 | Ga0373935_0019638_272_1354 | 331 |
| 148 | 3300035725 | Ga0373947_0011160 | Ga0373947_0011160_1286_2368 | 331 |
| 149 | 3300037068 | Ga0373925_0015963 | Ga0373925_0015963_1156_2238 | 331 |
| 150 | 3300037466 | Ga0395898_0004625 | Ga0395898_0004625_3633_4685 | 331 |
| 151 | 3300038443 | Ga0395901_0012797 | Ga0395901_0012797_722_1774 | 331 |
| 152 | 3300046455 | Ga0495603_0023321 | Ga0495603_0023321_1922_3004 | 331 |
| 153 | 3300046461 | Ga0495641_0010751 | Ga0495641_0010751_511_1593 | 331 |
| 154 | 3300046462 | Ga0495651_0037952 | Ga0495651_0037952_112_1194 | 331 |
| 155 | 3300046463 | Ga0495653_0083043 | Ga0495653_0083043_314_1396 | 331 |
| 156 | 3300046472 | Ga0495580_0032931 | Ga0495580_0032931_289_1371 | 331 |
| 157 | 3300046473 | Ga0495582_0049844 | Ga0495582_0049844_155_1237 | 331 |
| 158 | 3300046499 | Ga0495594_0022597 | Ga0495594_0022597_522_1604 | 331 |
| 159 | 3300046511 | Ga0495608_0053763 | Ga0495608_0053763_1070_2152 | 331 |
| 160 | 3300046514 | Ga0495618_0018469 | Ga0495618_0018469_303_1385 | 331 |
| 161 | 3300046517 | Ga0495630_0063714 | Ga0495630_0063714_1374_2456 | 331 |
| 162 | 3300046531 | Ga0495665_0004788 | Ga0495665_0004788_2974_4056 | 331 |
| 163 | 3300046559 | Ga0495667_0024844 | Ga0495667_0024844_2482_3564 | 331 |
| 164 | 3300046642 | Ga0495634_0009466 | Ga0495634_0009466_3108_4190 | 331 |
| 165 | 3300046679 | Ga0495623_0076315 | Ga0495623_0076315_917_1999 | 331 |
| 166 | 3300046680 | Ga0495646_0103975 | Ga0495646_0103975_255_1337 | 331 |
| 167 | 3300046690 | Ga0495624_0010277 | Ga0495624_0010277_4101_5183 | 331 |
| 168 | 3300046809 | Ga0495600_0017148 | Ga0495600_0017148_2796_3878 | 331 |
| 169 | 3300047319 | Ga0495674_0029762 | Ga0495674_0029762_3595_4677 | 331 |
| 170 | 3300047319 | Ga0495674_0051031 | Ga0495674_0051031_539_1621 | 331 |
| 171 | 3300047321 | Ga0495676_0216931 | Ga0495676_0216931_48_1130 | 331 |
| 172 | 3300047673 | Ga0495593_0015042 | Ga0495593_0015042_3162_4244 | 331 |
| 173 | 3300049592 | Ga0501076_0259354 | Ga0501076_0259354_172_1224 | 331 |
| 174 | 3300050510 | nmdc:mga06r32_210909_c1 | nmdc:mga06r32_210909_c1_304_1365 | 331 |
| 175 | 3300050512 | nmdc:mga0n895_64254_c1 | nmdc:mga0n895_64254_c1_570_1631 | 331 |
| 176 | 3300050513 | nmdc:mga0rr50_6861_c1 | nmdc:mga0rr50_6861_c1_474_1535 | 331 |
| 177 | 3300050514 | nmdc:mga08x19_1666_c1 | nmdc:mga08x19_1666_c1_4264_5325 | 331 |
| 178 | 3300050515 | nmdc:mga0a205_7419_c1 | nmdc:mga0a205_7419_c1_7617_8678 | 331 |
| 179 | 3300005471 | Ga0070698_100146382 | Ga0070698_1001463822 | 332 |
| 180 | 3300005471 | Ga0070698_100151371 | Ga0070698_1001513712 | 332 |
| 181 | 3300005518 | Ga0070699_100079796 | Ga0070699_1000797962 | 332 |
| 182 | 3300005937 | Ga0081455_10053793 | Ga0081455_100537934 | 332 |
| 183 | 3300005983 | Ga0081540_1002305 | Ga0081540_100230513 | 332 |
| 184 | 3300005985 | Ga0081539_10004748 | Ga0081539_100047489 | 332 |
| 185 | 3300009098 | Ga0105245_10005239 | Ga0105245_100052393 | 332 |
| 186 | 3300013307 | Ga0157372_10567538 | Ga0157372_105675381 | 332 |
| 187 | 3300014326 | Ga0157380_10034922 | Ga0157380_100349222 | 332 |
| 188 | 3300031903 | Ga0307407_10026476 | Ga0307407_100264762 | 332 |
| 189 | 3300031995 | Ga0307409_100012598 | Ga0307409_1000125985 | 332 |
| 190 | 3300032002 | Ga0307416_100051619 | Ga0307416_1000516193 | 332 |
| 191 | 3300032126 | Ga0307415_100122867 | Ga0307415_1001228671 | 332 |
| 192 | 3300037418 | Ga0395900_0104876 | Ga0395900_0104876_61_1080 | 332 |
| 193 | 3300037466 | Ga0395898_0006779 | Ga0395898_0006779_2021_3040 | 332 |
| 194 | 3300037471 | Ga0395905_0010578 | Ga0395905_0010578_1154_2206 | 332 |
| 195 | 3300037471 | Ga0395905_0012731 | Ga0395905_0012731_3927_4946 | 332 |
| 196 | 3300038443 | Ga0395901_0023578 | Ga0395901_0023578_3737_4789 | 332 |
| 197 | 3300038443 | Ga0395901_0048180 | Ga0395901_0048180_3215_4234 | 332 |
| 198 | 3300041410 | Ga0439461_0007682 | Ga0439461_0007682_117_1154 | 332 |
| 199 | 3300042009 | Ga0439451_003236 | Ga0439451_003236_2208_3284 | 332 |
| 200 | 3300046461 | Ga0495641_0092106 | Ga0495641_0092106_271_1341 | 332 |
| 201 | 3300047321 | Ga0495676_0044963 | Ga0495676_0044963_2269_3339 | 332 |
| 202 | 3300048907 | Ga0496104_0006666 | Ga0496104_0006666_7057_8115 | 332 |
| 203 | 3300048911 | Ga0496108_0000428 | Ga0496108_0000428_6437_7495 | 332 |
| 204 | 3300048911 | Ga0496108_0214107 | Ga0496108_0214107_561_1625 | 332 |
| 205 | 3300048912 | Ga0496109_0003640 | Ga0496109_0003640_3996_5054 | 332 |
| 206 | 3300048913 | Ga0496110_0023269 | Ga0496110_0023269_3223_4281 | 332 |
| 207 | 3300048914 | Ga0496111_0001255 | Ga0496111_0001255_11090_12148 | 332 |
| 208 | 3300048915 | Ga0496112_0006452 | Ga0496112_0006452_1200_2264 | 332 |
| 209 | 3300048915 | Ga0496112_0008148 | Ga0496112_0008148_1008_2066 | 332 |
| 210 | 3300049572 | Ga0501036_0103874 | Ga0501036_0103874_639_1655 | 332 |
| 211 | 3300049583 | Ga0501067_0103210 | Ga0501067_0103210_313_1314 | 332 |
| 212 | 3300050511 | nmdc:mga08y16_45293_c1 | nmdc:mga08y16_45293_c1_945_2030 | 332 |
| 213 | 3300006847 | Ga0075431_100187875 | Ga0075431_1001878752 | 333 |
| 214 | 3300009147 | Ga0114129_10177886 | Ga0114129_101778862 | 333 |
| 215 | 3300037466 | Ga0395898_0227644 | Ga0395898_0227644_285_1319 | 333 |
| 216 | 3300037471 | Ga0395905_0204101 | Ga0395905_0204101_269_1300 | 333 |
| 217 | 3300046455 | Ga0495603_0056934 | Ga0495603_0056934_713_1747 | 333 |
| 218 | 3300046461 | Ga0495641_0033609 | Ga0495641_0033609_476_1510 | 333 |
| 219 | 3300048912 | Ga0496109_0111403 | Ga0496109_0111403_717_1751 | 333 |
| 220 | 3300048913 | Ga0496110_0261565 | Ga0496110_0261565_166_1200 | 333 |
| 221 | 3300045836 | Ga0466958_0109113 | Ga0466958_0109113_647_1705 | 334 |
| 222 | 3300047319 | Ga0495674_0112463 | Ga0495674_0112463_313_1353 | 334 |
| 223 | 3300025927 | Ga0207687_10063597 | Ga0207687_100635973 | 335 |
| 224 | 3300025939 | Ga0207665_10026255 | Ga0207665_100262553 | 335 |
| 225 | 3300031824 | Ga0307413_10115225 | Ga0307413_101152252 | 335 |
| 226 | 3300046473 | Ga0495582_0123464 | Ga0495582_0123464_275_1315 | 335 |
| 227 | 3300046475 | Ga0495639_0029892 | Ga0495639_0029892_847_1887 | 335 |
| 228 | 3300046531 | Ga0495665_0026306 | Ga0495665_0026306_594_1634 | 335 |
| 229 | 3300047321 | Ga0495676_0014280 | Ga0495676_0014280_5716_6756 | 335 |
| 230 | 3300001991 | JGI24743J22301_10002140 | JGI24743J22301_100021402 | 336 |
| 231 | 3300002075 | JGI24738J21930_10008228 | JGI24738J21930_100082282 | 336 |
| 232 | 3300005333 | Ga0070677_10079015 | Ga0070677_100790152 | 336 |
| 233 | 3300005337 | Ga0070682_100149845 | Ga0070682_1001498452 | 336 |
| 234 | 3300005341 | Ga0070691_10019897 | Ga0070691_100198972 | 336 |
| 235 | 3300005343 | Ga0070687_100112640 | Ga0070687_1001126402 | 336 |
| 236 | 3300005345 | Ga0070692_10198849 | Ga0070692_101988492 | 336 |
| 237 | 3300005347 | Ga0070668_100129114 | Ga0070668_1001291141 | 336 |
| 238 | 3300005356 | Ga0070674_100220603 | Ga0070674_1002206032 | 336 |
| 239 | 3300005364 | Ga0070673_100088733 | Ga0070673_1000887332 | 336 |
| 240 | 3300005364 | Ga0070673_100150073 | Ga0070673_1001500732 | 336 |
| 241 | 3300005366 | Ga0070659_100189685 | Ga0070659_1001896852 | 336 |
| 242 | 3300005367 | Ga0070667_100232689 | Ga0070667_1002326892 | 336 |
| 243 | 3300005441 | Ga0070700_100282021 | Ga0070700_1002820212 | 336 |
| 244 | 3300005466 | Ga0070685_10003169 | Ga0070685_100031693 | 336 |
| 245 | 3300005530 | Ga0070679_100288855 | Ga0070679_1002888551 | 336 |
| 246 | 3300005543 | Ga0070672_100031722 | Ga0070672_1000317223 | 336 |
| 247 | 3300005549 | Ga0070704_100085349 | Ga0070704_1000853492 | 336 |
| 248 | 3300005563 | Ga0068855_100325645 | Ga0068855_1003256452 | 336 |
| 249 | 3300005578 | Ga0068854_100079368 | Ga0068854_1000793682 | 336 |
| 250 | 3300005615 | Ga0070702_100029409 | Ga0070702_1000294093 | 336 |
| 251 | 3300005617 | Ga0068859_100294916 | Ga0068859_1002949162 | 336 |
| 252 | 3300005718 | Ga0068866_10042259 | Ga0068866_100422592 | 336 |
| 253 | 3300005834 | Ga0068851_10021310 | Ga0068851_100213102 | 336 |
| 254 | 3300005843 | Ga0068860_100148798 | Ga0068860_1001487982 | 336 |
| 255 | 3300005843 | Ga0068860_100345953 | Ga0068860_1003459532 | 336 |
| 256 | 3300006881 | Ga0068865_100009066 | Ga0068865_1000090664 | 336 |
| 257 | 3300006931 | Ga0097620_100294908 | Ga0097620_1002949082 | 336 |
| 258 | 3300009148 | Ga0105243_10012002 | Ga0105243_100120024 | 336 |
| 259 | 3300009148 | Ga0105243_10033694 | Ga0105243_100336942 | 336 |
| 260 | 3300009176 | Ga0105242_10030369 | Ga0105242_100303691 | 336 |
| 261 | 3300009176 | Ga0105242_10145308 | Ga0105242_101453082 | 336 |
| 262 | 3300009177 | Ga0105248_10109754 | Ga0105248_101097542 | 336 |
| 263 | 3300009551 | Ga0105238_10279701 | Ga0105238_102797012 | 336 |
| 264 | 3300009553 | Ga0105249_10087232 | Ga0105249_100872322 | 336 |
| 265 | 3300010375 | Ga0105239_10105117 | Ga0105239_101051173 | 336 |
| 266 | 3300013105 | Ga0157369_10127166 | Ga0157369_101271662 | 336 |
| 267 | 3300013296 | Ga0157374_10066243 | Ga0157374_100662432 | 336 |
| 268 | 3300013306 | Ga0163162_10157998 | Ga0163162_101579982 | 336 |
| 269 | 3300014325 | Ga0163163_10193980 | Ga0163163_101939802 | 336 |
| 270 | 3300014326 | Ga0157380_10020199 | Ga0157380_100201995 | 336 |
| 271 | 3300014969 | Ga0157376_10016665 | Ga0157376_100166654 | 336 |
| 272 | 3300017792 | Ga0163161_10022677 | Ga0163161_100226773 | 336 |
| 273 | 3300025321 | Ga0207656_10042450 | Ga0207656_100424502 | 336 |
| 274 | 3300025901 | Ga0207688_10033230 | Ga0207688_100332303 | 336 |
| 275 | 3300025907 | Ga0207645_10036701 | Ga0207645_100367013 | 336 |
| 276 | 3300025908 | Ga0207643_10003044 | Ga0207643_100030444 | 336 |
| 277 | 3300025909 | Ga0207705_10079690 | Ga0207705_100796902 | 336 |
| 278 | 3300025912 | Ga0207707_10104569 | Ga0207707_101045692 | 336 |
| 279 | 3300025914 | Ga0207671_10187270 | Ga0207671_101872702 | 336 |
| 280 | 3300025918 | Ga0207662_10149361 | Ga0207662_101493612 | 336 |
| 281 | 3300025919 | Ga0207657_10007888 | Ga0207657_100078887 | 336 |
| 282 | 3300025924 | Ga0207694_10040965 | Ga0207694_100409652 | 336 |
| 283 | 3300025926 | Ga0207659_10188379 | Ga0207659_101883792 | 336 |
| 284 | 3300025927 | Ga0207687_10309667 | Ga0207687_103096672 | 336 |
| 285 | 3300025931 | Ga0207644_10073525 | Ga0207644_100735252 | 336 |
| 286 | 3300025932 | Ga0207690_10220788 | Ga0207690_102207882 | 336 |
| 287 | 3300025933 | Ga0207706_10011233 | Ga0207706_100112333 | 336 |
| 288 | 3300025934 | Ga0207686_10122144 | Ga0207686_101221442 | 336 |
| 289 | 3300025935 | Ga0207709_10019249 | Ga0207709_100192492 | 336 |
| 290 | 3300025938 | Ga0207704_10061730 | Ga0207704_100617302 | 336 |
| 291 | 3300025940 | Ga0207691_10006210 | Ga0207691_100062107 | 336 |
| 292 | 3300025940 | Ga0207691_10027491 | Ga0207691_100274912 | 336 |
| 293 | 3300025944 | Ga0207661_10064207 | Ga0207661_100642073 | 336 |
| 294 | 3300025961 | Ga0207712_10334613 | Ga0207712_103346132 | 336 |
| 295 | 3300025981 | Ga0207640_10069177 | Ga0207640_100691772 | 336 |
| 296 | 3300026023 | Ga0207677_10247377 | Ga0207677_102473772 | 336 |
| 297 | 3300026023 | Ga0207677_10315403 | Ga0207677_103154032 | 336 |
| 298 | 3300026067 | Ga0207678_10104692 | Ga0207678_101046922 | 336 |
| 299 | 3300026075 | Ga0207708_10031362 | Ga0207708_100313624 | 336 |
| 300 | 3300026075 | Ga0207708_10222942 | Ga0207708_102229422 | 336 |
| 301 | 3300026088 | Ga0207641_10028632 | Ga0207641_100286322 | 336 |
| 302 | 3300026089 | Ga0207648_10061197 | Ga0207648_100611971 | 336 |
| 303 | 3300026118 | Ga0207675_100018916 | Ga0207675_1000189165 | 336 |
| 304 | 3300026121 | Ga0207683_10022439 | Ga0207683_100224391 | 336 |
| 305 | 3300026121 | Ga0207683_10036927 | Ga0207683_100369274 | 336 |
| 306 | 3300027907 | Ga0207428_10096939 | Ga0207428_100969392 | 336 |
| 307 | 3300028379 | Ga0268266_10495447 | Ga0268266_104954472 | 336 |
| 308 | 3300034817 | Ga0373948_0004852 | Ga0373948_0004852_1031_2041 | 336 |
| 309 | 3300035092 | Ga0373952_0021533 | Ga0373952_0021533_276_1286 | 336 |
| 310 | 3300035115 | Ga0373941_0011213 | Ga0373941_0011213_498_1508 | 336 |
| 311 | 3300035691 | Ga0373931_0105791 | Ga0373931_0105791_162_1172 | 336 |
| 312 | 3300046473 | Ga0495582_0183755 | Ga0495582_0183755_11_1021 | 336 |
| 313 | 3300048091 | Ga0495626_0124974 | Ga0495626_0124974_63_1073 | 336 |
| 314 | 3300048905 | Ga0496102_0121501 | Ga0496102_0121501_982_1992 | 336 |
| 315 | 3300048907 | Ga0496104_0272734 | Ga0496104_0272734_479_1489 | 336 |
| 316 | 3300048910 | Ga0496107_0021094 | Ga0496107_0021094_2686_3696 | 336 |
| 317 | 3300048912 | Ga0496109_0007847 | Ga0496109_0007847_3576_4586 | 336 |
| 318 | 3300048912 | Ga0496109_0163403 | Ga0496109_0163403_70_1080 | 336 |
| 319 | 3300048913 | Ga0496110_0020384 | Ga0496110_0020384_1761_2771 | 336 |
| 320 | 3300048913 | Ga0496110_0121336 | Ga0496110_0121336_734_1744 | 336 |
| 321 | 3300048914 | Ga0496111_0012674 | Ga0496111_0012674_4103_5113 | 336 |
| 322 | 3300049592 | Ga0501076_0107173 | Ga0501076_0107173_370_1380 | 336 |
| 323 | 3300049741 | Ga0501079_0255009 | Ga0501079_0255009_41_1051 | 336 |
| 324 | 3300050511 | nmdc:mga08y16_69489_c1 | nmdc:mga08y16_69489_c1_2122_3132 | 336 |
| 325 | 3300050512 | nmdc:mga0n895_181108_c1 | nmdc:mga0n895_181108_c1_362_1372 | 336 |
| 326 | 3300054114 | Ga0501084_0241150 | Ga0501084_0241150_277_1287 | 336 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.961 | 9 | 240 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9488 | 10 | 223 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9476 | 8 | 223 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9461 | 8 | 222 |
| 7nnu-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs | 0.9418 | 8 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.992 | 8 | 223 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9851 | 10 | 222 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9785 | 8 | 223 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9743 | 10 | 241 | 3.40.50.300 |
| af_O69724_1_242_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9682 | 10 | 240 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1A2L0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9846 | 10 | 214 |
GO:0005524
GO:0015423 GO:0016887 GO:0055052 GO:1990060 |
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9843 | 10 | 227 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A2E7V6G1-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9829 | 3 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A534HSD0-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9821 | 3 | 224 |
GO:0005524
GO:0016887 |
| AF-A0A7J3BDG1-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9818 | 10 | 231 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar