F408229

General Info

Members Datasets Scaffolds Average Seq Length
326 214 325 342

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1002305|Ga0081540_100230513
Length 395
Sequence LRRYVGSFAATPCNTLAPTLDAVSQARRAADDARTDGAATPDVRLVDLMRRFADVVAVDAVSLDIARGEFFTLLGPSGSGKTTTLRLVAGFDQPDGGRIELAGADVTSRPPYARDVNTVFQDYALFPHMTVLQNVEYGLRVRRVARDERRRRAEEALAMVRLEGYGARKPAQLSGGQRQRVALARAIVNRPRVLLLDEPLGALDLKLRQEMQTELKRIQGEVGITFVYVTHDQEEALTMSDRLAVFNRGRIEQVGTPAEVYEHPANEFVAGFVGVSNVVERDGRRFTIRPEKVRLLDDGEPGDGLHVESGTVRDVAYVGMVTRYTVELDRGGELQVVRQNLETSSQQAQELRGRRVRVAWHEAQTFAIGRAQAGPASAAHVGRSGTRQDEEEERP

Samples

Sample ID Description Type Environment
1 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.31
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.66
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10002140 3300001991 Bacteria 2915
2 JGI24738J21930_10008228 3300002075 Bacteria 2375
3 JGI24744J21845_10001083 3300002077 Bacteria 5273
4 Ga0070658_10021571 3300005327 Bacteria 5162
5 Ga0070683_100001314 3300005329 Bacteria 18922
6 Ga0070683_100002720 3300005329 Bacteria 14119
7 Ga0070683_100215284 3300005329 Bacteria 1825
8 Ga0070677_10079015 3300005333 Bacteria 1403
9 Ga0070682_100149845 3300005337 Bacteria 1599
10 Ga0070660_100005101 3300005339 Bacteria 9070
11 Ga0070691_10019897 3300005341 Bacteria 3098
12 Ga0070687_100112640 3300005343 Bacteria 1542
13 Ga0070661_100185640 3300005344 Bacteria 1584
14 Ga0070692_10198849 3300005345 Bacteria 1172
15 Ga0070668_100129114 3300005347 Bacteria 2027
16 Ga0070675_100036789 3300005354 Bacteria 3985
17 Ga0070671_100116020 3300005355 Bacteria 2251
18 Ga0070674_100220603 3300005356 Bacteria 1475
19 Ga0070673_100088733 3300005364 Bacteria 2523
20 Ga0070673_100150073 3300005364 Bacteria 1973
21 Ga0070659_100045519 3300005366 Bacteria 3437
22 Ga0070659_100185812 3300005366 Bacteria 1707
23 Ga0070659_100189685 3300005366 Bacteria 1689
24 Ga0070667_100187530 3300005367 Bacteria 1831
25 Ga0070667_100232689 3300005367 Bacteria 1643
26 Ga0070713_100057202 3300005436 Bacteria 3246
27 Ga0070701_10004998 3300005438 Bacteria 5434
28 Ga0070700_100002344 3300005441 Bacteria 9640
29 Ga0070700_100282021 3300005441 Bacteria 1205
30 Ga0070708_100000274 3300005445 Bacteria 38511
31 Ga0070678_100000442 3300005456 Bacteria 19620
32 Ga0070681_10023661 3300005458 Bacteria 6181
33 Ga0070685_10003169 3300005466 Bacteria 8367
34 Ga0070706_100096847 3300005467 Bacteria 2740
35 Ga0070698_100123179 3300005471 Bacteria 2551
36 Ga0070698_100146382 3300005471 Bacteria 2311
37 Ga0070698_100151371 3300005471 Bacteria 2268
38 Ga0070699_100079796 3300005518 Bacteria 2851
39 Ga0070679_100142179 3300005530 Bacteria 2378
40 Ga0070679_100288855 3300005530 Bacteria 1591
41 Ga0070684_100021842 3300005535 Bacteria 5332
42 Ga0070684_100035231 3300005535 Bacteria 4283
43 Ga0068853_100008817 3300005539 Bacteria 8111
44 Ga0070672_100031722 3300005543 Bacteria 3980
45 Ga0070686_100002207 3300005544 Bacteria 10761
46 Ga0070693_100024550 3300005547 Bacteria 3234
47 Ga0070704_100085349 3300005549 Bacteria 2336
48 Ga0068855_100171078 3300005563 Bacteria 2460
49 Ga0068855_100325645 3300005563 Bacteria 1697
50 Ga0068857_100051260 3300005577 Bacteria 3661
51 Ga0068857_100112830 3300005577 Bacteria 2444
52 Ga0068854_100079368 3300005578 Bacteria 2419
53 Ga0068856_100005584 3300005614 Bacteria 12384
54 Ga0070702_100029409 3300005615 Bacteria 2987
55 Ga0068852_100013729 3300005616 Bacteria 6208
56 Ga0068852_100172123 3300005616 Bacteria 2031
57 Ga0068859_100178537 3300005617 Bacteria 2206
58 Ga0068859_100294916 3300005617 Bacteria 1715
59 Ga0068866_10003564 3300005718 Bacteria 6373
60 Ga0068866_10042259 3300005718 Bacteria 2267
61 Ga0068851_10021310 3300005834 Bacteria 3146
62 Ga0068860_100148798 3300005843 Bacteria 2254
63 Ga0068860_100345953 3300005843 Bacteria 1462
64 Ga0081455_10053793 3300005937 Bacteria 3437
65 Ga0081540_1002305 3300005983 Bacteria 15660
66 Ga0081540_1013801 3300005983 Bacteria 5227
67 Ga0081539_10004748 3300005985 Bacteria 14682
68 Ga0081539_10005570 3300005985 Bacteria 12744
69 Ga0081539_10051734 3300005985 Bacteria 2312
70 Ga0070715_10027437 3300006163 Bacteria 2275
71 Ga0075431_100031487 3300006847 Bacteria 5464
72 Ga0075431_100187875 3300006847 Bacteria 2118
73 Ga0075433_10077746 3300006852 Bacteria 2923
74 Ga0075434_100069923 3300006871 Bacteria 3500
75 Ga0068865_100009066 3300006881 Bacteria 6154
76 Ga0075436_100002820 3300006914 Bacteria 11907
77 Ga0097620_100178530 3300006931 Bacteria 2206
78 Ga0097620_100294908 3300006931 Bacteria 1715
79 Ga0075435_100001334 3300007076 Bacteria 15854
80 Ga0105240_10161054 3300009093 Bacteria 2665
81 Ga0111539_10018782 3300009094 Bacteria 8555
82 Ga0105245_10005239 3300009098 Bacteria 11393
83 Ga0105245_10528546 3300009098 Bacteria 1199
84 Ga0114129_10001697 3300009147 Bacteria 30038
85 Ga0114129_10005080 3300009147 Bacteria 18523
86 Ga0114129_10177886 3300009147 Bacteria 2897
87 Ga0105243_10009361 3300009148 Bacteria 7465
88 Ga0105243_10012002 3300009148 Bacteria 6549
89 Ga0105243_10033694 3300009148 Bacteria 3961
90 Ga0105241_10037354 3300009174 Bacteria 3658
91 Ga0105242_10030369 3300009176 Bacteria 4314
92 Ga0105242_10145308 3300009176 Bacteria 2063
93 Ga0105248_10109754 3300009177 Bacteria 3111
94 Ga0105238_10279701 3300009551 Bacteria 1650
95 Ga0105249_10000948 3300009553 Bacteria 25660
96 Ga0105249_10087232 3300009553 Bacteria 2911
97 Ga0105249_10121344 3300009553 Bacteria 2484
98 Ga0105239_10105117 3300010375 Bacteria 3126
99 Ga0157369_10040115 3300013105 Bacteria 5113
100 Ga0157369_10127166 3300013105 Bacteria 2701
101 Ga0157374_10066243 3300013296 Bacteria 3394
102 Ga0157378_10225101 3300013297 Bacteria 1785
103 Ga0163162_10157998 3300013306 Bacteria 2388
104 Ga0157372_10297677 3300013307 Bacteria 1877
105 Ga0157372_10567538 3300013307 Bacteria 1323
106 Ga0163163_10193980 3300014325 Bacteria 2079
107 Ga0163163_10236924 3300014325 Bacteria 1874
108 Ga0157380_10009040 3300014326 Bacteria 7118
109 Ga0157380_10020199 3300014326 Bacteria 4977
110 Ga0157380_10034922 3300014326 Bacteria 3880
111 Ga0157376_10016665 3300014969 Bacteria 5585
112 Ga0163161_10022677 3300017792 Bacteria 4422
113 Ga0206356_10895433 3300020070 Bacteria 2526
114 Ga0207656_10042450 3300025321 Bacteria 1935
115 Ga0207688_10033230 3300025901 Bacteria 2853
116 Ga0207685_10001630 3300025905 Bacteria 4813
117 Ga0207645_10036701 3300025907 Bacteria 3147
118 Ga0207643_10003044 3300025908 Bacteria 9011
119 Ga0207705_10050254 3300025909 Bacteria 3001
120 Ga0207705_10079690 3300025909 Bacteria 2385
121 Ga0207707_10104569 3300025912 Bacteria 2474
122 Ga0207695_10077245 3300025913 Bacteria 3383
123 Ga0207671_10071136 3300025914 Bacteria 2594
124 Ga0207671_10187270 3300025914 Bacteria 1613
125 Ga0207662_10149361 3300025918 Bacteria 1485
126 Ga0207657_10000046 3300025919 Bacteria 113887
127 Ga0207657_10007888 3300025919 Bacteria 10860
128 Ga0207649_10204433 3300025920 Bacteria 1397
129 Ga0207652_10104095 3300025921 Bacteria 2510
130 Ga0207694_10040965 3300025924 Bacteria 3568
131 Ga0207659_10188379 3300025926 Bacteria 1640
132 Ga0207687_10063597 3300025927 Bacteria 2613
133 Ga0207687_10309667 3300025927 Bacteria 1275
134 Ga0207644_10073525 3300025931 Bacteria 2507
135 Ga0207690_10220788 3300025932 Bacteria 1450
136 Ga0207706_10011233 3300025933 Bacteria 8166
137 Ga0207686_10122144 3300025934 Bacteria 1774
138 Ga0207709_10002743 3300025935 Bacteria 10857
139 Ga0207709_10019249 3300025935 Bacteria 3834
140 Ga0207704_10061730 3300025938 Bacteria 2327
141 Ga0207665_10026255 3300025939 Bacteria 3845
142 Ga0207691_10006210 3300025940 Bacteria 11542
143 Ga0207691_10027491 3300025940 Bacteria 5332
144 Ga0207661_10002079 3300025944 Bacteria 13773
145 Ga0207661_10064207 3300025944 Bacteria 2975
146 Ga0207679_10172353 3300025945 Bacteria 1783
147 Ga0207712_10010539 3300025961 Bacteria 5868
148 Ga0207712_10080197 3300025961 Bacteria 2373
149 Ga0207712_10334613 3300025961 Bacteria 1254
150 Ga0207640_10069177 3300025981 Bacteria 2369
151 Ga0207658_10159965 3300025986 Bacteria 1845
152 Ga0207677_10247377 3300026023 Bacteria 1446
153 Ga0207677_10315403 3300026023 Bacteria 1297
154 Ga0207703_10090226 3300026035 Bacteria 2575
155 Ga0207678_10104692 3300026067 Bacteria 2415
156 Ga0207708_10000564 3300026075 Bacteria 28643
157 Ga0207708_10031362 3300026075 Bacteria 4034
158 Ga0207708_10222942 3300026075 Bacteria 1511
159 Ga0207702_10104974 3300026078 Bacteria 2502
160 Ga0207641_10028632 3300026088 Bacteria 4604
161 Ga0207648_10061197 3300026089 Bacteria 3283
162 Ga0207674_10062896 3300026116 Bacteria 3748
163 Ga0207675_100018916 3300026118 Bacteria 6430
164 Ga0207675_100076994 3300026118 Bacteria 3124
165 Ga0207683_10000251 3300026121 Bacteria 47816
166 Ga0207683_10022439 3300026121 Bacteria 5419
167 Ga0207683_10036927 3300026121 Bacteria 4255
168 Ga0207428_10096939 3300027907 Bacteria 2283
169 Ga0268266_10495447 3300028379 Bacteria 1166
170 Ga0265319_1030465 3300028563 Bacteria 1887
171 Ga0307405_10165238 3300031731 Bacteria 1572
172 Ga0307413_10115225 3300031824 Bacteria 1808
173 Ga0307407_10026476 3300031903 Bacteria 3072
174 Ga0307409_100012598 3300031995 Bacteria 5396
175 Ga0307416_100051619 3300032002 Bacteria 3286
176 Ga0307415_100122867 3300032126 Bacteria 1950
177 Ga0307507_10001261 3300033179 Bacteria 56658
178 Ga0373948_0004852 3300034817 Bacteria 2149
179 Ga0373952_0021533 3300035092 Bacteria 1362
180 Ga0373941_0011213 3300035115 Bacteria 2311
181 Ga0373953_0089742 3300035117 Bacteria 1285
182 Ga0373954_0078446 3300035118 Bacteria 1576
183 Ga0373943_0009233 3300035170 Bacteria 4419
184 Ga0373955_0071067 3300035172 Bacteria 1946
185 Ga0373931_0105791 3300035691 Bacteria 1589
186 Ga0373935_0019638 3300035692 Bacteria 4120
187 Ga0373947_0011160 3300035725 Bacteria 5158
188 Ga0373925_0015963 3300037068 Bacteria 5437
189 Ga0395899_0093024 3300037312 Bacteria 2182
190 Ga0395900_0005855 3300037418 Bacteria 12833
191 Ga0395900_0104876 3300037418 Bacteria 2904
192 Ga0395898_0004625 3300037466 Bacteria 15019
193 Ga0395898_0006779 3300037466 Bacteria 12191
194 Ga0395898_0102231 3300037466 Bacteria 2751
195 Ga0395898_0227644 3300037466 Bacteria 1778
196 Ga0395905_0010578 3300037471 Bacteria 8962
197 Ga0395905_0012731 3300037471 Bacteria 8090
198 Ga0395905_0069142 3300037471 Bacteria 3307
199 Ga0395905_0204101 3300037471 Bacteria 1853
200 Ga0395901_0012797 3300038443 Bacteria 8509
201 Ga0395901_0023578 3300038443 Bacteria 6309
202 Ga0395901_0048180 3300038443 Bacteria 4425
203 Ga0395901_0116934 3300038443 Bacteria 2801
204 Ga0395901_0145842 3300038443 Bacteria 2488
205 Ga0439436_0028155 3300041404 Bacteria 1641
206 Ga0439439_0000087 3300041406 Bacteria 12039
207 Ga0439461_0007682 3300041410 Bacteria 1917
208 Ga0439451_003236 3300042009 Bacteria 3306
209 Ga0439434_0003263 3300042435 Bacteria 4763
210 Ga0466969_0009763 3300044656 Bacteria 5087
211 Ga0466972_0018788 3300044658 Bacteria 3454
212 Ga0466961_0018128 3300044693 Bacteria 4527
213 Ga0466963_0146214 3300044694 Bacteria 1640
214 Ga0466957_0084343 3300044842 Bacteria 1983
215 Ga0466958_0109113 3300045836 Bacteria 1727
216 Ga0466967_0027207 3300045976 Bacteria 4754
217 Ga0495603_0023321 3300046455 Bacteria 3747
218 Ga0495603_0056934 3300046455 Bacteria 2313
219 Ga0495641_0010751 3300046461 Bacteria 5271
220 Ga0495641_0033609 3300046461 Bacteria 2433
221 Ga0495641_0092106 3300046461 Bacteria 1354
222 Ga0495651_0016022 3300046462 Bacteria 5806
223 Ga0495651_0037952 3300046462 Bacteria 3751
224 Ga0495653_0065443 3300046463 Bacteria 2736
225 Ga0495653_0083043 3300046463 Bacteria 2363
226 Ga0495580_0032931 3300046472 Bacteria 3735
227 Ga0495582_0049844 3300046473 Bacteria 2306
228 Ga0495582_0123464 3300046473 Bacteria 1460
229 Ga0495582_0183755 3300046473 Bacteria 1192
230 Ga0495639_0029892 3300046475 Bacteria 2420
231 Ga0495594_0022597 3300046499 Bacteria 3365
232 Ga0495608_0053763 3300046511 Bacteria 2663
233 Ga0495618_0013969 3300046514 Bacteria 4888
234 Ga0495618_0018469 3300046514 Bacteria 4280
235 Ga0495630_0045795 3300046517 Bacteria 3269
236 Ga0495630_0063714 3300046517 Bacteria 2769
237 Ga0495652_0036251 3300046529 Bacteria 4290
238 Ga0495665_0004788 3300046531 Bacteria 7306
239 Ga0495665_0026306 3300046531 Bacteria 3125
240 Ga0495667_0016585 3300046559 Bacteria 4973
241 Ga0495667_0024844 3300046559 Bacteria 4035
242 Ga0495634_0009466 3300046642 Bacteria 7184
243 Ga0495635_0042341 3300046663 Bacteria 3144
244 Ga0495657_0010398 3300046675 Bacteria 7003
245 Ga0495623_0056889 3300046679 Bacteria 2461
246 Ga0495623_0076315 3300046679 Bacteria 2079
247 Ga0495646_0103975 3300046680 Bacteria 1624
248 Ga0495613_0158008 3300046689 Bacteria 1614
249 Ga0495624_0010277 3300046690 Bacteria 6449
250 Ga0495600_0017148 3300046809 Bacteria 4604
251 Ga0495600_0018934 3300046809 Bacteria 4394
252 Ga0495604_0056021 3300047317 Bacteria 3036
253 Ga0495674_0029762 3300047319 Bacteria 4969
254 Ga0495674_0051031 3300047319 Bacteria 3647
255 Ga0495674_0058158 3300047319 Bacteria 3381
256 Ga0495674_0071511 3300047319 Bacteria 2994
257 Ga0495674_0112463 3300047319 Bacteria 2307
258 Ga0495676_0014280 3300047321 Bacteria 7107
259 Ga0495676_0044963 3300047321 Bacteria 3599
260 Ga0495676_0216931 3300047321 Bacteria 1320
261 Ga0495680_0007877 3300047322 Bacteria 9723
262 Ga0495680_0037526 3300047322 Bacteria 3880
263 Ga0495675_0090345 3300047444 Bacteria 1922
264 Ga0495593_0015042 3300047673 Bacteria 4395
265 Ga0495602_0102606 3300048088 Bacteria 2343
266 Ga0495626_0124974 3300048091 Bacteria 1103
267 Ga0496100_0120685 3300048903 Bacteria 1833
268 Ga0496101_0046973 3300048904 Bacteria 3098
269 Ga0496102_0056599 3300048905 Bacteria 3577
270 Ga0496102_0121501 3300048905 Bacteria 2440
271 Ga0496104_0006666 3300048907 Bacteria 10162
272 Ga0496104_0026154 3300048907 Bacteria 5384
273 Ga0496104_0071041 3300048907 Bacteria 3310
274 Ga0496104_0272734 3300048907 Bacteria 1604
275 Ga0496105_0030571 3300048908 Bacteria 4412
276 Ga0496107_0021094 3300048910 Bacteria 4603
277 Ga0496107_0026680 3300048910 Bacteria 4097
278 Ga0496108_0000428 3300048911 Bacteria 33965
279 Ga0496108_0004518 3300048911 Bacteria 11209
280 Ga0496108_0064901 3300048911 Bacteria 3076
281 Ga0496108_0214107 3300048911 Bacteria 1673
282 Ga0496109_0003640 3300048912 Bacteria 12876
283 Ga0496109_0007847 3300048912 Bacteria 9041
284 Ga0496109_0020585 3300048912 Bacteria 5827
285 Ga0496109_0111403 3300048912 Bacteria 2545
286 Ga0496109_0163403 3300048912 Bacteria 2086
287 Ga0496109_0226048 3300048912 Bacteria 1760
288 Ga0496110_0020384 3300048913 Bacteria 5599
289 Ga0496110_0023269 3300048913 Bacteria 5267
290 Ga0496110_0062049 3300048913 Bacteria 3300
291 Ga0496110_0066163 3300048913 Bacteria 3196
292 Ga0496110_0121336 3300048913 Bacteria 2355
293 Ga0496110_0261565 3300048913 Bacteria 1575
294 Ga0496110_0290596 3300048913 Bacteria 1489
295 Ga0496111_0001255 3300048914 Bacteria 14197
296 Ga0496111_0012674 3300048914 Bacteria 5713
297 Ga0496111_0049390 3300048914 Bacteria 3033
298 Ga0496111_0070565 3300048914 Bacteria 2541
299 Ga0496112_0006452 3300048915 Bacteria 10296
300 Ga0496112_0008148 3300048915 Bacteria 9364
301 Ga0496112_0028553 3300048915 Bacteria 5386
302 Ga0496113_0039383 3300048916 Bacteria 3479
303 Ga0496114_0009353 3300048917 Bacteria 7778
304 Ga0496114_0605336 3300048917 Bacteria 966
305 Ga0501036_0103874 3300049572 Bacteria 2403
306 Ga0501067_0103210 3300049583 Bacteria 1584
307 Ga0501069_0190556 3300049585 Bacteria 1186
308 Ga0501076_0107173 3300049592 Bacteria 2256
309 Ga0501076_0259354 3300049592 Bacteria 1423
310 Ga0501079_0255009 3300049741 Bacteria 1371
311 Ga0501080_0040676 3300049742 Bacteria 4336
312 Ga0501080_0084913 3300049742 Bacteria 2942
313 Ga0501080_0227656 3300049742 Bacteria 1705
314 nmdc:mga05p37_704420_c1 3300050507 Bacteria 1121
315 nmdc:mga06r32_210909_c1 3300050510 Bacteria 1930
316 nmdc:mga08y16_11103_c1 3300050511 Bacteria 9458
317 nmdc:mga08y16_45293_c1 3300050511 Bacteria 4609
318 nmdc:mga08y16_69489_c1 3300050511 Bacteria 3672
319 nmdc:mga0n895_181108_c1 3300050512 Bacteria 2138
320 nmdc:mga0n895_64254_c1 3300050512 Bacteria 3631
321 nmdc:mga0rr50_6861_c1 3300050513 Bacteria 6980
322 nmdc:mga08x19_1666_c1 3300050514 Bacteria 13702
323 nmdc:mga0a205_7419_c1 3300050515 Bacteria 9932
324 Ga0495595_0017967 3300053084 Bacteria 3049
325 Ga0501084_0241150 3300054114 Bacteria 1526

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0605336 Ga0496114_0605336_11_841 265
2 3300044694 Ga0466963_0146214 Ga0466963_0146214_55_1158 288
3 3300044842 Ga0466957_0084343 Ga0466957_0084343_66_1169 288
4 3300049742 Ga0501080_0227656 Ga0501080_0227656_97_990 297
5 3300006163 Ga0070715_10027437 Ga0070715_100274372 303
6 3300025905 Ga0207685_10001630 Ga0207685_100016302 303
7 3300048903 Ga0496100_0120685 Ga0496100_0120685_351_1424 303
8 3300048904 Ga0496101_0046973 Ga0496101_0046973_1192_2265 303
9 3300048905 Ga0496102_0056599 Ga0496102_0056599_1246_2319 303
10 3300048907 Ga0496104_0026154 Ga0496104_0026154_1983_3056 303
11 3300048908 Ga0496105_0030571 Ga0496105_0030571_3281_4354 303
12 3300048910 Ga0496107_0026680 Ga0496107_0026680_1173_2246 303
13 3300048911 Ga0496108_0064901 Ga0496108_0064901_1864_2937 303
14 3300048913 Ga0496110_0062049 Ga0496110_0062049_1710_2783 303
15 3300048914 Ga0496111_0049390 Ga0496111_0049390_1293_2366 303
16 3300048917 Ga0496114_0009353 Ga0496114_0009353_1083_2156 303
17 3300005616 Ga0068852_100172123 Ga0068852_1001721232 304
18 3300013105 Ga0157369_10040115 Ga0157369_100401151 305
19 3300026078 Ga0207702_10104974 Ga0207702_101049742 308
20 3300048912 Ga0496109_0226048 Ga0496109_0226048_522_1553 309
21 3300014325 Ga0163163_10236924 Ga0163163_102369242 310
22 3300048916 Ga0496113_0039383 Ga0496113_0039383_1789_2820 311
23 3300005985 Ga0081539_10005570 Ga0081539_1000557012 313
24 3300025945 Ga0207679_10172353 Ga0207679_101723532 313
25 3300005329 Ga0070683_100215284 Ga0070683_1002152842 315
26 3300005329 Ga0070683_100001314 Ga0070683_10000131417 316
27 3300005535 Ga0070684_100021842 Ga0070684_1000218426 316
28 3300005577 Ga0068857_100051260 Ga0068857_1000512604 316
29 3300025944 Ga0207661_10002079 Ga0207661_1000207912 316
30 3300026116 Ga0207674_10062896 Ga0207674_100628962 316
31 3300005327 Ga0070658_10021571 Ga0070658_100215712 320
32 3300005329 Ga0070683_100002720 Ga0070683_1000027206 320
33 3300005339 Ga0070660_100005101 Ga0070660_10000510111 320
34 3300005344 Ga0070661_100185640 Ga0070661_1001856402 320
35 3300005458 Ga0070681_10023661 Ga0070681_100236616 320
36 3300005530 Ga0070679_100142179 Ga0070679_1001421792 320
37 3300005535 Ga0070684_100035231 Ga0070684_1000352313 320
38 3300005563 Ga0068855_100171078 Ga0068855_1001710782 320
39 3300005577 Ga0068857_100112830 Ga0068857_1001128302 320
40 3300009093 Ga0105240_10161054 Ga0105240_101610543 320
41 3300013307 Ga0157372_10297677 Ga0157372_102976772 320
42 3300020070 Ga0206356_10895433 Ga0206356_108954332 320
43 3300025909 Ga0207705_10050254 Ga0207705_100502542 320
44 3300025919 Ga0207657_10000046 Ga0207657_10000046116 320
45 3300025921 Ga0207652_10104095 Ga0207652_101040952 320
46 3300035117 Ga0373953_0089742 Ga0373953_0089742_246_1229 321
47 3300035172 Ga0373955_0071067 Ga0373955_0071067_54_1037 321
48 3300046462 Ga0495651_0016022 Ga0495651_0016022_1541_2524 321
49 3300046463 Ga0495653_0065443 Ga0495653_0065443_1050_2033 321
50 3300046517 Ga0495630_0045795 Ga0495630_0045795_1568_2551 321
51 3300046529 Ga0495652_0036251 Ga0495652_0036251_1487_2470 321
52 3300046559 Ga0495667_0016585 Ga0495667_0016585_3754_4737 321
53 3300046663 Ga0495635_0042341 Ga0495635_0042341_1480_2463 321
54 3300046675 Ga0495657_0010398 Ga0495657_0010398_4597_5580 321
55 3300046679 Ga0495623_0056889 Ga0495623_0056889_812_1795 321
56 3300046809 Ga0495600_0018934 Ga0495600_0018934_2446_3429 321
57 3300047317 Ga0495604_0056021 Ga0495604_0056021_1681_2664 321
58 3300047319 Ga0495674_0058158 Ga0495674_0058158_187_1170 321
59 3300047322 Ga0495680_0037526 Ga0495680_0037526_2497_3480 321
60 3300047444 Ga0495675_0090345 Ga0495675_0090345_542_1525 321
61 3300048088 Ga0495602_0102606 Ga0495602_0102606_65_1048 321
62 3300053084 Ga0495595_0017967 Ga0495595_0017967_762_1745 321
63 3300028563 Ga0265319_1030465 Ga0265319_10304651 322
64 3300033179 Ga0307507_10001261 Ga0307507_1000126147 322
65 3300038443 Ga0395901_0145842 Ga0395901_0145842_1256_2248 322
66 3300046514 Ga0495618_0013969 Ga0495618_0013969_3721_4773 322
67 3300005617 Ga0068859_100178537 Ga0068859_1001785372 323
68 3300005983 Ga0081540_1013801 Ga0081540_10138012 323
69 3300006931 Ga0097620_100178530 Ga0097620_1001785302 323
70 3300048913 Ga0496110_0290596 Ga0496110_0290596_277_1290 323
71 3300005445 Ga0070708_100000274 Ga0070708_10000027419 324
72 3300005467 Ga0070706_100096847 Ga0070706_1000968473 324
73 3300005471 Ga0070698_100123179 Ga0070698_1001231794 324
74 3300025920 Ga0207649_10204433 Ga0207649_102044332 324
75 3300009553 Ga0105249_10121344 Ga0105249_101213444 325
76 3300025913 Ga0207695_10077245 Ga0207695_100772452 325
77 3300031731 Ga0307405_10165238 Ga0307405_101652382 325
78 3300041404 Ga0439436_0028155 Ga0439436_0028155_173_1207 325
79 3300041406 Ga0439439_0000087 Ga0439439_0000087_9941_10975 325
80 3300042435 Ga0439434_0003263 Ga0439434_0003263_26_1060 325
81 3300044658 Ga0466972_0018788 Ga0466972_0018788_1170_2231 326
82 3300049585 Ga0501069_0190556 Ga0501069_0190556_96_1115 326
83 3300049742 Ga0501080_0040676 Ga0501080_0040676_2025_3044 326
84 3300050507 nmdc:mga05p37_704420_c1 nmdc:mga05p37_704420_c1_15_1046 326
85 3300002077 JGI24744J21845_10001083 JGI24744J21845_100010832 327
86 3300005366 Ga0070659_100045519 Ga0070659_1000455193 327
87 3300005438 Ga0070701_10004998 Ga0070701_100049984 327
88 3300005441 Ga0070700_100002344 Ga0070700_1000023445 327
89 3300005456 Ga0070678_100000442 Ga0070678_10000044211 327
90 3300005539 Ga0068853_100008817 Ga0068853_1000088175 327
91 3300005544 Ga0070686_100002207 Ga0070686_1000022074 327
92 3300005614 Ga0068856_100005584 Ga0068856_1000055842 327
93 3300005616 Ga0068852_100013729 Ga0068852_1000137292 327
94 3300005718 Ga0068866_10003564 Ga0068866_100035645 327
95 3300009094 Ga0111539_10018782 Ga0111539_1001878210 327
96 3300009098 Ga0105245_10528546 Ga0105245_105285462 327
97 3300009147 Ga0114129_10005080 Ga0114129_1000508014 327
98 3300009148 Ga0105243_10009361 Ga0105243_100093614 327
99 3300009174 Ga0105241_10037354 Ga0105241_100373542 327
100 3300009553 Ga0105249_10000948 Ga0105249_1000094816 327
101 3300013297 Ga0157378_10225101 Ga0157378_102251012 327
102 3300014326 Ga0157380_10009040 Ga0157380_100090404 327
103 3300025914 Ga0207671_10071136 Ga0207671_100711362 327
104 3300025935 Ga0207709_10002743 Ga0207709_100027438 327
105 3300025961 Ga0207712_10010539 Ga0207712_100105395 327
106 3300026035 Ga0207703_10090226 Ga0207703_100902262 327
107 3300026075 Ga0207708_10000564 Ga0207708_100005645 327
108 3300026118 Ga0207675_100076994 Ga0207675_1000769942 327
109 3300026121 Ga0207683_10000251 Ga0207683_1000025134 327
110 3300050511 nmdc:mga08y16_11103_c1 nmdc:mga08y16_11103_c1_296_1312 327
111 iso_pu_bacteria 3000405567 3000409191 327
112 3300005985 Ga0081539_10051734 Ga0081539_100517342 328
113 3300037312 Ga0395899_0093024 Ga0395899_0093024_277_1278 328
114 3300046689 Ga0495613_0158008 Ga0495613_0158008_474_1493 328
115 3300047319 Ga0495674_0071511 Ga0495674_0071511_1223_2242 328
116 3300047322 Ga0495680_0007877 Ga0495680_0007877_4326_5345 328
117 3300049742 Ga0501080_0084913 Ga0501080_0084913_1053_2090 328
118 3300037418 Ga0395900_0005855 Ga0395900_0005855_10642_11643 329
119 3300037466 Ga0395898_0102231 Ga0395898_0102231_1213_2214 329
120 3300037471 Ga0395905_0069142 Ga0395905_0069142_1105_2106 329
121 3300038443 Ga0395901_0116934 Ga0395901_0116934_583_1584 329
122 3300048907 Ga0496104_0071041 Ga0496104_0071041_488_1528 329
123 3300048911 Ga0496108_0004518 Ga0496108_0004518_9228_10268 329
124 3300048912 Ga0496109_0020585 Ga0496109_0020585_3623_4663 329
125 3300048913 Ga0496110_0066163 Ga0496110_0066163_1894_2934 329
126 3300048914 Ga0496111_0070565 Ga0496111_0070565_1129_2169 329
127 3300048915 Ga0496112_0028553 Ga0496112_0028553_1916_2956 329
128 3300005355 Ga0070671_100116020 Ga0070671_1001160202 330
129 3300005367 Ga0070667_100187530 Ga0070667_1001875302 330
130 3300025961 Ga0207712_10080197 Ga0207712_100801972 330
131 3300025986 Ga0207658_10159965 Ga0207658_101599652 330
132 3300044656 Ga0466969_0009763 Ga0466969_0009763_3075_4199 330
133 3300044693 Ga0466961_0018128 Ga0466961_0018128_562_1686 330
134 3300045976 Ga0466967_0027207 Ga0466967_0027207_618_1682 330
135 3300005354 Ga0070675_100036789 Ga0070675_1000367892 331
136 3300005366 Ga0070659_100185812 Ga0070659_1001858122 331
137 3300005436 Ga0070713_100057202 Ga0070713_1000572023 331
138 3300005547 Ga0070693_100024550 Ga0070693_1000245503 331
139 3300006847 Ga0075431_100031487 Ga0075431_1000314875 331
140 3300006852 Ga0075433_10077746 Ga0075433_100777462 331
141 3300006871 Ga0075434_100069923 Ga0075434_1000699233 331
142 3300006914 Ga0075436_100002820 Ga0075436_1000028205 331
143 3300007076 Ga0075435_100001334 Ga0075435_10000133412 331
144 3300009147 Ga0114129_10001697 Ga0114129_1000169712 331
145 3300035118 Ga0373954_0078446 Ga0373954_0078446_338_1420 331
146 3300035170 Ga0373943_0009233 Ga0373943_0009233_2935_4017 331
147 3300035692 Ga0373935_0019638 Ga0373935_0019638_272_1354 331
148 3300035725 Ga0373947_0011160 Ga0373947_0011160_1286_2368 331
149 3300037068 Ga0373925_0015963 Ga0373925_0015963_1156_2238 331
150 3300037466 Ga0395898_0004625 Ga0395898_0004625_3633_4685 331
151 3300038443 Ga0395901_0012797 Ga0395901_0012797_722_1774 331
152 3300046455 Ga0495603_0023321 Ga0495603_0023321_1922_3004 331
153 3300046461 Ga0495641_0010751 Ga0495641_0010751_511_1593 331
154 3300046462 Ga0495651_0037952 Ga0495651_0037952_112_1194 331
155 3300046463 Ga0495653_0083043 Ga0495653_0083043_314_1396 331
156 3300046472 Ga0495580_0032931 Ga0495580_0032931_289_1371 331
157 3300046473 Ga0495582_0049844 Ga0495582_0049844_155_1237 331
158 3300046499 Ga0495594_0022597 Ga0495594_0022597_522_1604 331
159 3300046511 Ga0495608_0053763 Ga0495608_0053763_1070_2152 331
160 3300046514 Ga0495618_0018469 Ga0495618_0018469_303_1385 331
161 3300046517 Ga0495630_0063714 Ga0495630_0063714_1374_2456 331
162 3300046531 Ga0495665_0004788 Ga0495665_0004788_2974_4056 331
163 3300046559 Ga0495667_0024844 Ga0495667_0024844_2482_3564 331
164 3300046642 Ga0495634_0009466 Ga0495634_0009466_3108_4190 331
165 3300046679 Ga0495623_0076315 Ga0495623_0076315_917_1999 331
166 3300046680 Ga0495646_0103975 Ga0495646_0103975_255_1337 331
167 3300046690 Ga0495624_0010277 Ga0495624_0010277_4101_5183 331
168 3300046809 Ga0495600_0017148 Ga0495600_0017148_2796_3878 331
169 3300047319 Ga0495674_0029762 Ga0495674_0029762_3595_4677 331
170 3300047319 Ga0495674_0051031 Ga0495674_0051031_539_1621 331
171 3300047321 Ga0495676_0216931 Ga0495676_0216931_48_1130 331
172 3300047673 Ga0495593_0015042 Ga0495593_0015042_3162_4244 331
173 3300049592 Ga0501076_0259354 Ga0501076_0259354_172_1224 331
174 3300050510 nmdc:mga06r32_210909_c1 nmdc:mga06r32_210909_c1_304_1365 331
175 3300050512 nmdc:mga0n895_64254_c1 nmdc:mga0n895_64254_c1_570_1631 331
176 3300050513 nmdc:mga0rr50_6861_c1 nmdc:mga0rr50_6861_c1_474_1535 331
177 3300050514 nmdc:mga08x19_1666_c1 nmdc:mga08x19_1666_c1_4264_5325 331
178 3300050515 nmdc:mga0a205_7419_c1 nmdc:mga0a205_7419_c1_7617_8678 331
179 3300005471 Ga0070698_100146382 Ga0070698_1001463822 332
180 3300005471 Ga0070698_100151371 Ga0070698_1001513712 332
181 3300005518 Ga0070699_100079796 Ga0070699_1000797962 332
182 3300005937 Ga0081455_10053793 Ga0081455_100537934 332
183 3300005983 Ga0081540_1002305 Ga0081540_100230513 332
184 3300005985 Ga0081539_10004748 Ga0081539_100047489 332
185 3300009098 Ga0105245_10005239 Ga0105245_100052393 332
186 3300013307 Ga0157372_10567538 Ga0157372_105675381 332
187 3300014326 Ga0157380_10034922 Ga0157380_100349222 332
188 3300031903 Ga0307407_10026476 Ga0307407_100264762 332
189 3300031995 Ga0307409_100012598 Ga0307409_1000125985 332
190 3300032002 Ga0307416_100051619 Ga0307416_1000516193 332
191 3300032126 Ga0307415_100122867 Ga0307415_1001228671 332
192 3300037418 Ga0395900_0104876 Ga0395900_0104876_61_1080 332
193 3300037466 Ga0395898_0006779 Ga0395898_0006779_2021_3040 332
194 3300037471 Ga0395905_0010578 Ga0395905_0010578_1154_2206 332
195 3300037471 Ga0395905_0012731 Ga0395905_0012731_3927_4946 332
196 3300038443 Ga0395901_0023578 Ga0395901_0023578_3737_4789 332
197 3300038443 Ga0395901_0048180 Ga0395901_0048180_3215_4234 332
198 3300041410 Ga0439461_0007682 Ga0439461_0007682_117_1154 332
199 3300042009 Ga0439451_003236 Ga0439451_003236_2208_3284 332
200 3300046461 Ga0495641_0092106 Ga0495641_0092106_271_1341 332
201 3300047321 Ga0495676_0044963 Ga0495676_0044963_2269_3339 332
202 3300048907 Ga0496104_0006666 Ga0496104_0006666_7057_8115 332
203 3300048911 Ga0496108_0000428 Ga0496108_0000428_6437_7495 332
204 3300048911 Ga0496108_0214107 Ga0496108_0214107_561_1625 332
205 3300048912 Ga0496109_0003640 Ga0496109_0003640_3996_5054 332
206 3300048913 Ga0496110_0023269 Ga0496110_0023269_3223_4281 332
207 3300048914 Ga0496111_0001255 Ga0496111_0001255_11090_12148 332
208 3300048915 Ga0496112_0006452 Ga0496112_0006452_1200_2264 332
209 3300048915 Ga0496112_0008148 Ga0496112_0008148_1008_2066 332
210 3300049572 Ga0501036_0103874 Ga0501036_0103874_639_1655 332
211 3300049583 Ga0501067_0103210 Ga0501067_0103210_313_1314 332
212 3300050511 nmdc:mga08y16_45293_c1 nmdc:mga08y16_45293_c1_945_2030 332
213 3300006847 Ga0075431_100187875 Ga0075431_1001878752 333
214 3300009147 Ga0114129_10177886 Ga0114129_101778862 333
215 3300037466 Ga0395898_0227644 Ga0395898_0227644_285_1319 333
216 3300037471 Ga0395905_0204101 Ga0395905_0204101_269_1300 333
217 3300046455 Ga0495603_0056934 Ga0495603_0056934_713_1747 333
218 3300046461 Ga0495641_0033609 Ga0495641_0033609_476_1510 333
219 3300048912 Ga0496109_0111403 Ga0496109_0111403_717_1751 333
220 3300048913 Ga0496110_0261565 Ga0496110_0261565_166_1200 333
221 3300045836 Ga0466958_0109113 Ga0466958_0109113_647_1705 334
222 3300047319 Ga0495674_0112463 Ga0495674_0112463_313_1353 334
223 3300025927 Ga0207687_10063597 Ga0207687_100635973 335
224 3300025939 Ga0207665_10026255 Ga0207665_100262553 335
225 3300031824 Ga0307413_10115225 Ga0307413_101152252 335
226 3300046473 Ga0495582_0123464 Ga0495582_0123464_275_1315 335
227 3300046475 Ga0495639_0029892 Ga0495639_0029892_847_1887 335
228 3300046531 Ga0495665_0026306 Ga0495665_0026306_594_1634 335
229 3300047321 Ga0495676_0014280 Ga0495676_0014280_5716_6756 335
230 3300001991 JGI24743J22301_10002140 JGI24743J22301_100021402 336
231 3300002075 JGI24738J21930_10008228 JGI24738J21930_100082282 336
232 3300005333 Ga0070677_10079015 Ga0070677_100790152 336
233 3300005337 Ga0070682_100149845 Ga0070682_1001498452 336
234 3300005341 Ga0070691_10019897 Ga0070691_100198972 336
235 3300005343 Ga0070687_100112640 Ga0070687_1001126402 336
236 3300005345 Ga0070692_10198849 Ga0070692_101988492 336
237 3300005347 Ga0070668_100129114 Ga0070668_1001291141 336
238 3300005356 Ga0070674_100220603 Ga0070674_1002206032 336
239 3300005364 Ga0070673_100088733 Ga0070673_1000887332 336
240 3300005364 Ga0070673_100150073 Ga0070673_1001500732 336
241 3300005366 Ga0070659_100189685 Ga0070659_1001896852 336
242 3300005367 Ga0070667_100232689 Ga0070667_1002326892 336
243 3300005441 Ga0070700_100282021 Ga0070700_1002820212 336
244 3300005466 Ga0070685_10003169 Ga0070685_100031693 336
245 3300005530 Ga0070679_100288855 Ga0070679_1002888551 336
246 3300005543 Ga0070672_100031722 Ga0070672_1000317223 336
247 3300005549 Ga0070704_100085349 Ga0070704_1000853492 336
248 3300005563 Ga0068855_100325645 Ga0068855_1003256452 336
249 3300005578 Ga0068854_100079368 Ga0068854_1000793682 336
250 3300005615 Ga0070702_100029409 Ga0070702_1000294093 336
251 3300005617 Ga0068859_100294916 Ga0068859_1002949162 336
252 3300005718 Ga0068866_10042259 Ga0068866_100422592 336
253 3300005834 Ga0068851_10021310 Ga0068851_100213102 336
254 3300005843 Ga0068860_100148798 Ga0068860_1001487982 336
255 3300005843 Ga0068860_100345953 Ga0068860_1003459532 336
256 3300006881 Ga0068865_100009066 Ga0068865_1000090664 336
257 3300006931 Ga0097620_100294908 Ga0097620_1002949082 336
258 3300009148 Ga0105243_10012002 Ga0105243_100120024 336
259 3300009148 Ga0105243_10033694 Ga0105243_100336942 336
260 3300009176 Ga0105242_10030369 Ga0105242_100303691 336
261 3300009176 Ga0105242_10145308 Ga0105242_101453082 336
262 3300009177 Ga0105248_10109754 Ga0105248_101097542 336
263 3300009551 Ga0105238_10279701 Ga0105238_102797012 336
264 3300009553 Ga0105249_10087232 Ga0105249_100872322 336
265 3300010375 Ga0105239_10105117 Ga0105239_101051173 336
266 3300013105 Ga0157369_10127166 Ga0157369_101271662 336
267 3300013296 Ga0157374_10066243 Ga0157374_100662432 336
268 3300013306 Ga0163162_10157998 Ga0163162_101579982 336
269 3300014325 Ga0163163_10193980 Ga0163163_101939802 336
270 3300014326 Ga0157380_10020199 Ga0157380_100201995 336
271 3300014969 Ga0157376_10016665 Ga0157376_100166654 336
272 3300017792 Ga0163161_10022677 Ga0163161_100226773 336
273 3300025321 Ga0207656_10042450 Ga0207656_100424502 336
274 3300025901 Ga0207688_10033230 Ga0207688_100332303 336
275 3300025907 Ga0207645_10036701 Ga0207645_100367013 336
276 3300025908 Ga0207643_10003044 Ga0207643_100030444 336
277 3300025909 Ga0207705_10079690 Ga0207705_100796902 336
278 3300025912 Ga0207707_10104569 Ga0207707_101045692 336
279 3300025914 Ga0207671_10187270 Ga0207671_101872702 336
280 3300025918 Ga0207662_10149361 Ga0207662_101493612 336
281 3300025919 Ga0207657_10007888 Ga0207657_100078887 336
282 3300025924 Ga0207694_10040965 Ga0207694_100409652 336
283 3300025926 Ga0207659_10188379 Ga0207659_101883792 336
284 3300025927 Ga0207687_10309667 Ga0207687_103096672 336
285 3300025931 Ga0207644_10073525 Ga0207644_100735252 336
286 3300025932 Ga0207690_10220788 Ga0207690_102207882 336
287 3300025933 Ga0207706_10011233 Ga0207706_100112333 336
288 3300025934 Ga0207686_10122144 Ga0207686_101221442 336
289 3300025935 Ga0207709_10019249 Ga0207709_100192492 336
290 3300025938 Ga0207704_10061730 Ga0207704_100617302 336
291 3300025940 Ga0207691_10006210 Ga0207691_100062107 336
292 3300025940 Ga0207691_10027491 Ga0207691_100274912 336
293 3300025944 Ga0207661_10064207 Ga0207661_100642073 336
294 3300025961 Ga0207712_10334613 Ga0207712_103346132 336
295 3300025981 Ga0207640_10069177 Ga0207640_100691772 336
296 3300026023 Ga0207677_10247377 Ga0207677_102473772 336
297 3300026023 Ga0207677_10315403 Ga0207677_103154032 336
298 3300026067 Ga0207678_10104692 Ga0207678_101046922 336
299 3300026075 Ga0207708_10031362 Ga0207708_100313624 336
300 3300026075 Ga0207708_10222942 Ga0207708_102229422 336
301 3300026088 Ga0207641_10028632 Ga0207641_100286322 336
302 3300026089 Ga0207648_10061197 Ga0207648_100611971 336
303 3300026118 Ga0207675_100018916 Ga0207675_1000189165 336
304 3300026121 Ga0207683_10022439 Ga0207683_100224391 336
305 3300026121 Ga0207683_10036927 Ga0207683_100369274 336
306 3300027907 Ga0207428_10096939 Ga0207428_100969392 336
307 3300028379 Ga0268266_10495447 Ga0268266_104954472 336
308 3300034817 Ga0373948_0004852 Ga0373948_0004852_1031_2041 336
309 3300035092 Ga0373952_0021533 Ga0373952_0021533_276_1286 336
310 3300035115 Ga0373941_0011213 Ga0373941_0011213_498_1508 336
311 3300035691 Ga0373931_0105791 Ga0373931_0105791_162_1172 336
312 3300046473 Ga0495582_0183755 Ga0495582_0183755_11_1021 336
313 3300048091 Ga0495626_0124974 Ga0495626_0124974_63_1073 336
314 3300048905 Ga0496102_0121501 Ga0496102_0121501_982_1992 336
315 3300048907 Ga0496104_0272734 Ga0496104_0272734_479_1489 336
316 3300048910 Ga0496107_0021094 Ga0496107_0021094_2686_3696 336
317 3300048912 Ga0496109_0007847 Ga0496109_0007847_3576_4586 336
318 3300048912 Ga0496109_0163403 Ga0496109_0163403_70_1080 336
319 3300048913 Ga0496110_0020384 Ga0496110_0020384_1761_2771 336
320 3300048913 Ga0496110_0121336 Ga0496110_0121336_734_1744 336
321 3300048914 Ga0496111_0012674 Ga0496111_0012674_4103_5113 336
322 3300049592 Ga0501076_0107173 Ga0501076_0107173_370_1380 336
323 3300049741 Ga0501079_0255009 Ga0501079_0255009_41_1051 336
324 3300050511 nmdc:mga08y16_69489_c1 nmdc:mga08y16_69489_c1_2122_3132 336
325 3300050512 nmdc:mga0n895_181108_c1 nmdc:mga0n895_181108_c1_362_1372 336
326 3300054114 Ga0501084_0241150 Ga0501084_0241150_277_1287 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

201

0.97

PF08402

TOBE_2

TOBE domain

286

368

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.961 9 240
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9488 10 223
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9476 8 223
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9461 8 222
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.9418 8 231
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.992 8 223 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9851 10 222 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9785 8 223 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9743 10 241 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9682 10 240 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9846 10 214 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9843 10 227 GO:0005524
GO:0016887
GO:0055052
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9829 3 222 GO:0005524
GO:0016887
AF-A0A534HSD0-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9821 3 224 GO:0005524
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9818 10 231 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.5 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map