F408194

General Info

Members Datasets Scaffolds Average Seq Length
326 226 652 268

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100150152|Ga0070707_1001501522
Length 296
Sequence VAVATRSIFDPLVPAGAYDEFTATAAPASAAQRAWTSADGALPALYIGHGAPPLLDDAVWMKQLASWTHTLPKPRGVLIVSAHWEAAPLMLSAPGAATPLVYDFGGFQQRYYTLTYPTPDASSLARDVAGLMPAVAPVHQHPSRGLDHGAWVPLKVMYPLADVPVLQLSIPTSDPSLLLSLGARLRPLRESGVLIIGSGFLTHGLPFVTADMIYGSFVPGWSSDFDQWAAEALARGDVETLAGFRKAPGMPYAHPTADHFLPLFVTLGAASDPTAPVETVIDGYWMGFAKRSFQVS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
215 2643221561 Nocardioides sp. Root151 Isolate Unclassified
216 2643221604 Nocardioides sp. Root190 Isolate Unclassified
217 2643221615 Nocardioides sp. Root224 Isolate Unclassified
218 2643221617 Nocardioides sp. Root79 Isolate Unclassified
219 2643221620 Nocardioides sp. Root240 Isolate Unclassified
220 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
221 2643221696 Nocardioides sp. Root140 Isolate Unclassified
222 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
223 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
224 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
225 8002775197 Frankia nepalensis CN7 Isolate Nodule
226 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 3.37
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 15.95
Nodule 0.61
Rhizoplane 2.45
Rhizosphere 74.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100150152 3300005468 Bacteria 2269
2 LJQas_1007862 3300000549 Bacteria 1307
3 JGI24738J21930_10015255 3300002075 Bacteria 1638
4 Ga0006562J51391_1165288 3300003578 Bacteria 972
5 Ga0070683_100106597 3300005329 Bacteria 2642
6 Ga0070683_100211578 3300005329 Bacteria 1842
7 Ga0070682_100017341 3300005337 Bacteria 4196
8 Ga0070660_100032983 3300005339 Bacteria 3900
9 Ga0070689_100154940 3300005340 Bacteria 1849
10 Ga0070691_10010912 3300005341 Bacteria 4149
11 Ga0070687_100056901 3300005343 Bacteria 2048
12 Ga0070661_100194466 3300005344 Bacteria 1548
13 Ga0070692_10018211 3300005345 Bacteria 3373
14 Ga0070675_100361080 3300005354 Bacteria 1290
15 Ga0070659_100032710 3300005366 Bacteria 4036
16 Ga0070667_100012833 3300005367 Bacteria 6923
17 Ga0070709_10125823 3300005434 Bacteria 1743
18 Ga0070709_10127032 3300005434 Bacteria 1736
19 Ga0070714_100035663 3300005435 Bacteria 4169
20 Ga0070714_100075999 3300005435 Bacteria 2915
21 Ga0070714_100098429 3300005435 Bacteria 2573
22 Ga0070714_100213831 3300005435 Bacteria 1768
23 Ga0070713_100134475 3300005436 Bacteria 2184
24 Ga0070713_100256334 3300005436 Bacteria 1597
25 Ga0070710_10020785 3300005437 Bacteria 3411
26 Ga0070701_10060094 3300005438 Bacteria 2000
27 Ga0070711_100216388 3300005439 Bacteria 1486
28 Ga0070700_100015170 3300005441 Bacteria 4364
29 Ga0070663_100036434 3300005455 Bacteria 3419
30 Ga0070663_100120726 3300005455 Bacteria 1979
31 Ga0070678_100348234 3300005456 Bacteria 1273
32 Ga0070662_100108032 3300005457 Bacteria 2115
33 Ga0070662_100172395 3300005457 Bacteria 1700
34 Ga0070698_100001109 3300005471 Bacteria 29696
35 Ga0070698_100014895 3300005471 Bacteria 8221
36 Ga0070684_100299504 3300005535 Bacteria 1475
37 Ga0070672_100068369 3300005543 Bacteria 2817
38 Ga0070664_100108949 3300005564 Bacteria 2415
39 Ga0068856_100631077 3300005614 Bacteria 1092
40 Ga0070702_100052625 3300005615 Bacteria 2336
41 Ga0068852_100047163 3300005616 Bacteria 3674
42 Ga0068861_100161513 3300005719 Bacteria 1849
43 Ga0068870_10226775 3300005840 Bacteria 1147
44 Ga0068860_100000237 3300005843 Bacteria 84631
45 Ga0081539_10021241 3300005985 Bacteria 4346
46 Ga0075365_10001856 3300006038 Bacteria 9919
47 Ga0075365_10088914 3300006038 Bacteria 2102
48 Ga0075365_10095084 3300006038 Bacteria 2034
49 Ga0075365_10245961 3300006038 Bacteria 1256
50 Ga0075365_10478667 3300006038 Bacteria 880
51 Ga0075368_10008369 3300006042 Bacteria 3681
52 Ga0075363_100004621 3300006048 Bacteria 6048
53 Ga0075363_100006234 3300006048 Bacteria 5397
54 Ga0075363_100036758 3300006048 Bacteria 2570
55 Ga0075363_100134126 3300006048 Bacteria 1390
56 Ga0075363_100173787 3300006048 Bacteria 1224
57 Ga0075363_100301726 3300006048 Bacteria 929
58 Ga0075364_10005045 3300006051 Bacteria 7652
59 Ga0075364_10013474 3300006051 Bacteria 5028
60 Ga0075364_10018483 3300006051 Bacteria 4364
61 Ga0075364_10022986 3300006051 Bacteria 3944
62 Ga0075364_10072382 3300006051 Bacteria 2271
63 Ga0070716_100003535 3300006173 Bacteria 7372
64 Ga0070712_100222643 3300006175 Bacteria 1494
65 Ga0075362_10023706 3300006177 Bacteria 2598
66 Ga0075367_10011797 3300006178 Bacteria 4639
67 Ga0075367_10083857 3300006178 Bacteria 1931
68 Ga0075367_10184702 3300006178 Bacteria 1300
69 Ga0075367_10226541 3300006178 Bacteria 1170
70 Ga0097621_100178704 3300006237 Bacteria 1833
71 Ga0075370_10001272 3300006353 Bacteria 10744
72 Ga0075370_10009502 3300006353 Bacteria 5054
73 Ga0075370_10016842 3300006353 Bacteria 3939
74 Ga0075370_10045949 3300006353 Bacteria 2470
75 Ga0105245_10055101 3300009098 Bacteria 3571
76 Ga0105243_10013957 3300009148 Bacteria 6078
77 Ga0105243_10429395 3300009148 Bacteria 1235
78 Ga0105242_10235964 3300009176 Bacteria 1642
79 Ga0105242_10799772 3300009176 Bacteria 933
80 Ga0105248_10572331 3300009177 Bacteria 1275
81 Ga0105237_10065526 3300009545 Bacteria 3629
82 Ga0157369_10049823 3300013105 Bacteria 4538
83 Ga0157369_10970087 3300013105 Bacteria 871
84 Ga0157374_10411266 3300013296 Bacteria 1351
85 Ga0157372_10460727 3300013307 Bacteria 1482
86 Ga0157375_10028053 3300013308 Bacteria 5271
87 Ga0157375_10290981 3300013308 Bacteria 1796
88 Ga0157377_10032806 3300014745 Bacteria 2830
89 Ga0163161_10288140 3300017792 Bacteria 1290
90 Ga0197907_10993734 3300020069 Bacteria 904
91 Ga0206354_10893739 3300020081 Bacteria 3037
92 Ga0206353_12006754 3300020082 Bacteria 2505
93 Ga0213876_10045212 3300021384 Bacteria 2329
94 Ga0213875_10001835 3300021388 Bacteria 13203
95 Ga0224712_10017291 3300022467 Bacteria 2389
96 Ga0207642_10185717 3300025899 Bacteria 1136
97 Ga0207647_10006449 3300025904 Bacteria 8526
98 Ga0207647_10073154 3300025904 Bacteria 2066
99 Ga0207647_10114364 3300025904 Bacteria 1594
100 Ga0207699_10006153 3300025906 Bacteria 5788
101 Ga0207693_10246544 3300025915 Bacteria 1402
102 Ga0207693_10307336 3300025915 Bacteria 1242
103 Ga0207663_10173259 3300025916 Bacteria 1535
104 Ga0207660_10261366 3300025917 Bacteria 1369
105 Ga0207657_10004479 3300025919 Bacteria 14773
106 Ga0207652_10278316 3300025921 Bacteria 1509
107 Ga0207659_10266246 3300025926 Bacteria 1396
108 Ga0207687_10210307 3300025927 Bacteria 1526
109 Ga0207700_10008420 3300025928 Bacteria 6387
110 Ga0207700_10137086 3300025928 Bacteria 2006
111 Ga0207664_10002754 3300025929 Bacteria 11668
112 Ga0207664_10090891 3300025929 Bacteria 2502
113 Ga0207664_10099901 3300025929 Bacteria 2395
114 Ga0207664_10133601 3300025929 Bacteria 2091
115 Ga0207664_10374900 3300025929 Bacteria 1262
116 Ga0207690_10030632 3300025932 Bacteria 3434
117 Ga0207690_10063777 3300025932 Bacteria 2513
118 Ga0207706_10365842 3300025933 Bacteria 1253
119 Ga0207665_10003433 3300025939 Bacteria 10600
120 Ga0207691_10131684 3300025940 Bacteria 2208
121 Ga0207711_10092888 3300025941 Bacteria 2657
122 Ga0207661_10103586 3300025944 Bacteria 2395
123 Ga0207661_10323473 3300025944 Bacteria 1387
124 Ga0207661_10378067 3300025944 Bacteria 1282
125 Ga0207661_10388213 3300025944 Bacteria 1264
126 Ga0207658_10023179 3300025986 Bacteria 4330
127 Ga0207658_10043117 3300025986 Bacteria 3278
128 Ga0207639_10579650 3300026041 Bacteria 1033
129 Ga0207678_10010026 3300026067 Bacteria 8313
130 Ga0207678_10040130 3300026067 Bacteria 4060
131 Ga0207678_10376169 3300026067 Bacteria 1227
132 Ga0207708_10002995 3300026075 Bacteria 12447
133 Ga0207708_10004292 3300026075 Bacteria 10492
134 Ga0207702_10548763 3300026078 Bacteria 1130
135 Ga0207675_100007153 3300026118 Bacteria 10545
136 Ga0207698_10016079 3300026142 Bacteria 5032
137 Ga0207698_10255068 3300026142 Bacteria 1607
138 Ga0209813_10005148 3300027866 Bacteria 3161
139 Ga0209813_10005869 3300027866 Bacteria 3008
140 Ga0207428_10078385 3300027907 Bacteria 2585
141 Ga0268264_10000195 3300028381 Bacteria 123899
142 Ga0265337_1001275 3300028556 Bacteria 12666
143 Ga0265319_1004305 3300028563 Bacteria 7082
144 Ga0265334_10001156 3300028573 Bacteria 12910
145 Ga0265318_10007243 3300028577 Bacteria 5035
146 Ga0265322_10009164 3300028654 Bacteria 2876
147 Ga0265338_10001831 3300028800 Bacteria 33341
148 Ga0265338_10004214 3300028800 Bacteria 19598
149 Ga0265338_10026341 3300028800 Bacteria 5868
150 Ga0265332_10001697 3300031238 Bacteria 12014
151 Ga0265320_10009958 3300031240 Bacteria 5686
152 Ga0265325_10009084 3300031241 Bacteria 5828
153 Ga0265316_10019339 3300031344 Bacteria 5828
154 Ga0307408_100379697 3300031548 Bacteria 1208
155 Ga0265313_10018752 3300031595 Bacteria 3875
156 Ga0307508_10317405 3300031616 Bacteria 1150
157 Ga0265342_10021721 3300031712 Bacteria 4092
158 Ga0316576_10011671 3300031727 Bacteria 5768
159 Ga0316576_10240767 3300031727 Bacteria 1359
160 Ga0316578_10069247 3300031728 Bacteria 2088
161 Ga0307405_10145148 3300031731 Bacteria 1661
162 Ga0307413_10518373 3300031824 Bacteria 961
163 Ga0307410_10084562 3300031852 Bacteria 2237
164 Ga0307410_10189555 3300031852 Bacteria 1563
165 Ga0307406_10618805 3300031901 Bacteria 895
166 Ga0307407_10383223 3300031903 Bacteria 1004
167 Ga0307409_100035747 3300031995 Bacteria 3644
168 Ga0307409_100224988 3300031995 Bacteria 1696
169 Ga0307416_100016245 3300032002 Bacteria 5167
170 Ga0307416_100302063 3300032002 Bacteria 1592
171 Ga0307416_100607251 3300032002 Bacteria 1174
172 Ga0307415_100019214 3300032126 Bacteria 4144
173 Ga0307415_100240768 3300032126 Bacteria 1463
174 Ga0373934_0082346 3300035086 Bacteria 1293
175 Ga0373936_0069265 3300035113 Bacteria 1452
176 Ga0373953_0044261 3300035117 Bacteria 1779
177 Ga0373954_0054020 3300035118 Bacteria 1889
178 Ga0373956_0013575 3300035119 Bacteria 3390
179 Ga0373957_0114036 3300035120 Bacteria 1090
180 Ga0373935_0295104 3300035692 Bacteria 1144
181 Ga0373933_0248345 3300035724 Bacteria 1145
182 Ga0373937_0117462 3300036401 Bacteria 2477
183 Ga0373937_0363836 3300036401 Bacteria 1371
184 Ga0373925_0000360 3300037068 Bacteria 47318
185 Ga0373925_0059907 3300037068 Bacteria 2857
186 Ga0395899_0060187 3300037312 Bacteria 2798
187 Ga0395900_0110915 3300037418 Bacteria 2818
188 Ga0395900_0482692 3300037418 Bacteria 1192
189 Ga0395898_0233466 3300037466 Bacteria 1754
190 Ga0395898_0662832 3300037466 Bacteria 986
191 Ga0395898_0675563 3300037466 Bacteria 975
192 Ga0436364_0044689 3300037853 Bacteria 1020
193 Ga0436364_0583902 3300037853 Bacteria 21040
194 Ga0436365_0116602 3300039437 Bacteria 3164
195 Ga0436363_1703132 3300039450 Bacteria 2798
196 Ga0451853_1270728 3300041512 Bacteria 1005
197 Ga0451853_1292950 3300041512 Bacteria 7604
198 Ga0466969_0126974 3300044656 Bacteria 1184
199 Ga0466972_0106540 3300044658 Bacteria 1325
200 Ga0466965_0007648 3300044683 Bacteria 4973
201 Ga0466965_0251553 3300044683 Bacteria 948
202 Ga0466966_0017280 3300044684 Bacteria 4766
203 Ga0466961_0110783 3300044693 Bacteria 1727
204 Ga0466963_0041498 3300044694 Bacteria 3018
205 Ga0466964_0029859 3300044706 Bacteria 2155
206 Ga0466971_0001409 3300044719 Bacteria 10103
207 Ga0466970_0006648 3300044765 Bacteria 5780
208 Ga0466970_0141453 3300044765 Bacteria 1326
209 Ga0466970_0328404 3300044765 Bacteria 865
210 Ga0466957_0057689 3300044842 Bacteria 2377
211 Ga0466960_0021978 3300044901 Bacteria 2847
212 Ga0466960_0055534 3300044901 Bacteria 1926
213 Ga0466960_0080726 3300044901 Bacteria 1638
214 Ga0466958_0146855 3300045836 Bacteria 1486
215 Ga0466967_0015977 3300045976 Bacteria 5903
216 Ga0495592_0048583 3300046454 Bacteria 3156
217 Ga0495651_0262909 3300046462 Bacteria 1173
218 Ga0495653_0037817 3300046463 Bacteria 3789
219 Ga0495582_0168433 3300046473 Bacteria 1247
220 Ga0495664_0019134 3300046477 Bacteria 3933
221 Ga0495664_0043307 3300046477 Bacteria 2667
222 Ga0495608_0217554 3300046511 Bacteria 1199
223 Ga0495628_0093428 3300046516 Bacteria 2326
224 Ga0495652_0068995 3300046529 Bacteria 2960
225 Ga0495640_0043100 3300046533 Bacteria 3144
226 Ga0495645_0152710 3300046543 Bacteria 1602
227 Ga0495667_0237044 3300046559 Bacteria 1162
228 Ga0495634_0114717 3300046642 Bacteria 1730
229 Ga0495634_0202801 3300046642 Bacteria 1231
230 Ga0495599_0036860 3300046678 Bacteria 3072
231 Ga0495646_0043297 3300046680 Bacteria 2758
232 Ga0495600_0031954 3300046809 Bacteria 3413
233 Ga0495680_0034374 3300047322 Bacteria 4093
234 Ga0495684_0015541 3300047471 Bacteria 5860
235 Ga0496101_0006093 3300048904 Bacteria 7745
236 Ga0496106_0103120 3300048909 Bacteria 2213
237 Ga0496108_0000414 3300048911 Bacteria 34876
238 Ga0496108_0249366 3300048911 Bacteria 1544
239 Ga0496110_0205757 3300048913 Bacteria 1789
240 Ga0496114_0073027 3300048917 Bacteria 2887
241 Ga0496114_0111573 3300048917 Bacteria 2344
242 Ga0496115_0034350 3300048918 Bacteria 4008
243 Ga0496126_0099524 3300048929 Bacteria 2546
244 Ga0496126_0210914 3300048929 Bacteria 1635
245 Ga0501311_028191 3300049527 Bacteria 800
246 Ga0501315_016831 3300049531 Bacteria 950
247 Ga0501316_018696 3300049532 Bacteria 858
248 Ga0501316_019610 3300049532 Bacteria 843
249 Ga0501322_005720 3300049538 Bacteria 868
250 Ga0501036_0033093 3300049572 Bacteria 4372
251 Ga0501036_0321456 3300049572 Bacteria 1293
252 Ga0501037_0112579 3300049573 Bacteria 1960
253 Ga0501037_0187642 3300049573 Bacteria 1465
254 Ga0501038_0185456 3300049574 Bacteria 1677
255 Ga0501039_0067189 3300049575 Bacteria 2784
256 Ga0501039_0107674 3300049575 Bacteria 2178
257 Ga0501039_0212172 3300049575 Bacteria 1522
258 Ga0501040_0055796 3300049576 Bacteria 2710
259 Ga0501040_0097245 3300049576 Bacteria 2051
260 Ga0501042_0027283 3300049578 Bacteria 4015
261 Ga0501042_0179472 3300049578 Bacteria 1527
262 Ga0501048_0109294 3300049582 Bacteria 1952
263 Ga0501067_0274335 3300049583 Bacteria 939
264 Ga0501068_0172576 3300049584 Bacteria 1365
265 Ga0501069_0125913 3300049585 Bacteria 1465
266 Ga0501070_0142960 3300049586 Bacteria 1975
267 Ga0501070_0453570 3300049586 Bacteria 1034
268 Ga0501071_0181582 3300049587 Bacteria 1577
269 Ga0501071_0375193 3300049587 Bacteria 1084
270 Ga0501073_0032330 3300049589 Bacteria 3729
271 Ga0501075_0427471 3300049591 Bacteria 1010
272 Ga0501076_0215576 3300049592 Bacteria 1569
273 Ga0501077_0441092 3300049593 Bacteria 834
274 Ga0501080_0151696 3300049742 Bacteria 2141
275 Ga0501035_0274853 3300049822 Bacteria 1425
276 Ga0501044_0489826 3300049823 Bacteria 1132
277 Ga0501045_0040262 3300049824 Bacteria 3401
278 Ga0501045_0085485 3300049824 Bacteria 2328
279 Ga0501045_0123335 3300049824 Bacteria 1924
280 Ga0501045_0196266 3300049824 Bacteria 1504
281 Ga0501045_0386967 3300049824 Bacteria 1041
282 nmdc:mga03683_46764_c1 3300050489 Bacteria 1794
283 nmdc:mga03n38_5926_c1 3300050490 Bacteria 4203
284 nmdc:mga00v17_10442_c1 3300050491 Bacteria 5071
285 nmdc:mga00v17_111863_c1 3300050491 Bacteria 1733
286 nmdc:mga00v17_123225_c1 3300050491 Bacteria 1652
287 nmdc:mga00v17_69476_c1 3300050491 Bacteria 2180
288 nmdc:mga0yw44_107064_c1 3300050492 Bacteria 1788
289 nmdc:mga0yw44_57050_c1 3300050492 Bacteria 2381
290 nmdc:mga0yw44_73022_c1 3300050492 Bacteria 2134
291 nmdc:mga06z11_15328_c1 3300050494 Bacteria 3418
292 nmdc:mga06z11_170412_c1 3300050494 Bacteria 1250
293 nmdc:mga06z11_70616_c1 3300050494 Bacteria 1847
294 nmdc:mga04h51_4433_c1 3300050495 Bacteria 3492
295 nmdc:mga07m45_16916_c1 3300050496 Bacteria 3909
296 nmdc:mga07m45_26659_c1 3300050496 Bacteria 3177
297 Ga0495601_0040690 3300053077 Bacteria 2912
298 Ga0500644_0000278 3300053088 Bacteria 28510
299 Ga0500641_0090699 3300053096 Bacteria 1304
300 Ga0500556_0001083 3300053104 Bacteria 13734
301 Ga0500560_008266 3300053107 Bacteria 2496
302 Ga0500560_045298 3300053107 Bacteria 1395
303 Ga0500593_000052 3300053117 Bacteria 42002
304 Ga0500573_0094047 3300053140 Bacteria 1691
305 Ga0500604_0129358 3300053151 Bacteria 848
306 Ga0500620_062913 3300053155 Bacteria 1266
307 Ga0501084_0303497 3300054114 Bacteria 1349
308 Ga0501084_0317418 3300054114 Bacteria 1316
309 Ga0587111_0013866 3300060346 Bacteria 1448
310 Ga0501082_0273240 3300060353 Bacteria 1471
311 Ga0501082_0520463 3300060353 Bacteria 1040
312 Ga0466962_0112445 3300061719 Bacteria 1311
313 Ga0530510_0279073 3300061734 Bacteria 1248
314 Ga0530510_0343999 3300061734 Bacteria 1120
315 2643824344 2643221561 Bacteria 4984412
316 2644033469 2643221604 Bacteria 5014917
317 2644090959 2643221615 Bacteria 5487866
318 2644101549 2643221617 Bacteria 5139111
319 2644118798 2643221620 Bacteria 5134593
320 2644320762 2643221657 Bacteria 5490246
321 2644534764 2643221696 Bacteria 5431823
322 2812334232 2811994874 Bacteria 5367947
323 2984579439 2984576629 Bacteria 4248407
324 2990257048 2990256926 Bacteria 4252839
325 8002780388 8002775197 Bacteria 10728764
326 8054613646 8054609563 Bacteria 5170090
327 Ga0070707_100150152
328 LJQas_1007862
329 JGI24738J21930_10015255
330 Ga0006562J51391_1165288
331 Ga0070683_100106597
332 Ga0070683_100211578
333 Ga0070682_100017341
334 Ga0070660_100032983
335 Ga0070689_100154940
336 Ga0070691_10010912
337 Ga0070687_100056901
338 Ga0070661_100194466
339 Ga0070692_10018211
340 Ga0070675_100361080
341 Ga0070659_100032710
342 Ga0070667_100012833
343 Ga0070709_10125823
344 Ga0070709_10127032
345 Ga0070714_100035663
346 Ga0070714_100075999
347 Ga0070714_100098429
348 Ga0070714_100213831
349 Ga0070713_100134475
350 Ga0070713_100256334
351 Ga0070710_10020785
352 Ga0070701_10060094
353 Ga0070711_100216388
354 Ga0070700_100015170
355 Ga0070663_100036434
356 Ga0070663_100120726
357 Ga0070678_100348234
358 Ga0070662_100108032
359 Ga0070662_100172395
360 Ga0070698_100001109
361 Ga0070698_100014895
362 Ga0070684_100299504
363 Ga0070672_100068369
364 Ga0070664_100108949
365 Ga0068856_100631077
366 Ga0070702_100052625
367 Ga0068852_100047163
368 Ga0068861_100161513
369 Ga0068870_10226775
370 Ga0068860_100000237
371 Ga0081539_10021241
372 Ga0075365_10001856
373 Ga0075365_10088914
374 Ga0075365_10095084
375 Ga0075365_10245961
376 Ga0075365_10478667
377 Ga0075368_10008369
378 Ga0075363_100004621
379 Ga0075363_100006234
380 Ga0075363_100036758
381 Ga0075363_100134126
382 Ga0075363_100173787
383 Ga0075363_100301726
384 Ga0075364_10005045
385 Ga0075364_10013474
386 Ga0075364_10018483
387 Ga0075364_10022986
388 Ga0075364_10072382
389 Ga0070716_100003535
390 Ga0070712_100222643
391 Ga0075362_10023706
392 Ga0075367_10011797
393 Ga0075367_10083857
394 Ga0075367_10184702
395 Ga0075367_10226541
396 Ga0097621_100178704
397 Ga0075370_10001272
398 Ga0075370_10009502
399 Ga0075370_10016842
400 Ga0075370_10045949
401 Ga0105245_10055101
402 Ga0105243_10013957
403 Ga0105243_10429395
404 Ga0105242_10235964
405 Ga0105242_10799772
406 Ga0105248_10572331
407 Ga0105237_10065526
408 Ga0157369_10049823
409 Ga0157369_10970087
410 Ga0157374_10411266
411 Ga0157372_10460727
412 Ga0157375_10028053
413 Ga0157375_10290981
414 Ga0157377_10032806
415 Ga0163161_10288140
416 Ga0197907_10993734
417 Ga0206354_10893739
418 Ga0206353_12006754
419 Ga0213876_10045212
420 Ga0213875_10001835
421 Ga0224712_10017291
422 Ga0207642_10185717
423 Ga0207647_10006449
424 Ga0207647_10073154
425 Ga0207647_10114364
426 Ga0207699_10006153
427 Ga0207693_10246544
428 Ga0207693_10307336
429 Ga0207663_10173259
430 Ga0207660_10261366
431 Ga0207657_10004479
432 Ga0207652_10278316
433 Ga0207659_10266246
434 Ga0207687_10210307
435 Ga0207700_10008420
436 Ga0207700_10137086
437 Ga0207664_10002754
438 Ga0207664_10090891
439 Ga0207664_10099901
440 Ga0207664_10133601
441 Ga0207664_10374900
442 Ga0207690_10030632
443 Ga0207690_10063777
444 Ga0207706_10365842
445 Ga0207665_10003433
446 Ga0207691_10131684
447 Ga0207711_10092888
448 Ga0207661_10103586
449 Ga0207661_10323473
450 Ga0207661_10378067
451 Ga0207661_10388213
452 Ga0207658_10023179
453 Ga0207658_10043117
454 Ga0207639_10579650
455 Ga0207678_10010026
456 Ga0207678_10040130
457 Ga0207678_10376169
458 Ga0207708_10002995
459 Ga0207708_10004292
460 Ga0207702_10548763
461 Ga0207675_100007153
462 Ga0207698_10016079
463 Ga0207698_10255068
464 Ga0209813_10005148
465 Ga0209813_10005869
466 Ga0207428_10078385
467 Ga0268264_10000195
468 Ga0265337_1001275
469 Ga0265319_1004305
470 Ga0265334_10001156
471 Ga0265318_10007243
472 Ga0265322_10009164
473 Ga0265338_10001831
474 Ga0265338_10004214
475 Ga0265338_10026341
476 Ga0265332_10001697
477 Ga0265320_10009958
478 Ga0265325_10009084
479 Ga0265316_10019339
480 Ga0307408_100379697
481 Ga0265313_10018752
482 Ga0307508_10317405
483 Ga0265342_10021721
484 Ga0316576_10011671
485 Ga0316576_10240767
486 Ga0316578_10069247
487 Ga0307405_10145148
488 Ga0307413_10518373
489 Ga0307410_10084562
490 Ga0307410_10189555
491 Ga0307406_10618805
492 Ga0307407_10383223
493 Ga0307409_100035747
494 Ga0307409_100224988
495 Ga0307416_100016245
496 Ga0307416_100302063
497 Ga0307416_100607251
498 Ga0307415_100019214
499 Ga0307415_100240768
500 Ga0373934_0082346
501 Ga0373936_0069265
502 Ga0373953_0044261
503 Ga0373954_0054020
504 Ga0373956_0013575
505 Ga0373957_0114036
506 Ga0373935_0295104
507 Ga0373933_0248345
508 Ga0373937_0117462
509 Ga0373937_0363836
510 Ga0373925_0000360
511 Ga0373925_0059907
512 Ga0395899_0060187
513 Ga0395900_0110915
514 Ga0395900_0482692
515 Ga0395898_0233466
516 Ga0395898_0662832
517 Ga0395898_0675563
518 Ga0436364_0044689
519 Ga0436364_0583902
520 Ga0436365_0116602
521 Ga0436363_1703132
522 Ga0451853_1270728
523 Ga0451853_1292950
524 Ga0466969_0126974
525 Ga0466972_0106540
526 Ga0466965_0007648
527 Ga0466965_0251553
528 Ga0466966_0017280
529 Ga0466961_0110783
530 Ga0466963_0041498
531 Ga0466964_0029859
532 Ga0466971_0001409
533 Ga0466970_0006648
534 Ga0466970_0141453
535 Ga0466970_0328404
536 Ga0466957_0057689
537 Ga0466960_0021978
538 Ga0466960_0055534
539 Ga0466960_0080726
540 Ga0466958_0146855
541 Ga0466967_0015977
542 Ga0495592_0048583
543 Ga0495651_0262909
544 Ga0495653_0037817
545 Ga0495582_0168433
546 Ga0495664_0019134
547 Ga0495664_0043307
548 Ga0495608_0217554
549 Ga0495628_0093428
550 Ga0495652_0068995
551 Ga0495640_0043100
552 Ga0495645_0152710
553 Ga0495667_0237044
554 Ga0495634_0114717
555 Ga0495634_0202801
556 Ga0495599_0036860
557 Ga0495646_0043297
558 Ga0495600_0031954
559 Ga0495680_0034374
560 Ga0495684_0015541
561 Ga0496101_0006093
562 Ga0496106_0103120
563 Ga0496108_0000414
564 Ga0496108_0249366
565 Ga0496110_0205757
566 Ga0496114_0073027
567 Ga0496114_0111573
568 Ga0496115_0034350
569 Ga0496126_0099524
570 Ga0496126_0210914
571 Ga0501311_028191
572 Ga0501315_016831
573 Ga0501316_018696
574 Ga0501316_019610
575 Ga0501322_005720
576 Ga0501036_0033093
577 Ga0501036_0321456
578 Ga0501037_0112579
579 Ga0501037_0187642
580 Ga0501038_0185456
581 Ga0501039_0067189
582 Ga0501039_0107674
583 Ga0501039_0212172
584 Ga0501040_0055796
585 Ga0501040_0097245
586 Ga0501042_0027283
587 Ga0501042_0179472
588 Ga0501048_0109294
589 Ga0501067_0274335
590 Ga0501068_0172576
591 Ga0501069_0125913
592 Ga0501070_0142960
593 Ga0501070_0453570
594 Ga0501071_0181582
595 Ga0501071_0375193
596 Ga0501073_0032330
597 Ga0501075_0427471
598 Ga0501076_0215576
599 Ga0501077_0441092
600 Ga0501080_0151696
601 Ga0501035_0274853
602 Ga0501044_0489826
603 Ga0501045_0040262
604 Ga0501045_0085485
605 Ga0501045_0123335
606 Ga0501045_0196266
607 Ga0501045_0386967
608 nmdc:mga03683_46764_c1
609 nmdc:mga03n38_5926_c1
610 nmdc:mga00v17_10442_c1
611 nmdc:mga00v17_111863_c1
612 nmdc:mga00v17_123225_c1
613 nmdc:mga00v17_69476_c1
614 nmdc:mga0yw44_107064_c1
615 nmdc:mga0yw44_57050_c1
616 nmdc:mga0yw44_73022_c1
617 nmdc:mga06z11_15328_c1
618 nmdc:mga06z11_170412_c1
619 nmdc:mga06z11_70616_c1
620 nmdc:mga04h51_4433_c1
621 nmdc:mga07m45_16916_c1
622 nmdc:mga07m45_26659_c1
623 Ga0495601_0040690
624 Ga0500644_0000278
625 Ga0500641_0090699
626 Ga0500556_0001083
627 Ga0500560_008266
628 Ga0500560_045298
629 Ga0500593_000052
630 Ga0500573_0094047
631 Ga0500604_0129358
632 Ga0500620_062913
633 Ga0501084_0303497
634 Ga0501084_0317418
635 Ga0587111_0013866
636 Ga0501082_0273240
637 Ga0501082_0520463
638 Ga0466962_0112445
639 Ga0530510_0279073
640 Ga0530510_0343999
641 2643824344
642 2644033469
643 2644090959
644 2644101549
645 2644118798
646 2644320762
647 2644534764
648 2812334232
649 2984579439
650 2990257048
651 8002780388
652 8054613646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

53

286

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.8714 4 257
2pw6-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein jw3007 from escherichia coli k12 0.868 4 257
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7534 5 256
8iq8-assembly1.cif.gz_D crystal structure of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (dhpao) from acinetobacter baumannii 0.7381 5 256
3vsh-assembly1.cif.gz_C crystal structure of native 1,6-apd (with iron), 2-animophenol-1,6-dioxygenase 0.7319 5 256
ID Description Score Start End Superfamily
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9232 6 257 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9149 4 257 3.40.830.10
af_I1MQB9_2_262_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9025 6 257 3.40.830.10
af_P24197_1_271_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9013 4 257 3.40.830.10
af_Q54W77_1_267_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8935 1 257 3.40.830.10
ID Description Score Start End GO Terms
AF-V8CSU1-F1-model_v4 Extradiol ring-cleavage dioxygenase 0.9935 3 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A545AFX4-F1-model_v4 Dioxygenase 0.9925 4 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7J5WZE7-F1-model_v4 4,5-DOPA dioxygenase extradiol (EC 1.13.11.29) 0.9923 4 257 GO:0008198
GO:0008270
GO:0050297
AF-A0A5A7XQ98-F1-model_v4 Dioxygenase 0.9895 5 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213
AF-A0A7K0NEE6-F1-model_v4 Dioxygenase 0.9885 107 257 GO:0008198
GO:0008270
GO:0016701
GO:0051213

Map