F408169

General Info

Members Datasets Scaffolds Average Seq Length
326 190 652 298

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100013444|Ga0070669_1000134444
Length 348
Sequence MSRTAIRLVLLVVVAAGVGAYFYLHRAPAALVLTGIVTTDDVIVSPQIGGQIEQLLVKEGDAVKKGQLVAVIVPDELRADTAYYSHNVAGLSSQVQESEAALRFQERQTADQILQAESNLAASEAQVVAAAADLENARLVYSRTENLSKRGVIAPQELDQSRTAASAAQAKLDALKKQVDAQRAAVALARSTAEQTAVRRSQVQANEHMKAAANAQRTKADVRLRYTELHAPIDGIVDVRAVRMGEVVNPGQPVVTVINQDDLWVRVDVEESYIDRVRIGDTLTVRLPSGVERQGTVFFRGVDASFATQRDVSRTKRDIKTFEVRLRVDNSDRRLAVGMTAYVVLPIS

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
130 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 1.84
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100013444 3300005353 Bacteria 5818
2 Ga0065712_10005368 3300005290 Bacteria 4132
3 Ga0070676_10001628 3300005328 Bacteria 11411
4 Ga0070683_100022152 3300005329 Bacteria 5677
5 Ga0070683_100025238 3300005329 Bacteria 5335
6 Ga0070683_100033388 3300005329 Bacteria 4692
7 Ga0070690_100195424 3300005330 Bacteria 1405
8 Ga0070670_100004652 3300005331 Bacteria 11512
9 Ga0068869_100001679 3300005334 Bacteria 13221
10 Ga0070666_10059493 3300005335 Bacteria 2584
11 Ga0070666_10073368 3300005335 Bacteria 2331
12 Ga0070666_10172069 3300005335 Bacteria 1517
13 Ga0070680_100016399 3300005336 Bacteria 5830
14 Ga0070680_100020012 3300005336 Bacteria 5305
15 Ga0070680_100294850 3300005336 Bacteria 1375
16 Ga0068868_100364197 3300005338 Bacteria 1241
17 Ga0070689_100255892 3300005340 Bacteria 1446
18 Ga0070687_100008204 3300005343 Bacteria 4408
19 Ga0070669_100116213 3300005353 Bacteria 2036
20 Ga0070675_100000204 3300005354 Bacteria 37628
21 Ga0070675_100044019 3300005354 Bacteria 3650
22 Ga0070671_100144378 3300005355 Bacteria 2009
23 Ga0070674_100293872 3300005356 Bacteria 1293
24 Ga0070673_100024245 3300005364 Bacteria 4446
25 Ga0070673_100044140 3300005364 Bacteria 3450
26 Ga0070673_100096254 3300005364 Bacteria 2429
27 Ga0070673_100227437 3300005364 Bacteria 1617
28 Ga0070673_100318293 3300005364 Bacteria 1374
29 Ga0070667_100033620 3300005367 Bacteria 4288
30 Ga0070667_100268678 3300005367 Bacteria 1529
31 Ga0070709_10075868 3300005434 Bacteria 2182
32 Ga0070714_100058974 3300005435 Bacteria 3290
33 Ga0070700_100004566 3300005441 Bacteria 7245
34 Ga0070678_100096869 3300005456 Bacteria 2277
35 Ga0070678_100255938 3300005456 Bacteria 1470
36 Ga0070678_100325486 3300005456 Bacteria 1314
37 Ga0070662_100287122 3300005457 Bacteria 1333
38 Ga0070681_10029432 3300005458 Bacteria 5515
39 Ga0070681_10050754 3300005458 Bacteria 4139
40 Ga0068867_100002578 3300005459 Bacteria 12771
41 Ga0070685_10169588 3300005466 Bacteria 1398
42 Ga0070685_10212535 3300005466 Unclassified 1263
43 Ga0070707_100361598 3300005468 Bacteria 1410
44 Ga0070698_100010527 3300005471 Bacteria 9858
45 Ga0070698_100330318 3300005471 Bacteria 1456
46 Ga0070699_100026032 3300005518 Bacteria 5045
47 Ga0070699_100063469 3300005518 Bacteria 3203
48 Ga0070699_100136866 3300005518 Unclassified 2161
49 Ga0070679_100040286 3300005530 Bacteria 4648
50 Ga0070679_100181254 3300005530 Bacteria 2078
51 Ga0070684_100030058 3300005535 Bacteria 4613
52 Ga0070684_100055871 3300005535 Bacteria 3443
53 Ga0070697_100198866 3300005536 Bacteria 1703
54 Ga0070686_100034635 3300005544 Bacteria 3113
55 Ga0070686_100240914 3300005544 Bacteria 1317
56 Ga0070696_100026293 3300005546 Bacteria 3959
57 Ga0070665_100313905 3300005548 Bacteria 1571
58 Ga0068855_100194282 3300005563 Bacteria 2287
59 Ga0068854_100032237 3300005578 Bacteria 3644
60 Ga0068854_100093810 3300005578 Bacteria 2238
61 Ga0068852_100220618 3300005616 Bacteria 1803
62 Ga0068859_100108548 3300005617 Bacteria 2837
63 Ga0068864_100049643 3300005618 Bacteria 3610
64 Ga0068864_100083852 3300005618 Bacteria 2799
65 Ga0068861_100024202 3300005719 Bacteria 4389
66 Ga0068861_100076620 3300005719 Bacteria 2607
67 Ga0068861_100305079 3300005719 Bacteria 1381
68 Ga0068851_10106764 3300005834 Bacteria 1491
69 Ga0068863_100002375 3300005841 Bacteria 18726
70 Ga0068858_100191856 3300005842 Bacteria 1931
71 Ga0068860_100213601 3300005843 Bacteria 1871
72 Ga0068860_100289023 3300005843 Bacteria 1604
73 Ga0068862_100001611 3300005844 Bacteria 20547
74 Ga0081539_10000108 3300005985 Bacteria 195322
75 Ga0081539_10003019 3300005985 Bacteria 21854
76 Ga0075364_10032924 3300006051 Bacteria 3334
77 Ga0075367_10186501 3300006178 Bacteria 1294
78 Ga0097621_100134739 3300006237 Bacteria 2106
79 Ga0075428_100012594 3300006844 Bacteria 9403
80 Ga0075428_100092510 3300006844 Bacteria 3297
81 Ga0075428_100118449 3300006844 Bacteria 2884
82 Ga0075428_100301912 3300006844 Unclassified 1721
83 Ga0075430_100056714 3300006846 Bacteria 3294
84 Ga0075431_100024549 3300006847 Bacteria 6178
85 Ga0075431_100169800 3300006847 Bacteria 2241
86 Ga0075433_10012517 3300006852 Bacteria 6859
87 Ga0075433_10083885 3300006852 Bacteria 2812
88 Ga0075433_10113500 3300006852 Bacteria 2404
89 Ga0075433_10143259 3300006852 Bacteria 2124
90 Ga0075433_10166198 3300006852 Bacteria 1964
91 Ga0075434_100000026 3300006871 Bacteria 68165
92 Ga0075434_100004506 3300006871 Bacteria 12570
93 Ga0075434_100017152 3300006871 Bacteria 6970
94 Ga0075434_100031934 3300006871 Bacteria 5192
95 Ga0075434_100253067 3300006871 Bacteria 1780
96 Ga0075434_100401846 3300006871 Bacteria 1391
97 Ga0075434_100429046 3300006871 Bacteria 1343
98 Ga0075436_100001236 3300006914 Bacteria 17354
99 Ga0075436_100016171 3300006914 Bacteria 5108
100 Ga0075436_100018893 3300006914 Bacteria 4720
101 Ga0075436_100069645 3300006914 Bacteria 2431
102 Ga0097620_100108549 3300006931 Bacteria 2837
103 Ga0075435_100000017 3300007076 Bacteria 99666
104 Ga0075435_100016947 3300007076 Bacteria 5501
105 Ga0075435_100064178 3300007076 Bacteria 2983
106 Ga0075435_100100574 3300007076 Bacteria 2395
107 Ga0075435_100257072 3300007076 Bacteria 1488
108 Ga0105240_10027034 3300009093 Bacteria 7521
109 Ga0105240_10116151 3300009093 Bacteria 3229
110 Ga0105240_10155286 3300009093 Unclassified 2723
111 Ga0111539_10041132 3300009094 Bacteria 5559
112 Ga0111539_10062729 3300009094 Bacteria 4399
113 Ga0111539_10199800 3300009094 Bacteria 2331
114 Ga0105245_10239674 3300009098 Bacteria 1757
115 Ga0105247_10009361 3300009101 Bacteria 5948
116 Ga0105247_10079099 3300009101 Bacteria 2069
117 Ga0114129_10005856 3300009147 Bacteria 17405
118 Ga0114129_10008640 3300009147 Bacteria 14522
119 Ga0114129_10009604 3300009147 Bacteria 13798
120 Ga0114129_10012152 3300009147 Bacteria 12254
121 Ga0114129_10057881 3300009147 Bacteria 5423
122 Ga0114129_10100596 3300009147 Bacteria 4000
123 Ga0114129_10182347 3300009147 Bacteria 2856
124 Ga0114129_10307666 3300009147 Bacteria 2110
125 Ga0105243_10006909 3300009148 Bacteria 8746
126 Ga0105243_10314464 3300009148 Bacteria 1424
127 Ga0105243_10413317 3300009148 Unclassified 1256
128 Ga0105241_10136725 3300009174 Bacteria 1991
129 Ga0105241_10171542 3300009174 Bacteria 1792
130 Ga0105242_10032538 3300009176 Bacteria 4170
131 Ga0105248_10002596 3300009177 Bacteria 20105
132 Ga0105248_10259566 3300009177 Bacteria 1956
133 Ga0105248_10432052 3300009177 Bacteria 1483
134 Ga0105248_10514305 3300009177 Unclassified 1350
135 Ga0105238_10535273 3300009551 Unclassified 1175
136 Ga0157373_10027862 3300013100 Bacteria 4075
137 Ga0157373_10067869 3300013100 Bacteria 2521
138 Ga0157370_10026903 3300013104 Bacteria 5674
139 Ga0157370_10050617 3300013104 Bacteria 3970
140 Ga0157369_10050898 3300013105 Bacteria 4484
141 Ga0157378_10176123 3300013297 Unclassified 2009
142 Ga0157378_10387973 3300013297 Unclassified 1373
143 Ga0163162_10063413 3300013306 Bacteria 3738
144 Ga0157372_10009462 3300013307 Bacteria 10362
145 Ga0157372_10597694 3300013307 Bacteria 1286
146 Ga0157375_10030708 3300013308 Bacteria 5070
147 Ga0157375_10244209 3300013308 Bacteria 1955
148 Ga0157375_10631329 3300013308 Bacteria 1229
149 Ga0163163_10000047 3300014325 Bacteria 131685
150 Ga0163163_10005764 3300014325 Bacteria 10758
151 Ga0163163_10060619 3300014325 Bacteria 3747
152 Ga0157380_10001630 3300014326 Bacteria 14783
153 Ga0157377_10078579 3300014745 Bacteria 1923
154 Ga0157379_10211110 3300014968 Bacteria 1757
155 Ga0157379_10230611 3300014968 Bacteria 1678
156 Ga0206356_11453660 3300020070 Bacteria 1783
157 Ga0206354_10472831 3300020081 Unclassified 1345
158 Ga0207710_10004773 3300025900 Bacteria 5879
159 Ga0207680_10085979 3300025903 Bacteria 1988
160 Ga0207645_10002403 3300025907 Bacteria 14735
161 Ga0207643_10019552 3300025908 Bacteria 3713
162 Ga0207654_10262750 3300025911 Unclassified 1161
163 Ga0207707_10006800 3300025912 Bacteria 9978
164 Ga0207707_10034161 3300025912 Bacteria 4449
165 Ga0207695_10003247 3300025913 Bacteria 23138
166 Ga0207695_10016111 3300025913 Bacteria 8769
167 Ga0207695_10043509 3300025913 Bacteria 4786
168 Ga0207662_10010229 3300025918 Bacteria 5174
169 Ga0207662_10083610 3300025918 Bacteria 1951
170 Ga0207649_10107978 3300025920 Bacteria 1854
171 Ga0207652_10006480 3300025921 Bacteria 9439
172 Ga0207652_10073998 3300025921 Bacteria 2965
173 Ga0207652_10154528 3300025921 Bacteria 2055
174 Ga0207681_10005118 3300025923 Bacteria 8052
175 Ga0207681_10028436 3300025923 Bacteria 3621
176 Ga0207681_10144699 3300025923 Bacteria 1774
177 Ga0207659_10000201 3300025926 Bacteria 35674
178 Ga0207659_10029154 3300025926 Bacteria 3758
179 Ga0207687_10396339 3300025927 Bacteria 1134
180 Ga0207644_10030243 3300025931 Bacteria 3764
181 Ga0207706_10053717 3300025933 Bacteria 3556
182 Ga0207706_10130747 3300025933 Bacteria 2208
183 Ga0207686_10001288 3300025934 Bacteria 14382
184 Ga0207709_10030179 3300025935 Bacteria 3152
185 Ga0207670_10018000 3300025936 Bacteria 4283
186 Ga0207670_10098747 3300025936 Bacteria 2081
187 Ga0207669_10242681 3300025937 Bacteria 1336
188 Ga0207691_10005953 3300025940 Bacteria 11779
189 Ga0207691_10113978 3300025940 Bacteria 2402
190 Ga0207711_10005439 3300025941 Bacteria 10768
191 Ga0207689_10003099 3300025942 Bacteria 15289
192 Ga0207661_10025021 3300025944 Bacteria 4533
193 Ga0207679_10041465 3300025945 Bacteria 3300
194 Ga0207667_10116576 3300025949 Bacteria 2752
195 Ga0207651_10047803 3300025960 Bacteria 2888
196 Ga0207651_10079616 3300025960 Bacteria 2354
197 Ga0207651_10099623 3300025960 Bacteria 2152
198 Ga0207712_10351144 3300025961 Bacteria 1226
199 Ga0207640_10026145 3300025981 Bacteria 3541
200 Ga0207640_10072565 3300025981 Bacteria 2323
201 Ga0207708_10001656 3300026075 Bacteria 16570
202 Ga0207708_10131099 3300026075 Bacteria 1960
203 Ga0207641_10015691 3300026088 Bacteria 6206
204 Ga0207648_10000646 3300026089 Bacteria 39114
205 Ga0207648_10513985 3300026089 Bacteria 1097
206 Ga0207676_10001407 3300026095 Bacteria 17876
207 Ga0207676_10061964 3300026095 Bacteria 2964
208 Ga0207675_100034730 3300026118 Bacteria 4703
209 Ga0207675_100132774 3300026118 Bacteria 2361
210 Ga0207675_100188844 3300026118 Unclassified 1975
211 Ga0207683_10078102 3300026121 Bacteria 2933
212 Ga0207683_10104753 3300026121 Bacteria 2528
213 Ga0209974_10023216 3300027876 Bacteria 2053
214 Ga0207428_10033414 3300027907 Bacteria 4225
215 Ga0268266_10062140 3300028379 Bacteria 3222
216 Ga0268265_10007550 3300028380 Bacteria 7339
217 Ga0268264_10371227 3300028381 Bacteria 1367
218 Ga0265330_10000013 3300031235 Bacteria 177129
219 Ga0265328_10036191 3300031239 Bacteria 1824
220 Ga0265320_10022644 3300031240 Bacteria 3358
221 Ga0265325_10009799 3300031241 Bacteria 5580
222 Ga0265331_10006118 3300031250 Bacteria 7162
223 Ga0265316_10000032 3300031344 Bacteria 160775
224 Ga0265314_10000004 3300031711 Bacteria 939480
225 Ga0265342_10000162 3300031712 Bacteria 75047
226 Ga0316576_10006698 3300031727 Bacteria 7198
227 Ga0316583_10008733 3300032133 Bacteria 3656
228 Ga0373930_0003245 3300034816 Bacteria 2571
229 Ga0373948_0010612 3300034817 Bacteria 1612
230 Ga0373959_0003133 3300034820 Bacteria 2633
231 Ga0373938_0000961 3300034957 Bacteria 4624
232 Ga0373929_0001216 3300035085 Bacteria 4975
233 Ga0373934_0004021 3300035086 Bacteria 5414
234 Ga0373940_0018413 3300035088 Unclassified 1752
235 Ga0373951_0001197 3300035091 Bacteria 6861
236 Ga0373923_0040287 3300035111 Bacteria 1922
237 Ga0373932_0000205 3300035112 Bacteria 17455
238 Ga0373956_0004171 3300035119 Bacteria 5792
239 Ga0373957_0004398 3300035120 Bacteria 4285
240 Ga0373960_0001877 3300035121 Bacteria 4703
241 Ga0373955_0015470 3300035172 Bacteria 3737
242 Ga0373942_0001612 3300035207 Bacteria 5777
243 Ga0373961_0000239 3300035241 Bacteria 25540
244 Ga0373933_0034576 3300035724 Bacteria 2946
245 Ga0373937_0000878 3300036401 Bacteria 25776
246 Ga0373937_0001526 3300036401 Bacteria 19483
247 Ga0373937_0448670 3300036401 Unclassified 1225
248 Ga0316582_0017645 3300036647 Bacteria 4135
249 Ga0439435_0008733 3300042436 Bacteria 2358
250 Ga0451577_0104430 3300042876 Bacteria 2532
251 Ga0451576_0004346 3300045051 Bacteria 18494
252 Ga0451576_0046329 3300045051 Bacteria 4579
253 Ga0451576_0057829 3300045051 Bacteria 4053
254 Ga0451576_0106073 3300045051 Bacteria 2924
255 Ga0495651_0120277 3300046462 Bacteria 1930
256 Ga0495609_0076823 3300046538 Bacteria 1463
257 Ga0495646_0148225 3300046680 Unclassified 1307
258 Ga0495680_0043120 3300047322 Bacteria 3575
259 Ga0495684_0215810 3300047471 Bacteria 1409
260 Ga0496101_0328453 3300048904 Unclassified 1200
261 Ga0496108_0013349 3300048911 Bacteria 6698
262 Ga0496109_0087068 3300048912 Bacteria 2885
263 Ga0496110_0069246 3300048913 Bacteria 3125
264 Ga0496112_0044178 3300048915 Bacteria 4365
265 Ga0496113_0058699 3300048916 Bacteria 2896
266 Ga0501032_0005062 3300049569 Bacteria 9848
267 Ga0501034_0003112 3300049571 Bacteria 19120
268 Ga0501036_0027435 3300049572 Bacteria 4811
269 Ga0501039_0027168 3300049575 Bacteria 4400
270 Ga0501043_0034993 3300049579 Bacteria 3950
271 Ga0501046_0025765 3300049580 Bacteria 4809
272 Ga0501047_0000611 3300049581 Bacteria 37850
273 Ga0501047_0002312 3300049581 Bacteria 18231
274 Ga0501067_0066970 3300049583 Bacteria 1987
275 Ga0501068_0022598 3300049584 Bacteria 3678
276 Ga0501073_0129715 3300049589 Bacteria 1747
277 Ga0501080_0025660 3300049742 Bacteria 5473
278 Ga0501083_0011911 3300049744 Bacteria 6093
279 Ga0501083_0064517 3300049744 Bacteria 2440
280 Ga0501083_0093996 3300049744 Bacteria 1979
281 Ga0501044_0019058 3300049823 Bacteria 7346
282 nmdc:mga00v17_136947_c1 3300050491 Bacteria 1568
283 nmdc:mga06z11_116726_c1 3300050494 Bacteria 1484
284 nmdc:mga05p37_10185_c1 3300050507 Bacteria 11160
285 nmdc:mga05p37_142367_c1 3300050507 Bacteria 2937
286 nmdc:mga05p37_36249_c1 3300050507 Bacteria 6053
287 nmdc:mga05p37_3735_c1 3300050507 Bacteria 17816
288 nmdc:mga05p37_432229_c1 3300050507 Bacteria 1529
289 nmdc:mga05p37_68831_c1 3300050507 Bacteria 4353
290 nmdc:mga05p37_83581_c2 3300050507 Bacteria 3077
291 nmdc:mga05p37_89596_c1 3300050507 Bacteria 3791
292 nmdc:mga05p37_96257_c1 3300050507 Bacteria 3647
293 nmdc:mga09592_103361_c1 3300050508 Bacteria 2441
294 nmdc:mga09592_218868_c1 3300050508 Bacteria 1650
295 nmdc:mga0qj67_265218_c1 3300050509 Bacteria 1393
296 nmdc:mga0qj67_83367_c1 3300050509 Bacteria 2563
297 nmdc:mga06r32_26467_c1 3300050510 Bacteria 5408
298 nmdc:mga08y16_410615_c1 3300050511 Bacteria 1385
299 nmdc:mga08y16_631062_c1 3300050511 Bacteria 1077
300 nmdc:mga08y16_78625_c1 3300050511 Bacteria 3439
301 nmdc:mga0n895_144445_c1 3300050512 Bacteria 2408
302 nmdc:mga0n895_185550_c1 3300050512 Bacteria 2111
303 nmdc:mga0n895_250294_c1 3300050512 Bacteria 1798
304 nmdc:mga0n895_37_c1 3300050512 Bacteria 77167
305 nmdc:mga0n895_62738_c1 3300050512 Bacteria 3674
306 nmdc:mga0n895_6872_c2 3300050512 Bacteria 8711
307 nmdc:mga0rr50_119397_c1 3300050513 Bacteria 2096
308 nmdc:mga0rr50_13805_c1 3300050513 Bacteria 5275
309 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
310 nmdc:mga0rr50_179397_c1 3300050513 Bacteria 1730
311 nmdc:mga0rr50_226111_c1 3300050513 Bacteria 1547
312 nmdc:mga0rr50_96023_c1 3300050513 Bacteria 2318
313 nmdc:mga08x19_19444_c1 3300050514 Bacteria 4167
314 nmdc:mga08x19_19535_c1 3300050514 Bacteria 4160
315 nmdc:mga08x19_275_c1 3300050514 Bacteria 38855
316 nmdc:mga08x19_5227_c1 3300050514 Bacteria 7682
317 nmdc:mga0a205_1267_c2 3300050515 Bacteria 12352
318 nmdc:mga0a205_17267_c1 3300050515 Bacteria 6761
319 nmdc:mga0a205_181976_c1 3300050515 Bacteria 1996
320 nmdc:mga0a205_3830_c1 3300050515 Bacteria 13478
321 nmdc:mga0a205_5966_c1 3300050515 Bacteria 10978
322 nmdc:mga0a205_92495_c1 3300050515 Bacteria 2922
323 Ga0500616_0000383 3300053153 Bacteria 61884
324 Ga0500645_000160 3300053730 Bacteria 52261
325 Ga0501084_0065346 3300054114 Bacteria 3043
326 Ga0501082_0051093 3300060353 Bacteria 3563
327 Ga0070669_100013444
328 Ga0065712_10005368
329 Ga0070676_10001628
330 Ga0070683_100022152
331 Ga0070683_100025238
332 Ga0070683_100033388
333 Ga0070690_100195424
334 Ga0070670_100004652
335 Ga0068869_100001679
336 Ga0070666_10059493
337 Ga0070666_10073368
338 Ga0070666_10172069
339 Ga0070680_100016399
340 Ga0070680_100020012
341 Ga0070680_100294850
342 Ga0068868_100364197
343 Ga0070689_100255892
344 Ga0070687_100008204
345 Ga0070669_100116213
346 Ga0070675_100000204
347 Ga0070675_100044019
348 Ga0070671_100144378
349 Ga0070674_100293872
350 Ga0070673_100024245
351 Ga0070673_100044140
352 Ga0070673_100096254
353 Ga0070673_100227437
354 Ga0070673_100318293
355 Ga0070667_100033620
356 Ga0070667_100268678
357 Ga0070709_10075868
358 Ga0070714_100058974
359 Ga0070700_100004566
360 Ga0070678_100096869
361 Ga0070678_100255938
362 Ga0070678_100325486
363 Ga0070662_100287122
364 Ga0070681_10029432
365 Ga0070681_10050754
366 Ga0068867_100002578
367 Ga0070685_10169588
368 Ga0070685_10212535
369 Ga0070707_100361598
370 Ga0070698_100010527
371 Ga0070698_100330318
372 Ga0070699_100026032
373 Ga0070699_100063469
374 Ga0070699_100136866
375 Ga0070679_100040286
376 Ga0070679_100181254
377 Ga0070684_100030058
378 Ga0070684_100055871
379 Ga0070697_100198866
380 Ga0070686_100034635
381 Ga0070686_100240914
382 Ga0070696_100026293
383 Ga0070665_100313905
384 Ga0068855_100194282
385 Ga0068854_100032237
386 Ga0068854_100093810
387 Ga0068852_100220618
388 Ga0068859_100108548
389 Ga0068864_100049643
390 Ga0068864_100083852
391 Ga0068861_100024202
392 Ga0068861_100076620
393 Ga0068861_100305079
394 Ga0068851_10106764
395 Ga0068863_100002375
396 Ga0068858_100191856
397 Ga0068860_100213601
398 Ga0068860_100289023
399 Ga0068862_100001611
400 Ga0081539_10000108
401 Ga0081539_10003019
402 Ga0075364_10032924
403 Ga0075367_10186501
404 Ga0097621_100134739
405 Ga0075428_100012594
406 Ga0075428_100092510
407 Ga0075428_100118449
408 Ga0075428_100301912
409 Ga0075430_100056714
410 Ga0075431_100024549
411 Ga0075431_100169800
412 Ga0075433_10012517
413 Ga0075433_10083885
414 Ga0075433_10113500
415 Ga0075433_10143259
416 Ga0075433_10166198
417 Ga0075434_100000026
418 Ga0075434_100004506
419 Ga0075434_100017152
420 Ga0075434_100031934
421 Ga0075434_100253067
422 Ga0075434_100401846
423 Ga0075434_100429046
424 Ga0075436_100001236
425 Ga0075436_100016171
426 Ga0075436_100018893
427 Ga0075436_100069645
428 Ga0097620_100108549
429 Ga0075435_100000017
430 Ga0075435_100016947
431 Ga0075435_100064178
432 Ga0075435_100100574
433 Ga0075435_100257072
434 Ga0105240_10027034
435 Ga0105240_10116151
436 Ga0105240_10155286
437 Ga0111539_10041132
438 Ga0111539_10062729
439 Ga0111539_10199800
440 Ga0105245_10239674
441 Ga0105247_10009361
442 Ga0105247_10079099
443 Ga0114129_10005856
444 Ga0114129_10008640
445 Ga0114129_10009604
446 Ga0114129_10012152
447 Ga0114129_10057881
448 Ga0114129_10100596
449 Ga0114129_10182347
450 Ga0114129_10307666
451 Ga0105243_10006909
452 Ga0105243_10314464
453 Ga0105243_10413317
454 Ga0105241_10136725
455 Ga0105241_10171542
456 Ga0105242_10032538
457 Ga0105248_10002596
458 Ga0105248_10259566
459 Ga0105248_10432052
460 Ga0105248_10514305
461 Ga0105238_10535273
462 Ga0157373_10027862
463 Ga0157373_10067869
464 Ga0157370_10026903
465 Ga0157370_10050617
466 Ga0157369_10050898
467 Ga0157378_10176123
468 Ga0157378_10387973
469 Ga0163162_10063413
470 Ga0157372_10009462
471 Ga0157372_10597694
472 Ga0157375_10030708
473 Ga0157375_10244209
474 Ga0157375_10631329
475 Ga0163163_10000047
476 Ga0163163_10005764
477 Ga0163163_10060619
478 Ga0157380_10001630
479 Ga0157377_10078579
480 Ga0157379_10211110
481 Ga0157379_10230611
482 Ga0206356_11453660
483 Ga0206354_10472831
484 Ga0207710_10004773
485 Ga0207680_10085979
486 Ga0207645_10002403
487 Ga0207643_10019552
488 Ga0207654_10262750
489 Ga0207707_10006800
490 Ga0207707_10034161
491 Ga0207695_10003247
492 Ga0207695_10016111
493 Ga0207695_10043509
494 Ga0207662_10010229
495 Ga0207662_10083610
496 Ga0207649_10107978
497 Ga0207652_10006480
498 Ga0207652_10073998
499 Ga0207652_10154528
500 Ga0207681_10005118
501 Ga0207681_10028436
502 Ga0207681_10144699
503 Ga0207659_10000201
504 Ga0207659_10029154
505 Ga0207687_10396339
506 Ga0207644_10030243
507 Ga0207706_10053717
508 Ga0207706_10130747
509 Ga0207686_10001288
510 Ga0207709_10030179
511 Ga0207670_10018000
512 Ga0207670_10098747
513 Ga0207669_10242681
514 Ga0207691_10005953
515 Ga0207691_10113978
516 Ga0207711_10005439
517 Ga0207689_10003099
518 Ga0207661_10025021
519 Ga0207679_10041465
520 Ga0207667_10116576
521 Ga0207651_10047803
522 Ga0207651_10079616
523 Ga0207651_10099623
524 Ga0207712_10351144
525 Ga0207640_10026145
526 Ga0207640_10072565
527 Ga0207708_10001656
528 Ga0207708_10131099
529 Ga0207641_10015691
530 Ga0207648_10000646
531 Ga0207648_10513985
532 Ga0207676_10001407
533 Ga0207676_10061964
534 Ga0207675_100034730
535 Ga0207675_100132774
536 Ga0207675_100188844
537 Ga0207683_10078102
538 Ga0207683_10104753
539 Ga0209974_10023216
540 Ga0207428_10033414
541 Ga0268266_10062140
542 Ga0268265_10007550
543 Ga0268264_10371227
544 Ga0265330_10000013
545 Ga0265328_10036191
546 Ga0265320_10022644
547 Ga0265325_10009799
548 Ga0265331_10006118
549 Ga0265316_10000032
550 Ga0265314_10000004
551 Ga0265342_10000162
552 Ga0316576_10006698
553 Ga0316583_10008733
554 Ga0373930_0003245
555 Ga0373948_0010612
556 Ga0373959_0003133
557 Ga0373938_0000961
558 Ga0373929_0001216
559 Ga0373934_0004021
560 Ga0373940_0018413
561 Ga0373951_0001197
562 Ga0373923_0040287
563 Ga0373932_0000205
564 Ga0373956_0004171
565 Ga0373957_0004398
566 Ga0373960_0001877
567 Ga0373955_0015470
568 Ga0373942_0001612
569 Ga0373961_0000239
570 Ga0373933_0034576
571 Ga0373937_0000878
572 Ga0373937_0001526
573 Ga0373937_0448670
574 Ga0316582_0017645
575 Ga0439435_0008733
576 Ga0451577_0104430
577 Ga0451576_0004346
578 Ga0451576_0046329
579 Ga0451576_0057829
580 Ga0451576_0106073
581 Ga0495651_0120277
582 Ga0495609_0076823
583 Ga0495646_0148225
584 Ga0495680_0043120
585 Ga0495684_0215810
586 Ga0496101_0328453
587 Ga0496108_0013349
588 Ga0496109_0087068
589 Ga0496110_0069246
590 Ga0496112_0044178
591 Ga0496113_0058699
592 Ga0501032_0005062
593 Ga0501034_0003112
594 Ga0501036_0027435
595 Ga0501039_0027168
596 Ga0501043_0034993
597 Ga0501046_0025765
598 Ga0501047_0000611
599 Ga0501047_0002312
600 Ga0501067_0066970
601 Ga0501068_0022598
602 Ga0501073_0129715
603 Ga0501080_0025660
604 Ga0501083_0011911
605 Ga0501083_0064517
606 Ga0501083_0093996
607 Ga0501044_0019058
608 nmdc:mga00v17_136947_c1
609 nmdc:mga06z11_116726_c1
610 nmdc:mga05p37_10185_c1
611 nmdc:mga05p37_142367_c1
612 nmdc:mga05p37_36249_c1
613 nmdc:mga05p37_3735_c1
614 nmdc:mga05p37_432229_c1
615 nmdc:mga05p37_68831_c1
616 nmdc:mga05p37_83581_c2
617 nmdc:mga05p37_89596_c1
618 nmdc:mga05p37_96257_c1
619 nmdc:mga09592_103361_c1
620 nmdc:mga09592_218868_c1
621 nmdc:mga0qj67_265218_c1
622 nmdc:mga0qj67_83367_c1
623 nmdc:mga06r32_26467_c1
624 nmdc:mga08y16_410615_c1
625 nmdc:mga08y16_631062_c1
626 nmdc:mga08y16_78625_c1
627 nmdc:mga0n895_144445_c1
628 nmdc:mga0n895_185550_c1
629 nmdc:mga0n895_250294_c1
630 nmdc:mga0n895_37_c1
631 nmdc:mga0n895_62738_c1
632 nmdc:mga0n895_6872_c2
633 nmdc:mga0rr50_119397_c1
634 nmdc:mga0rr50_13805_c1
635 nmdc:mga0rr50_14_c1
636 nmdc:mga0rr50_179397_c1
637 nmdc:mga0rr50_226111_c1
638 nmdc:mga0rr50_96023_c1
639 nmdc:mga08x19_19444_c1
640 nmdc:mga08x19_19535_c1
641 nmdc:mga08x19_275_c1
642 nmdc:mga08x19_5227_c1
643 nmdc:mga0a205_1267_c2
644 nmdc:mga0a205_17267_c1
645 nmdc:mga0a205_181976_c1
646 nmdc:mga0a205_3830_c1
647 nmdc:mga0a205_5966_c1
648 nmdc:mga0a205_92495_c1
649 Ga0500616_0000383
650 Ga0500645_000160
651 Ga0501084_0065346
652 Ga0501082_0051093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

38

82

0.92

PF13437

HlyD_3

HlyD family secretion protein

228

338

0.86

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

28

341

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ks8-assembly1.cif.gz_C crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.9449 36 65
5ks8-assembly1.cif.gz_F crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus 0.942 36 66
2b8f-assembly1.cif.gz_A solution structure of bacillus subtilis blap apo form (energy minimized mean structure) 0.897 37 65
5csa-assembly1.cif.gz_A crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.89 36 65
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.889 36 226
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9748 33 228 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9588 33 228 2.40.50.100
3n6rA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9575 35 65 2.40.50.100
af_P9WPQ1_4_71_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9563 37 66 2.40.50.100
af_P19262_68_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9558 197 228 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A3D4Z3W7-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8287 21 316 GO:0030313
AF-A0A1Q3K5H2-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8143 20 316 GO:0015679
GO:0030288
GO:0046914
GO:0060003
AF-A0A3A0FPX5-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8103 20 317 GO:0005886
GO:0015679
GO:0022857
GO:0030313
GO:0060003
AF-A0A139SJ11-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7914 21 316 GO:0005886
GO:0015562
GO:1990281
AF-A0A6N7B3C2-F1-model_v4 RND family efflux transporter MFP subunit 0.7856 21 317 GO:0005886
GO:0022857
GO:0030313

Map