F408114

General Info

Members Datasets Scaffolds Average Seq Length
326 200 325 207

Family's Representative Sequence

Representative Sequence 3300002155|JGI24033J26618_1019922|JGI24033J26618_10199222
Length 226
Sequence MLKWLYQFLYKILKHVSRQLSIXALLVIFALGCKQNKKEAPASEKVITPDSIKNQAQEVTVNPYASVDISPMDMSYFPVDYPKIKMAHANISPPVMRVIYSRPHLQRRALFNGILKYDEPWRLGANEASEIDFYKPVSIQGKKISAGRYIIYGIPHVDKWTIILNSNIDSWGLKQDSTKDVGSFEVPVLTNNVSLEYFTMVFEKTESGADLLIAWADVLARLQIKF

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
133 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
197 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
198 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 0
Rhizoplane 0.61
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3359027 2162886011 Unclassified 3028
2 JGI24746J21847_1032756 3300001977 Bacteria 717
3 JGI24033J26618_1019922 3300002155 Bacteria 853
4 rootH1_10007419 3300003316 Bacteria 5985
5 rootH2_10136073 3300003320 Bacteria 1371
6 rootL2_10015226 3300003322 Bacteria 2205
7 rootH1_10121894 3300003323 Bacteria 3833
8 Ga0065712_10068802 3300005290 Bacteria 8971
9 Ga0065707_10114435 3300005295 Unclassified 2283
10 Ga0070676_10011797 3300005328 Unclassified 4756
11 Ga0070676_10047122 3300005328 Bacteria 2516
12 Ga0070676_10142478 3300005328 Bacteria 1527
13 Ga0070676_10148966 3300005328 Unclassified 1496
14 Ga0070690_100036376 3300005330 Bacteria 3094
15 Ga0070690_100598793 3300005330 Bacteria 836
16 Ga0070670_100012200 3300005331 Bacteria 7348
17 Ga0070670_100031969 3300005331 Unclassified 4531
18 Ga0070670_100047942 3300005331 Bacteria 3677
19 Ga0070670_100187348 3300005331 Bacteria 1797
20 Ga0070670_100499657 3300005331 Bacteria 1081
21 Ga0070670_100521187 3300005331 Bacteria 1058
22 Ga0070670_100708959 3300005331 Bacteria 905
23 Ga0068869_100010197 3300005334 Bacteria 6118
24 Ga0068869_100035276 3300005334 Bacteria 3544
25 Ga0068869_100069601 3300005334 Unclassified 2602
26 Ga0068869_100091498 3300005334 Bacteria 2288
27 Ga0070666_10007984 3300005335 Bacteria 6543
28 Ga0068868_100008955 3300005338 Bacteria 7182
29 Ga0068868_100022282 3300005338 Bacteria 4778
30 Ga0070689_100041802 3300005340 Unclassified 3518
31 Ga0070687_100316291 3300005343 Bacteria 996
32 Ga0070668_100003950 3300005347 Bacteria 10961
33 Ga0070668_100127243 3300005347 Bacteria 2041
34 Ga0070668_100254009 3300005347 Bacteria 1460
35 Ga0070668_100538073 3300005347 Unclassified 1015
36 Ga0070669_100006032 3300005353 Bacteria 8743
37 Ga0070669_100011389 3300005353 Bacteria 6314
38 Ga0070669_100012225 3300005353 Bacteria 6093
39 Ga0070675_100003918 3300005354 Bacteria 11275
40 Ga0070675_100103510 3300005354 Bacteria 2401
41 Ga0070671_100023840 3300005355 Bacteria 5008
42 Ga0070674_100008285 3300005356 Bacteria 6183
43 Ga0070674_100552712 3300005356 Bacteria 966
44 Ga0070673_100003907 3300005364 Bacteria 9364
45 Ga0070673_100035123 3300005364 Bacteria 3799
46 Ga0070673_100209251 3300005364 Bacteria 1683
47 Ga0070688_100004791 3300005365 Bacteria 7073
48 Ga0070667_100138758 3300005367 Bacteria 2127
49 Ga0070667_100286576 3300005367 Bacteria 1480
50 Ga0070667_100473115 3300005367 Bacteria 1147
51 Ga0070701_10021670 3300005438 Unclassified 3071
52 Ga0070700_100052719 3300005441 Unclassified 2537
53 Ga0070694_100320301 3300005444 Bacteria 1193
54 Ga0070678_100153728 3300005456 Bacteria 1856
55 Ga0070678_100391913 3300005456 Bacteria 1204
56 Ga0070662_100006612 3300005457 Bacteria 7484
57 Ga0070662_100045395 3300005457 Bacteria 3152
58 Ga0070662_100078615 3300005457 Bacteria 2451
59 Ga0068867_100026586 3300005459 Unclassified 4156
60 Ga0068867_100130136 3300005459 Unclassified 1955
61 Ga0068867_100553285 3300005459 Bacteria 997
62 Ga0070698_100109631 3300005471 Bacteria 2727
63 Ga0068853_100038148 3300005539 Bacteria 4091
64 Ga0070672_100171014 3300005543 Unclassified 1807
65 Ga0070686_100199938 3300005544 Unclassified 1432
66 Ga0070665_100046206 3300005548 Bacteria 4374
67 Ga0070665_100365499 3300005548 Unclassified 1449
68 Ga0070665_101080134 3300005548 Unclassified 814
69 Ga0068855_100007850 3300005563 Bacteria 12895
70 Ga0068857_100004492 3300005577 Bacteria 11788
71 Ga0068857_100016759 3300005577 Bacteria 6419
72 Ga0068854_100052321 3300005578 Bacteria 2928
73 Ga0068854_100313764 3300005578 Bacteria 1272
74 Ga0068856_100010240 3300005614 Bacteria 9115
75 Ga0068859_100029185 3300005617 Bacteria 5535
76 Ga0068859_100034405 3300005617 Bacteria 5085
77 Ga0068859_100044134 3300005617 Bacteria 4480
78 Ga0068859_100349524 3300005617 Bacteria 1573
79 Ga0068864_100011380 3300005618 Bacteria 7353
80 Ga0068866_10105318 3300005718 Bacteria 1563
81 Ga0068866_10434353 3300005718 Unclassified 855
82 Ga0068861_100013519 3300005719 Bacteria 5712
83 Ga0068861_100017420 3300005719 Bacteria 5100
84 Ga0068861_100025993 3300005719 Bacteria 4251
85 Ga0068870_10007092 3300005840 Bacteria 4980
86 Ga0068863_100128814 3300005841 Bacteria 2415
87 Ga0068858_100365053 3300005842 Bacteria 1384
88 Ga0068858_100395165 3300005842 Bacteria 1328
89 Ga0068860_100056149 3300005843 Bacteria 3745
90 Ga0068860_100142909 3300005843 Bacteria 2301
91 Ga0068860_100252382 3300005843 Bacteria 1718
92 Ga0068860_100371028 3300005843 Bacteria 1411
93 Ga0068862_100034005 3300005844 Bacteria 4311
94 Ga0081455_10516139 3300005937 Bacteria 798
95 Ga0075366_10017856 3300006195 Bacteria 4091
96 Ga0075366_10020949 3300006195 Bacteria 3798
97 Ga0075366_10215716 3300006195 Bacteria 1169
98 Ga0097621_100018051 3300006237 Bacteria 5378
99 Ga0097621_100112559 3300006237 Bacteria 2301
100 Ga0068871_100039436 3300006358 Bacteria 3779
101 Ga0068871_100542614 3300006358 Bacteria 1052
102 Ga0068865_100133940 3300006881 Bacteria 1859
103 Ga0097620_100029185 3300006931 Bacteria 5535
104 Ga0097620_100034407 3300006931 Bacteria 5085
105 Ga0097620_100044135 3300006931 Bacteria 4480
106 Ga0097620_100349522 3300006931 Bacteria 1573
107 Ga0105240_10636654 3300009093 Unclassified 1170
108 Ga0111539_10000458 3300009094 Bacteria 51231
109 Ga0105247_10002017 3300009101 Bacteria 14059
110 Ga0114129_10010459 3300009147 Bacteria 13234
111 Ga0105241_10045504 3300009174 Bacteria 3330
112 Ga0105241_10063146 3300009174 Bacteria 2857
113 Ga0105241_10416275 3300009174 Bacteria 1182
114 Ga0105242_10002072 3300009176 Bacteria 15818
115 Ga0105242_10014334 3300009176 Bacteria 6140
116 Ga0105242_10029871 3300009176 Bacteria 4350
117 Ga0105242_10480725 3300009176 Bacteria 1177
118 Ga0105237_10050281 3300009545 Bacteria 4188
119 Ga0105249_10001273 3300009553 Bacteria 22114
120 Ga0105249_10002674 3300009553 Bacteria 15414
121 Ga0105249_10003210 3300009553 Bacteria 14149
122 Ga0105249_10019703 3300009553 Bacteria 6021
123 Ga0105239_10000992 3300010375 Bacteria 39769
124 Ga0105239_10070654 3300010375 Bacteria 3835
125 Ga0157374_10035399 3300013296 Bacteria 4568
126 Ga0157374_10184474 3300013296 Bacteria 2039
127 Ga0157374_10186605 3300013296 Bacteria 2027
128 Ga0157374_10362738 3300013296 Bacteria 1441
129 Ga0157378_10116677 3300013297 Bacteria 2455
130 Ga0157378_10219438 3300013297 Bacteria 1807
131 Ga0157378_10647621 3300013297 Bacteria 1072
132 Ga0163162_10089033 3300013306 Bacteria 3167
133 Ga0157372_10040072 3300013307 Bacteria 5172
134 Ga0157375_10013435 3300013308 Bacteria 7286
135 Ga0157375_10679072 3300013308 Bacteria 1185
136 Ga0157375_10790826 3300013308 Bacteria 1098
137 Ga0163163_10060843 3300014325 Bacteria 3741
138 Ga0157380_10002400 3300014326 Bacteria 12600
139 Ga0157380_10732360 3300014326 Unclassified 998
140 Ga0157377_10002011 3300014745 Bacteria 8909
141 Ga0157377_10074769 3300014745 Unclassified 1966
142 Ga0157379_10258345 3300014968 Bacteria 1582
143 Ga0163161_10005686 3300017792 Bacteria 8646
144 Ga0209646_1002730 3300025246 Bacteria 3759
145 Ga0207697_10094322 3300025315 Bacteria 1270
146 Ga0207682_10086774 3300025893 Bacteria 1350
147 Ga0207642_10109610 3300025899 Bacteria 1403
148 Ga0207642_10487022 3300025899 Bacteria 753
149 Ga0207710_10001084 3300025900 Bacteria 14005
150 Ga0207688_10001032 3300025901 Bacteria 14255
151 Ga0207680_10023597 3300025903 Bacteria 3362
152 Ga0207645_10000529 3300025907 Bacteria 31798
153 Ga0207645_10098930 3300025907 Bacteria 1881
154 Ga0207645_10134465 3300025907 Bacteria 1610
155 Ga0207645_10313669 3300025907 Unclassified 1045
156 Ga0207643_10006052 3300025908 Bacteria 6464
157 Ga0207695_10449760 3300025913 Unclassified 1171
158 Ga0207662_10200261 3300025918 Unclassified 1292
159 Ga0207649_10094636 3300025920 Bacteria 1963
160 Ga0207681_10080689 3300025923 Bacteria 2295
161 Ga0207681_10226682 3300025923 Unclassified 1448
162 Ga0207681_10349996 3300025923 Bacteria 1182
163 Ga0207650_10127870 3300025925 Unclassified 1985
164 Ga0207650_10442223 3300025925 Bacteria 1081
165 Ga0207650_10563760 3300025925 Bacteria 956
166 Ga0207644_10218258 3300025931 Unclassified 1510
167 Ga0207706_10005719 3300025933 Bacteria 11581
168 Ga0207706_10029708 3300025933 Bacteria 4878
169 Ga0207706_10040972 3300025933 Bacteria 4106
170 Ga0207686_10106384 3300025934 Bacteria 1883
171 Ga0207670_10013982 3300025936 Unclassified 4752
172 Ga0207669_10321367 3300025937 Bacteria 1185
173 Ga0207691_10011756 3300025940 Bacteria 8402
174 Ga0207691_10103963 3300025940 Unclassified 2532
175 Ga0207689_10001844 3300025942 Bacteria 20051
176 Ga0207689_10003063 3300025942 Bacteria 15398
177 Ga0207689_10023885 3300025942 Bacteria 5128
178 Ga0207689_10034555 3300025942 Bacteria 4199
179 Ga0207689_10047030 3300025942 Bacteria 3564
180 Ga0207689_10177844 3300025942 Unclassified 1755
181 Ga0207667_10000969 3300025949 Bacteria 36612
182 Ga0207651_10019680 3300025960 Bacteria 4053
183 Ga0207651_10088073 3300025960 Bacteria 2262
184 Ga0207712_10002001 3300025961 Bacteria 13381
185 Ga0207712_10002689 3300025961 Bacteria 11351
186 Ga0207712_10005902 3300025961 Bacteria 7722
187 Ga0207712_10022808 3300025961 Bacteria 4125
188 Ga0207668_10066194 3300025972 Bacteria 2560
189 Ga0207668_10074353 3300025972 Unclassified 2439
190 Ga0207668_10494340 3300025972 Unclassified 1051
191 Ga0207640_10258242 3300025981 Bacteria 1356
192 Ga0207658_10133283 3300025986 Bacteria 1999
193 Ga0207658_10167054 3300025986 Unclassified 1809
194 Ga0207658_10309439 3300025986 Bacteria 1364
195 Ga0207677_10070381 3300026023 Bacteria 2465
196 Ga0207677_10597897 3300026023 Bacteria 968
197 Ga0207703_10133069 3300026035 Bacteria 2150
198 Ga0207708_10034717 3300026075 Unclassified 3836
199 Ga0207702_10049274 3300026078 Bacteria 3554
200 Ga0207641_10245381 3300026088 Bacteria 1671
201 Ga0207648_10007341 3300026089 Bacteria 10853
202 Ga0207648_10045096 3300026089 Unclassified 3868
203 Ga0207648_10061278 3300026089 Bacteria 3281
204 Ga0207648_10104696 3300026089 Unclassified 2482
205 Ga0207648_10648521 3300026089 Unclassified 976
206 Ga0207674_10004270 3300026116 Bacteria 17239
207 Ga0207674_10022366 3300026116 Bacteria 6789
208 Ga0207674_10047265 3300026116 Bacteria 4413
209 Ga0207674_10672585 3300026116 Bacteria 1000
210 Ga0207675_100000646 3300026118 Bacteria 34270
211 Ga0207675_100002469 3300026118 Bacteria 18305
212 Ga0207675_100018789 3300026118 Bacteria 6450
213 Ga0207683_10002257 3300026121 Bacteria 16909
214 Ga0207683_10008246 3300026121 Bacteria 8910
215 Ga0207698_10667513 3300026142 Unclassified 1031
216 Ga0268266_10111383 3300028379 Bacteria 2425
217 Ga0268266_10633903 3300028379 Bacteria 1028
218 Ga0268265_10024291 3300028380 Bacteria 4287
219 Ga0268264_10036593 3300028381 Bacteria 4045
220 Ga0268264_10217932 3300028381 Bacteria 1755
221 Ga0268264_10302954 3300028381 Bacteria 1505
222 Ga0307513_10051117 3300031456 Bacteria 4462
223 Ga0307513_10099018 3300031456 Bacteria 2945
224 Ga0307513_10101549 3300031456 Bacteria 2898
225 Ga0307513_10362494 3300031456 Bacteria 1194
226 Ga0307509_10025235 3300031507 Bacteria 6642
227 Ga0373956_0169755 3300035119 Bacteria 1030
228 Ga0373955_0022926 3300035172 Unclassified 3174
229 Ga0373935_0601933 3300035692 Unclassified 804
230 Ga0373933_0014213 3300035724 Bacteria 4422
231 Ga0373937_0071297 3300036401 Unclassified 3204
232 Ga0439436_0014836 3300041404 Bacteria 2347
233 Ga0439439_0000467 3300041406 Bacteria 6911
234 Ga0439439_0023858 3300041406 Bacteria 1534
235 Ga0439465_0004571 3300041413 Bacteria 4471
236 Ga0451797_1102267 3300041453 Bacteria 1034
237 Ga0451800_1287260 3300041459 Bacteria 1530
238 Ga0451851_0380242 3300041507 Bacteria 1266
239 Ga0439449_0021213 3300042007 Bacteria 2432
240 Ga0439449_0047123 3300042007 Bacteria 1596
241 Ga0439449_0057922 3300042007 Bacteria 1430
242 Ga0439454_013410 3300042011 Viruses 1125
243 Ga0439455_0051799 3300042012 Bacteria 1074
244 Ga0439457_045199 3300042014 Viruses 984
245 Ga0450894_026582 3300042131 Viruses 795
246 Ga0450898_001928 3300042134 Bacteria 2825
247 Ga0439434_0008924 3300042435 Bacteria 2946
248 Ga0466969_0000110 3300044656 Bacteria 43267
249 Ga0466972_0000049 3300044658 Bacteria 118829
250 Ga0466965_0448820 3300044683 Bacteria 718
251 Ga0466966_0000015 3300044684 Bacteria 127402
252 Ga0466968_0008793 3300044735 Bacteria 3874
253 Ga0466957_0011189 3300044842 Bacteria 5169
254 Ga0466959_0000030 3300045049 Bacteria 111343
255 Ga0495638_0246110 3300046460 Bacteria 988
256 Ga0495650_0026388 3300046471 Bacteria 2704
257 Ga0495580_0268113 3300046472 Bacteria 1167
258 Ga0495608_0047157 3300046511 Unclassified 2865
259 Ga0495628_0056871 3300046516 Unclassified 3078
260 Ga0495630_0039766 3300046517 Bacteria 3516
261 Ga0495632_0111536 3300046519 Bacteria 1284
262 Ga0495643_0050523 3300046522 Bacteria 2239
263 Ga0495640_0152501 3300046533 Unclassified 1484
264 Ga0495586_0279665 3300046535 Unclassified 955
265 Ga0495587_0376577 3300046536 Unclassified 790
266 Ga0495634_0053659 3300046642 Unclassified 2700
267 Ga0495635_0145624 3300046663 Bacteria 1613
268 Ga0495646_0175474 3300046680 Bacteria 1179
269 Ga0495613_0127047 3300046689 Bacteria 1828
270 Ga0495674_0175350 3300047319 Unclassified 1787
271 Ga0495672_0014460 3300047320 Bacteria 5404
272 Ga0495680_0179563 3300047322 Unclassified 1529
273 Ga0495684_0065495 3300047471 Unclassified 2762
274 Ga0501031_0053095 3300049568 Bacteria 2640
275 Ga0501032_0056039 3300049569 Bacteria 2650
276 Ga0501032_0108900 3300049569 Bacteria 1834
277 Ga0501034_0001968 3300049571 Bacteria 26034
278 Ga0501036_0025419 3300049572 Bacteria 4994
279 Ga0501036_0337091 3300049572 Bacteria 1259
280 Ga0501037_0020842 3300049573 Bacteria 4840
281 Ga0501037_0167186 3300049573 Bacteria 1565
282 Ga0501038_0043476 3300049574 Bacteria 3906
283 Ga0501039_0200127 3300049575 Unclassified 1570
284 Ga0501042_0079325 3300049578 Bacteria 2352
285 Ga0501043_0147388 3300049579 Unclassified 1842
286 Ga0501043_0457890 3300049579 Bacteria 957
287 Ga0501046_0043716 3300049580 Bacteria 3565
288 Ga0501047_0002429 3300049581 Bacteria 17803
289 Ga0501047_0496988 3300049581 Bacteria 1046
290 Ga0501048_0006145 3300049582 Bacteria 9144
291 Ga0501068_0224317 3300049584 Bacteria 1195
292 Ga0501072_0219919 3300049588 Bacteria 1514
293 Ga0501072_0434806 3300049588 Bacteria 1040
294 Ga0501073_0075784 3300049589 Bacteria 2341
295 Ga0501074_0001160 3300049590 Bacteria 17257
296 Ga0501225_0001109 3300049705 Bacteria 8448
297 Ga0501079_0420582 3300049741 Bacteria 1049
298 Ga0501083_0001132 3300049744 Bacteria 17866
299 Ga0501035_0061176 3300049822 Bacteria 3352
300 Ga0501035_0345766 3300049822 Bacteria 1245
301 Ga0501044_0005315 3300049823 Bacteria 14325
302 nmdc:mga0k408_101973_c1 3300050493 Bacteria 1692
303 nmdc:mga0k408_15721_c1 3300050493 Bacteria 4189
304 nmdc:mga0k408_44507_c1 3300050493 Bacteria 2560
305 nmdc:mga05p37_1790_c2 3300050507 Bacteria 13235
306 nmdc:mga08y16_61093_c1 3300050511 Unclassified 3935
307 Ga0495619_0259329 3300053085 Bacteria 1205
308 Ga0500578_0000063 3300053086 Bacteria 117869
309 Ga0500578_0087486 3300053086 Bacteria 1979
310 Ga0500583_0000153 3300053092 Bacteria 28587
311 Ga0500556_0200481 3300053104 Bacteria 789
312 Ga0500572_036433 3300053111 Bacteria 1405
313 Ga0500628_018384 3300053129 Bacteria 1378
314 Ga0500652_005512 3300053131 Bacteria 3993
315 Ga0500568_0000080 3300053139 Bacteria 92694
316 Ga0500589_009686 3300053147 Bacteria 4085
317 Ga0500589_058562 3300053147 Unclassified 1771
318 Ga0500622_0039413 3300053156 Bacteria 2463
319 Ga0500622_0101555 3300053156 Bacteria 1415
320 Ga0500636_0183753 3300053177 Bacteria 1120
321 Ga0500637_0190258 3300053178 Bacteria 1173
322 Ga0500611_000003 3300053727 Bacteria 333431
323 Ga0500611_098680 3300053727 Bacteria 753
324 Ga0501084_0282005 3300054114 Bacteria 1403
325 Ga0590075_108393 3300059424 Unclassified 724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10362738 Ga0157374_103627381 177
2 3300005328 Ga0070676_10148966 Ga0070676_101489662 183
3 3300005330 Ga0070690_100036376 Ga0070690_1000363762 183
4 3300005331 Ga0070670_100047942 Ga0070670_1000479422 183
5 3300005334 Ga0068869_100091498 Ga0068869_1000914982 183
6 3300005338 Ga0068868_100022282 Ga0068868_1000222823 183
7 3300005355 Ga0070671_100023840 Ga0070671_1000238402 183
8 3300005364 Ga0070673_100035123 Ga0070673_1000351231 183
9 3300005456 Ga0070678_100391913 Ga0070678_1003919132 183
10 3300005457 Ga0070662_100045395 Ga0070662_1000453953 183
11 3300005544 Ga0070686_100199938 Ga0070686_1001999382 183
12 3300005578 Ga0068854_100052321 Ga0068854_1000523213 183
13 3300006237 Ga0097621_100112559 Ga0097621_1001125592 183
14 3300009093 Ga0105240_10636654 Ga0105240_106366542 183
15 3300009176 Ga0105242_10480725 Ga0105242_104807251 183
16 3300010375 Ga0105239_10070654 Ga0105239_100706543 183
17 3300013296 Ga0157374_10184474 Ga0157374_101844742 183
18 3300013297 Ga0157378_10116677 Ga0157378_101166774 183
19 3300013306 Ga0163162_10089033 Ga0163162_100890332 183
20 3300013307 Ga0157372_10040072 Ga0157372_100400723 183
21 3300014325 Ga0163163_10060843 Ga0163163_100608433 183
22 3300014745 Ga0157377_10074769 Ga0157377_100747692 183
23 3300017792 Ga0163161_10005686 Ga0163161_100056866 183
24 3300025907 Ga0207645_10098930 Ga0207645_100989302 183
25 3300025913 Ga0207695_10449760 Ga0207695_104497602 183
26 3300025920 Ga0207649_10094636 Ga0207649_100946362 183
27 3300025931 Ga0207644_10218258 Ga0207644_102182582 183
28 3300025933 Ga0207706_10040972 Ga0207706_100409722 183
29 3300025934 Ga0207686_10106384 Ga0207686_101063842 183
30 3300025942 Ga0207689_10034555 Ga0207689_100345552 183
31 3300025960 Ga0207651_10019680 Ga0207651_100196803 183
32 3300026023 Ga0207677_10070381 Ga0207677_100703812 183
33 3300026089 Ga0207648_10648521 Ga0207648_106485211 183
34 3300026121 Ga0207683_10002257 Ga0207683_100022576 183
35 3300053727 Ga0500611_098680 Ga0500611_098680_98_694 183
36 3300005367 Ga0070667_100286576 Ga0070667_1002865761 184
37 3300025986 Ga0207658_10167054 Ga0207658_101670542 184
38 3300003323 rootH1_10121894 rootH1_101218942 186
39 3300005331 Ga0070670_100708959 Ga0070670_1007089591 186
40 3300053727 Ga0500611_000003 Ga0500611_000003_327221_327862 188
41 3300003316 rootH1_10007419 rootH1_100074193 190
42 3300041404 Ga0439436_0014836 Ga0439436_0014836_94_684 190
43 3300042007 Ga0439449_0021213 Ga0439449_0021213_1430_2020 190
44 3300049578 Ga0501042_0079325 Ga0501042_0079325_24_614 190
45 3300050493 nmdc:mga0k408_101973_c1 nmdc:mga0k408_101973_c1_275_862 190
46 3300050493 nmdc:mga0k408_44507_c1 nmdc:mga0k408_44507_c1_1566_2156 190
47 3300041507 Ga0451851_0380242 Ga0451851_0380242_332_925 191
48 3300053156 Ga0500622_0039413 Ga0500622_0039413_119_712 191
49 3300031456 Ga0307513_10362494 Ga0307513_103624942 192
50 3300041459 Ga0451800_1287260 Ga0451800_1287260_142_735 192
51 3300044683 Ga0466965_0448820 Ga0466965_0448820_66_695 192
52 3300046460 Ga0495638_0246110 Ga0495638_0246110_113_706 192
53 3300046519 Ga0495632_0111536 Ga0495632_0111536_207_803 192
54 3300047320 Ga0495672_0014460 Ga0495672_0014460_4260_4907 192
55 3300053092 Ga0500583_0000153 Ga0500583_0000153_19491_20087 192
56 3300053104 Ga0500556_0200481 Ga0500556_0200481_118_714 192
57 3300053131 Ga0500652_005512 Ga0500652_005512_3009_3605 192
58 3300053147 Ga0500589_009686 Ga0500589_009686_621_1214 192
59 3300053156 Ga0500622_0101555 Ga0500622_0101555_704_1297 192
60 3300005718 Ga0068866_10434353 Ga0068866_104343531 195
61 3300025899 Ga0207642_10487022 Ga0207642_104870222 195
62 3300025918 Ga0207662_10200261 Ga0207662_102002612 196
63 3300046471 Ga0495650_0026388 Ga0495650_0026388_2014_2646 197
64 3300026088 Ga0207641_10245381 Ga0207641_102453812 199
65 3300005459 Ga0068867_100553285 Ga0068867_1005532852 200
66 3300005844 Ga0068862_100034005 Ga0068862_1000340054 200
67 3300009553 Ga0105249_10019703 Ga0105249_100197034 200
68 3300025961 Ga0207712_10022808 Ga0207712_100228081 200
69 3300025972 Ga0207668_10066194 Ga0207668_100661942 200
70 3300025986 Ga0207658_10133283 Ga0207658_101332832 200
71 3300028380 Ga0268265_10024291 Ga0268265_100242914 200
72 iso_pu_bacteria 2738541278 2738725578 201
73 3300049588 Ga0501072_0434806 Ga0501072_0434806_409_1029 202
74 3300006195 Ga0075366_10215716 Ga0075366_102157162 203
75 3300049569 Ga0501032_0056039 Ga0501032_0056039_484_1122 203
76 3300049571 Ga0501034_0001968 Ga0501034_0001968_19609_20247 203
77 3300049572 Ga0501036_0025419 Ga0501036_0025419_2584_3222 203
78 3300049573 Ga0501037_0020842 Ga0501037_0020842_2431_3069 203
79 3300049579 Ga0501043_0457890 Ga0501043_0457890_146_784 203
80 3300049580 Ga0501046_0043716 Ga0501046_0043716_1529_2167 203
81 3300049581 Ga0501047_0002429 Ga0501047_0002429_11226_11864 203
82 3300049582 Ga0501048_0006145 Ga0501048_0006145_2292_2930 203
83 3300049588 Ga0501072_0219919 Ga0501072_0219919_349_987 203
84 3300049589 Ga0501073_0075784 Ga0501073_0075784_1530_2168 203
85 3300049590 Ga0501074_0001160 Ga0501074_0001160_3567_4205 203
86 3300049741 Ga0501079_0420582 Ga0501079_0420582_39_677 203
87 3300049744 Ga0501083_0001132 Ga0501083_0001132_6467_7105 203
88 3300049822 Ga0501035_0061176 Ga0501035_0061176_423_1061 203
89 3300049823 Ga0501044_0005315 Ga0501044_0005315_1362_2000 203
90 3300054114 Ga0501084_0282005 Ga0501084_0282005_189_827 203
91 3300001977 JGI24746J21847_1032756 JGI24746J21847_10327561 204
92 3300005543 Ga0070672_100171014 Ga0070672_1001710142 204
93 3300005578 Ga0068854_100313764 Ga0068854_1003137641 204
94 3300005937 Ga0081455_10516139 Ga0081455_105161392 204
95 3300006195 Ga0075366_10020949 Ga0075366_100209492 204
96 3300025923 Ga0207681_10226682 Ga0207681_102266822 204
97 3300025937 Ga0207669_10321367 Ga0207669_103213672 204
98 3300025981 Ga0207640_10258242 Ga0207640_102582422 204
99 3300026023 Ga0207677_10597897 Ga0207677_105978972 204
100 3300041406 Ga0439439_0000467 Ga0439439_0000467_3224_3862 204
101 3300059424 Ga0590075_108393 Ga0590075_108393_43_681 204
102 3300003320 rootH2_10136073 rootH2_101360732 205
103 3300003322 rootL2_10015226 rootL2_100152262 205
104 3300005459 Ga0068867_100130136 Ga0068867_1001301363 205
105 3300005471 Ga0070698_100109631 Ga0070698_1001096313 205
106 3300005563 Ga0068855_100007850 Ga0068855_10000785013 205
107 3300005577 Ga0068857_100016759 Ga0068857_1000167591 205
108 3300005614 Ga0068856_100010240 Ga0068856_1000102407 205
109 3300005843 Ga0068860_100371028 Ga0068860_1003710282 205
110 3300006195 Ga0075366_10017856 Ga0075366_100178562 205
111 3300009147 Ga0114129_10010459 Ga0114129_100104599 205
112 3300009174 Ga0105241_10045504 Ga0105241_100455044 205
113 3300009545 Ga0105237_10050281 Ga0105237_100502812 205
114 3300010375 Ga0105239_10000992 Ga0105239_1000099224 205
115 3300013296 Ga0157374_10035399 Ga0157374_100353995 205
116 3300025246 Ga0209646_1002730 Ga0209646_10027305 205
117 3300025949 Ga0207667_10000969 Ga0207667_1000096912 205
118 3300026078 Ga0207702_10049274 Ga0207702_100492742 205
119 3300026089 Ga0207648_10061278 Ga0207648_100612782 205
120 3300026116 Ga0207674_10022366 Ga0207674_100223662 205
121 3300028381 Ga0268264_10302954 Ga0268264_103029542 205
122 3300031456 Ga0307513_10051117 Ga0307513_100511172 205
123 3300031456 Ga0307513_10099018 Ga0307513_100990183 205
124 3300031456 Ga0307513_10101549 Ga0307513_101015492 205
125 3300031507 Ga0307509_10025235 Ga0307509_100252353 205
126 3300041453 Ga0451797_1102267 Ga0451797_1102267_130_771 205
127 3300042007 Ga0439449_0047123 Ga0439449_0047123_288_926 205
128 3300042012 Ga0439455_0051799 Ga0439455_0051799_380_1021 205
129 3300044656 Ga0466969_0000110 Ga0466969_0000110_28523_29155 205
130 3300044658 Ga0466972_0000049 Ga0466972_0000049_19386_20030 205
131 3300044684 Ga0466966_0000015 Ga0466966_0000015_59428_60060 205
132 3300044842 Ga0466957_0011189 Ga0466957_0011189_4096_4737 205
133 3300045049 Ga0466959_0000030 Ga0466959_0000030_78639_79271 205
134 3300046680 Ga0495646_0175474 Ga0495646_0175474_156_776 205
135 3300049705 Ga0501225_0001109 Ga0501225_0001109_5226_5864 205
136 3300050493 nmdc:mga0k408_15721_c1 nmdc:mga0k408_15721_c1_1381_2016 205
137 3300050507 nmdc:mga05p37_1790_c2 nmdc:mga05p37_1790_c2_7737_8372 205
138 3300053086 Ga0500578_0000063 Ga0500578_0000063_40148_40789 205
139 3300053111 Ga0500572_036433 Ga0500572_036433_349_990 205
140 3300053147 Ga0500589_058562 Ga0500589_058562_547_1185 205
141 3300053177 Ga0500636_0183753 Ga0500636_0183753_76_717 205
142 3300005328 Ga0070676_10142478 Ga0070676_101424782 206
143 3300005331 Ga0070670_100187348 Ga0070670_1001873483 206
144 3300005347 Ga0070668_100127243 Ga0070668_1001272432 206
145 3300005367 Ga0070667_100138758 Ga0070667_1001387582 206
146 3300009174 Ga0105241_10416275 Ga0105241_104162752 206
147 3300009176 Ga0105242_10014334 Ga0105242_100143346 206
148 3300013296 Ga0157374_10186605 Ga0157374_101866053 206
149 3300013308 Ga0157375_10679072 Ga0157375_106790722 206
150 3300025899 Ga0207642_10109610 Ga0207642_101096102 206
151 3300025986 Ga0207658_10309439 Ga0207658_103094392 206
152 3300035119 Ga0373956_0169755 Ga0373956_0169755_116_739 206
153 3300035172 Ga0373955_0022926 Ga0373955_0022926_2381_3004 206
154 3300035692 Ga0373935_0601933 Ga0373935_0601933_146_769 206
155 3300035724 Ga0373933_0014213 Ga0373933_0014213_2336_2959 206
156 3300036401 Ga0373937_0071297 Ga0373937_0071297_126_749 206
157 3300044735 Ga0466968_0008793 Ga0466968_0008793_3063_3704 206
158 3300046472 Ga0495580_0268113 Ga0495580_0268113_56_691 206
159 3300046511 Ga0495608_0047157 Ga0495608_0047157_2143_2766 206
160 3300046516 Ga0495628_0056871 Ga0495628_0056871_37_660 206
161 3300046517 Ga0495630_0039766 Ga0495630_0039766_779_1402 206
162 3300046533 Ga0495640_0152501 Ga0495640_0152501_779_1402 206
163 3300046535 Ga0495586_0279665 Ga0495586_0279665_312_935 206
164 3300046536 Ga0495587_0376577 Ga0495587_0376577_38_661 206
165 3300046642 Ga0495634_0053659 Ga0495634_0053659_1774_2397 206
166 3300046663 Ga0495635_0145624 Ga0495635_0145624_436_1059 206
167 3300046689 Ga0495613_0127047 Ga0495613_0127047_247_870 206
168 3300047319 Ga0495674_0175350 Ga0495674_0175350_1150_1773 206
169 3300047322 Ga0495680_0179563 Ga0495680_0179563_773_1396 206
170 3300047471 Ga0495684_0065495 Ga0495684_0065495_1871_2494 206
171 3300053085 Ga0495619_0259329 Ga0495619_0259329_304_927 206
172 3300053086 Ga0500578_0087486 Ga0500578_0087486_923_1567 206
173 3300053178 Ga0500637_0190258 Ga0500637_0190258_144_788 206
174 3300025907 Ga0207645_10313669 Ga0207645_103136692 208
175 3300005330 Ga0070690_100598793 Ga0070690_1005987931 209
176 3300005331 Ga0070670_100012200 Ga0070670_10001220010 209
177 3300005335 Ga0070666_10007984 Ga0070666_100079846 209
178 3300005338 Ga0068868_100008955 Ga0068868_1000089553 209
179 3300005347 Ga0070668_100003950 Ga0070668_10000395012 209
180 3300005353 Ga0070669_100006032 Ga0070669_1000060322 209
181 3300005354 Ga0070675_100103510 Ga0070675_1001035101 209
182 3300005356 Ga0070674_100008285 Ga0070674_1000082853 209
183 3300005364 Ga0070673_100003907 Ga0070673_1000039079 209
184 3300005456 Ga0070678_100153728 Ga0070678_1001537282 209
185 3300005457 Ga0070662_100078615 Ga0070662_1000786152 209
186 3300005539 Ga0068853_100038148 Ga0068853_1000381484 209
187 3300005548 Ga0070665_100046206 Ga0070665_1000462062 209
188 3300005617 Ga0068859_100044134 Ga0068859_1000441342 209
189 3300005718 Ga0068866_10105318 Ga0068866_101053182 209
190 3300005719 Ga0068861_100017420 Ga0068861_1000174202 209
191 3300005719 Ga0068861_100025993 Ga0068861_1000259932 209
192 3300005840 Ga0068870_10007092 Ga0068870_100070925 209
193 3300005841 Ga0068863_100128814 Ga0068863_1001288144 209
194 3300005843 Ga0068860_100252382 Ga0068860_1002523823 209
195 3300006237 Ga0097621_100018051 Ga0097621_1000180512 209
196 3300006358 Ga0068871_100039436 Ga0068871_1000394363 209
197 3300006881 Ga0068865_100133940 Ga0068865_1001339402 209
198 3300006931 Ga0097620_100044135 Ga0097620_1000441352 209
199 3300009176 Ga0105242_10029871 Ga0105242_100298712 209
200 3300009553 Ga0105249_10002674 Ga0105249_1000267412 209
201 3300013308 Ga0157375_10790826 Ga0157375_107908262 209
202 3300025315 Ga0207697_10094322 Ga0207697_100943222 209
203 3300025893 Ga0207682_10086774 Ga0207682_100867742 209
204 3300025901 Ga0207688_10001032 Ga0207688_1000103211 209
205 3300025903 Ga0207680_10023597 Ga0207680_100235972 209
206 3300025907 Ga0207645_10000529 Ga0207645_1000052917 209
207 3300025908 Ga0207643_10006052 Ga0207643_100060522 209
208 3300025923 Ga0207681_10080689 Ga0207681_100806892 209
209 3300025925 Ga0207650_10563760 Ga0207650_105637602 209
210 3300025933 Ga0207706_10029708 Ga0207706_100297084 209
211 3300025940 Ga0207691_10011756 Ga0207691_100117562 209
212 3300025942 Ga0207689_10001844 Ga0207689_100018447 209
213 3300025942 Ga0207689_10003063 Ga0207689_100030639 209
214 3300025961 Ga0207712_10002689 Ga0207712_1000268912 209
215 3300026089 Ga0207648_10007341 Ga0207648_100073418 209
216 3300026116 Ga0207674_10047265 Ga0207674_100472655 209
217 3300026118 Ga0207675_100002469 Ga0207675_1000024699 209
218 3300026118 Ga0207675_100018789 Ga0207675_1000187897 209
219 3300026121 Ga0207683_10008246 Ga0207683_100082467 209
220 3300026142 Ga0207698_10667513 Ga0207698_106675131 209
221 3300028379 Ga0268266_10111383 Ga0268266_101113833 209
222 3300041406 Ga0439439_0023858 Ga0439439_0023858_787_1437 209
223 3300042007 Ga0439449_0057922 Ga0439449_0057922_17_661 209
224 3300042011 Ga0439454_013410 Ga0439454_013410_22_666 209
225 3300042014 Ga0439457_045199 Ga0439457_045199_135_779 209
226 3300042131 Ga0450894_026582 Ga0450894_026582_37_687 209
227 3300042134 Ga0450898_001928 Ga0450898_001928_1787_2431 209
228 3300042435 Ga0439434_0008924 Ga0439434_0008924_1559_2203 209
229 3300005328 Ga0070676_10047122 Ga0070676_100471222 210
230 3300005331 Ga0070670_100499657 Ga0070670_1004996572 210
231 3300005331 Ga0070670_100521187 Ga0070670_1005211872 210
232 3300005334 Ga0068869_100010197 Ga0068869_1000101976 210
233 3300005334 Ga0068869_100035276 Ga0068869_1000352762 210
234 3300005353 Ga0070669_100012225 Ga0070669_1000122252 210
235 3300005367 Ga0070667_100473115 Ga0070667_1004731151 210
236 3300005617 Ga0068859_100034405 Ga0068859_1000344054 210
237 3300005617 Ga0068859_100349524 Ga0068859_1003495242 210
238 3300005618 Ga0068864_100011380 Ga0068864_1000113802 210
239 3300005842 Ga0068858_100365053 Ga0068858_1003650532 210
240 3300005842 Ga0068858_100395165 Ga0068858_1003951652 210
241 3300005843 Ga0068860_100056149 Ga0068860_1000561492 210
242 3300005843 Ga0068860_100142909 Ga0068860_1001429092 210
243 3300006358 Ga0068871_100542614 Ga0068871_1005426142 210
244 3300006931 Ga0097620_100034407 Ga0097620_1000344074 210
245 3300006931 Ga0097620_100349522 Ga0097620_1003495222 210
246 3300009101 Ga0105247_10002017 Ga0105247_100020175 210
247 3300009174 Ga0105241_10063146 Ga0105241_100631463 210
248 3300009176 Ga0105242_10002072 Ga0105242_1000207213 210
249 3300009553 Ga0105249_10001273 Ga0105249_100012735 210
250 3300013297 Ga0157378_10219438 Ga0157378_102194382 210
251 3300013297 Ga0157378_10647621 Ga0157378_106476212 210
252 3300014968 Ga0157379_10258345 Ga0157379_102583452 210
253 3300025900 Ga0207710_10001084 Ga0207710_1000108412 210
254 3300025907 Ga0207645_10134465 Ga0207645_101344652 210
255 3300025923 Ga0207681_10349996 Ga0207681_103499962 210
256 3300025925 Ga0207650_10442223 Ga0207650_104422232 210
257 3300025942 Ga0207689_10023885 Ga0207689_100238852 210
258 3300025942 Ga0207689_10047030 Ga0207689_100470302 210
259 3300025961 Ga0207712_10002001 Ga0207712_100020017 210
260 3300026035 Ga0207703_10133069 Ga0207703_101330692 210
261 3300026089 Ga0207648_10104696 Ga0207648_101046964 210
262 3300026116 Ga0207674_10672585 Ga0207674_106725852 210
263 3300028381 Ga0268264_10036593 Ga0268264_100365933 210
264 3300028381 Ga0268264_10217932 Ga0268264_102179322 210
265 3300049568 Ga0501031_0053095 Ga0501031_0053095_158_802 210
266 3300049569 Ga0501032_0108900 Ga0501032_0108900_271_915 210
267 3300049572 Ga0501036_0337091 Ga0501036_0337091_566_1210 210
268 3300049573 Ga0501037_0167186 Ga0501037_0167186_687_1331 210
269 3300049574 Ga0501038_0043476 Ga0501038_0043476_2643_3287 210
270 3300049575 Ga0501039_0200127 Ga0501039_0200127_653_1297 210
271 3300049579 Ga0501043_0147388 Ga0501043_0147388_579_1223 210
272 3300049581 Ga0501047_0496988 Ga0501047_0496988_190_834 210
273 3300049584 Ga0501068_0224317 Ga0501068_0224317_430_1074 210
274 3300049822 Ga0501035_0345766 Ga0501035_0345766_27_671 210
275 3300053129 Ga0500628_018384 Ga0500628_018384_367_1002 210
276 3300005290 Ga0065712_10068802 Ga0065712_100688028 211
277 3300005295 Ga0065707_10114435 Ga0065707_101144353 211
278 3300005328 Ga0070676_10011797 Ga0070676_100117973 211
279 3300005331 Ga0070670_100031969 Ga0070670_1000319692 211
280 3300005334 Ga0068869_100069601 Ga0068869_1000696013 211
281 3300005340 Ga0070689_100041802 Ga0070689_1000418023 211
282 3300005347 Ga0070668_100254009 Ga0070668_1002540092 211
283 3300005353 Ga0070669_100011389 Ga0070669_1000113896 211
284 3300005354 Ga0070675_100003918 Ga0070675_1000039189 211
285 3300005356 Ga0070674_100552712 Ga0070674_1005527122 211
286 3300005364 Ga0070673_100209251 Ga0070673_1002092513 211
287 3300005365 Ga0070688_100004791 Ga0070688_1000047916 211
288 3300005441 Ga0070700_100052719 Ga0070700_1000527192 211
289 3300005444 Ga0070694_100320301 Ga0070694_1003203011 211
290 3300005457 Ga0070662_100006612 Ga0070662_1000066121 211
291 3300005459 Ga0068867_100026586 Ga0068867_1000265864 211
292 3300005548 Ga0070665_100365499 Ga0070665_1003654992 211
293 3300005577 Ga0068857_100004492 Ga0068857_1000044923 211
294 3300005719 Ga0068861_100013519 Ga0068861_1000135194 211
295 3300025933 Ga0207706_10005719 Ga0207706_1000571911 211
296 3300025940 Ga0207691_10103963 Ga0207691_101039633 211
297 3300025961 Ga0207712_10005902 Ga0207712_100059026 211
298 3300025972 Ga0207668_10074353 Ga0207668_100743533 211
299 3300026075 Ga0207708_10034717 Ga0207708_100347173 211
300 3300026116 Ga0207674_10004270 Ga0207674_1000427018 211
301 3300026118 Ga0207675_100000646 Ga0207675_1000006464 211
302 3300028379 Ga0268266_10633903 Ga0268266_106339032 211
303 3300041413 Ga0439465_0004571 Ga0439465_0004571_1320_1961 211
304 3300005347 Ga0070668_100538073 Ga0070668_1005380732 212
305 3300005548 Ga0070665_101080134 Ga0070665_1010801342 212
306 3300025972 Ga0207668_10494340 Ga0207668_104943402 212
307 3300053139 Ga0500568_0000080 Ga0500568_0000080_91022_91666 212
308 3300046522 Ga0495643_0050523 Ga0495643_0050523_68_715 213
309 3300014326 Ga0157380_10732360 Ga0157380_107323601 214
310 3300025960 Ga0207651_10088073 Ga0207651_100880733 219
311 2162886011 MRS1b_contig_3359027 MRS1b_0194.00000480 226
312 3300002155 JGI24033J26618_1019922 JGI24033J26618_10199222 226
313 3300005343 Ga0070687_100316291 Ga0070687_1003162912 226
314 3300005438 Ga0070701_10021670 Ga0070701_100216703 226
315 3300005617 Ga0068859_100029185 Ga0068859_1000291855 226
316 3300006931 Ga0097620_100029185 Ga0097620_1000291855 226
317 3300009094 Ga0111539_10000458 Ga0111539_1000045830 226
318 3300009553 Ga0105249_10003210 Ga0105249_1000321012 226
319 3300013308 Ga0157375_10013435 Ga0157375_100134354 226
320 3300014326 Ga0157380_10002400 Ga0157380_1000240012 226
321 3300014745 Ga0157377_10002011 Ga0157377_100020112 226
322 3300025925 Ga0207650_10127870 Ga0207650_101278702 226
323 3300025936 Ga0207670_10013982 Ga0207670_100139823 226
324 3300025942 Ga0207689_10177844 Ga0207689_101778442 226
325 3300026089 Ga0207648_10045096 Ga0207648_100450962 226
326 3300050511 nmdc:mga08y16_61093_c1 nmdc:mga08y16_61093_c1_561_1241 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11138

DUF2911

Protein of unknown function (DUF2911)

82

224

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fov-assembly1.cif.gz_A abeh (tryptophan-5-halogenase) bound to fad and cl 0.6789 188 225
2vx8-assembly5.cif.gz_D vamp7 longin domain hrb peptide complex 0.6727 198 225
6ioz-assembly1.cif.gz_A structural insights of idursulfase beta 0.6702 149 187
5fql-assembly1.cif.gz_A-2 insights into hunter syndrome from the structure of iduronate-2- sulfatase 0.6582 149 187
8fox-assembly4.cif.gz_D abeh (tryptophan-5-halogenase) 0.6579 188 225
ID Description Score Start End Superfamily
af_K7L4D0_610_722_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7841 188 225 2.30.29.30
af_Q4DPK8_1_127_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7305 198 222 3.30.450.50
af_P53318_26_290_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7172 186 225 3.50.50.60
af_Q4DVH6_123_446_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.68 142 185 3.60.21.10
af_Q4CT13_9_352_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6648 200 225 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A519IW15-F1-model_v4 deleted 0.9614 105 226
AF-A0A7Y2MT83-F1-model_v4 DUF2911 domain-containing protein 0.9599 96 226
AF-A0A359E6J8-F1-model_v4 DUF2911 domain-containing protein 0.9562 136 226
AF-A0A537J7S9-F1-model_v4 DUF2911 domain-containing protein 0.9559 116 226
AF-A0A1D8P8D3-F1-model_v4 DUF2911 domain-containing protein 0.9541 96 225

Feature Viewer

pLDDT pTM Quality
81.4 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map