F408114
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 200 | 325 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300002155|JGI24033J26618_1019922|JGI24033J26618_10199222 |
| Length | 226 |
| Sequence | MLKWLYQFLYKILKHVSRQLSIXALLVIFALGCKQNKKEAPASEKVITPDSIKNQAQEVTVNPYASVDISPMDMSYFPVDYPKIKMAHANISPPVMRVIYSRPHLQRRALFNGILKYDEPWRLGANEASEIDFYKPVSIQGKKISAGRYIIYGIPHVDKWTIILNSNIDSWGLKQDSTKDVGSFEVPVLTNNVSLEYFTMVFEKTESGADLLIAWADVLARLQIKF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 124 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 125 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 126 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 127 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 131 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 132 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 133 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 134 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 135 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 141 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 188 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 189 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 190 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 191 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 192 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 195 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 196 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 198 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 199 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.75 |
| Nodule | 0 |
| Rhizoplane | 0.61 |
| Rhizosphere | 88.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3359027 | 2162886011 | Unclassified | 3028 |
| 2 | JGI24746J21847_1032756 | 3300001977 | Bacteria | 717 |
| 3 | JGI24033J26618_1019922 | 3300002155 | Bacteria | 853 |
| 4 | rootH1_10007419 | 3300003316 | Bacteria | 5985 |
| 5 | rootH2_10136073 | 3300003320 | Bacteria | 1371 |
| 6 | rootL2_10015226 | 3300003322 | Bacteria | 2205 |
| 7 | rootH1_10121894 | 3300003323 | Bacteria | 3833 |
| 8 | Ga0065712_10068802 | 3300005290 | Bacteria | 8971 |
| 9 | Ga0065707_10114435 | 3300005295 | Unclassified | 2283 |
| 10 | Ga0070676_10011797 | 3300005328 | Unclassified | 4756 |
| 11 | Ga0070676_10047122 | 3300005328 | Bacteria | 2516 |
| 12 | Ga0070676_10142478 | 3300005328 | Bacteria | 1527 |
| 13 | Ga0070676_10148966 | 3300005328 | Unclassified | 1496 |
| 14 | Ga0070690_100036376 | 3300005330 | Bacteria | 3094 |
| 15 | Ga0070690_100598793 | 3300005330 | Bacteria | 836 |
| 16 | Ga0070670_100012200 | 3300005331 | Bacteria | 7348 |
| 17 | Ga0070670_100031969 | 3300005331 | Unclassified | 4531 |
| 18 | Ga0070670_100047942 | 3300005331 | Bacteria | 3677 |
| 19 | Ga0070670_100187348 | 3300005331 | Bacteria | 1797 |
| 20 | Ga0070670_100499657 | 3300005331 | Bacteria | 1081 |
| 21 | Ga0070670_100521187 | 3300005331 | Bacteria | 1058 |
| 22 | Ga0070670_100708959 | 3300005331 | Bacteria | 905 |
| 23 | Ga0068869_100010197 | 3300005334 | Bacteria | 6118 |
| 24 | Ga0068869_100035276 | 3300005334 | Bacteria | 3544 |
| 25 | Ga0068869_100069601 | 3300005334 | Unclassified | 2602 |
| 26 | Ga0068869_100091498 | 3300005334 | Bacteria | 2288 |
| 27 | Ga0070666_10007984 | 3300005335 | Bacteria | 6543 |
| 28 | Ga0068868_100008955 | 3300005338 | Bacteria | 7182 |
| 29 | Ga0068868_100022282 | 3300005338 | Bacteria | 4778 |
| 30 | Ga0070689_100041802 | 3300005340 | Unclassified | 3518 |
| 31 | Ga0070687_100316291 | 3300005343 | Bacteria | 996 |
| 32 | Ga0070668_100003950 | 3300005347 | Bacteria | 10961 |
| 33 | Ga0070668_100127243 | 3300005347 | Bacteria | 2041 |
| 34 | Ga0070668_100254009 | 3300005347 | Bacteria | 1460 |
| 35 | Ga0070668_100538073 | 3300005347 | Unclassified | 1015 |
| 36 | Ga0070669_100006032 | 3300005353 | Bacteria | 8743 |
| 37 | Ga0070669_100011389 | 3300005353 | Bacteria | 6314 |
| 38 | Ga0070669_100012225 | 3300005353 | Bacteria | 6093 |
| 39 | Ga0070675_100003918 | 3300005354 | Bacteria | 11275 |
| 40 | Ga0070675_100103510 | 3300005354 | Bacteria | 2401 |
| 41 | Ga0070671_100023840 | 3300005355 | Bacteria | 5008 |
| 42 | Ga0070674_100008285 | 3300005356 | Bacteria | 6183 |
| 43 | Ga0070674_100552712 | 3300005356 | Bacteria | 966 |
| 44 | Ga0070673_100003907 | 3300005364 | Bacteria | 9364 |
| 45 | Ga0070673_100035123 | 3300005364 | Bacteria | 3799 |
| 46 | Ga0070673_100209251 | 3300005364 | Bacteria | 1683 |
| 47 | Ga0070688_100004791 | 3300005365 | Bacteria | 7073 |
| 48 | Ga0070667_100138758 | 3300005367 | Bacteria | 2127 |
| 49 | Ga0070667_100286576 | 3300005367 | Bacteria | 1480 |
| 50 | Ga0070667_100473115 | 3300005367 | Bacteria | 1147 |
| 51 | Ga0070701_10021670 | 3300005438 | Unclassified | 3071 |
| 52 | Ga0070700_100052719 | 3300005441 | Unclassified | 2537 |
| 53 | Ga0070694_100320301 | 3300005444 | Bacteria | 1193 |
| 54 | Ga0070678_100153728 | 3300005456 | Bacteria | 1856 |
| 55 | Ga0070678_100391913 | 3300005456 | Bacteria | 1204 |
| 56 | Ga0070662_100006612 | 3300005457 | Bacteria | 7484 |
| 57 | Ga0070662_100045395 | 3300005457 | Bacteria | 3152 |
| 58 | Ga0070662_100078615 | 3300005457 | Bacteria | 2451 |
| 59 | Ga0068867_100026586 | 3300005459 | Unclassified | 4156 |
| 60 | Ga0068867_100130136 | 3300005459 | Unclassified | 1955 |
| 61 | Ga0068867_100553285 | 3300005459 | Bacteria | 997 |
| 62 | Ga0070698_100109631 | 3300005471 | Bacteria | 2727 |
| 63 | Ga0068853_100038148 | 3300005539 | Bacteria | 4091 |
| 64 | Ga0070672_100171014 | 3300005543 | Unclassified | 1807 |
| 65 | Ga0070686_100199938 | 3300005544 | Unclassified | 1432 |
| 66 | Ga0070665_100046206 | 3300005548 | Bacteria | 4374 |
| 67 | Ga0070665_100365499 | 3300005548 | Unclassified | 1449 |
| 68 | Ga0070665_101080134 | 3300005548 | Unclassified | 814 |
| 69 | Ga0068855_100007850 | 3300005563 | Bacteria | 12895 |
| 70 | Ga0068857_100004492 | 3300005577 | Bacteria | 11788 |
| 71 | Ga0068857_100016759 | 3300005577 | Bacteria | 6419 |
| 72 | Ga0068854_100052321 | 3300005578 | Bacteria | 2928 |
| 73 | Ga0068854_100313764 | 3300005578 | Bacteria | 1272 |
| 74 | Ga0068856_100010240 | 3300005614 | Bacteria | 9115 |
| 75 | Ga0068859_100029185 | 3300005617 | Bacteria | 5535 |
| 76 | Ga0068859_100034405 | 3300005617 | Bacteria | 5085 |
| 77 | Ga0068859_100044134 | 3300005617 | Bacteria | 4480 |
| 78 | Ga0068859_100349524 | 3300005617 | Bacteria | 1573 |
| 79 | Ga0068864_100011380 | 3300005618 | Bacteria | 7353 |
| 80 | Ga0068866_10105318 | 3300005718 | Bacteria | 1563 |
| 81 | Ga0068866_10434353 | 3300005718 | Unclassified | 855 |
| 82 | Ga0068861_100013519 | 3300005719 | Bacteria | 5712 |
| 83 | Ga0068861_100017420 | 3300005719 | Bacteria | 5100 |
| 84 | Ga0068861_100025993 | 3300005719 | Bacteria | 4251 |
| 85 | Ga0068870_10007092 | 3300005840 | Bacteria | 4980 |
| 86 | Ga0068863_100128814 | 3300005841 | Bacteria | 2415 |
| 87 | Ga0068858_100365053 | 3300005842 | Bacteria | 1384 |
| 88 | Ga0068858_100395165 | 3300005842 | Bacteria | 1328 |
| 89 | Ga0068860_100056149 | 3300005843 | Bacteria | 3745 |
| 90 | Ga0068860_100142909 | 3300005843 | Bacteria | 2301 |
| 91 | Ga0068860_100252382 | 3300005843 | Bacteria | 1718 |
| 92 | Ga0068860_100371028 | 3300005843 | Bacteria | 1411 |
| 93 | Ga0068862_100034005 | 3300005844 | Bacteria | 4311 |
| 94 | Ga0081455_10516139 | 3300005937 | Bacteria | 798 |
| 95 | Ga0075366_10017856 | 3300006195 | Bacteria | 4091 |
| 96 | Ga0075366_10020949 | 3300006195 | Bacteria | 3798 |
| 97 | Ga0075366_10215716 | 3300006195 | Bacteria | 1169 |
| 98 | Ga0097621_100018051 | 3300006237 | Bacteria | 5378 |
| 99 | Ga0097621_100112559 | 3300006237 | Bacteria | 2301 |
| 100 | Ga0068871_100039436 | 3300006358 | Bacteria | 3779 |
| 101 | Ga0068871_100542614 | 3300006358 | Bacteria | 1052 |
| 102 | Ga0068865_100133940 | 3300006881 | Bacteria | 1859 |
| 103 | Ga0097620_100029185 | 3300006931 | Bacteria | 5535 |
| 104 | Ga0097620_100034407 | 3300006931 | Bacteria | 5085 |
| 105 | Ga0097620_100044135 | 3300006931 | Bacteria | 4480 |
| 106 | Ga0097620_100349522 | 3300006931 | Bacteria | 1573 |
| 107 | Ga0105240_10636654 | 3300009093 | Unclassified | 1170 |
| 108 | Ga0111539_10000458 | 3300009094 | Bacteria | 51231 |
| 109 | Ga0105247_10002017 | 3300009101 | Bacteria | 14059 |
| 110 | Ga0114129_10010459 | 3300009147 | Bacteria | 13234 |
| 111 | Ga0105241_10045504 | 3300009174 | Bacteria | 3330 |
| 112 | Ga0105241_10063146 | 3300009174 | Bacteria | 2857 |
| 113 | Ga0105241_10416275 | 3300009174 | Bacteria | 1182 |
| 114 | Ga0105242_10002072 | 3300009176 | Bacteria | 15818 |
| 115 | Ga0105242_10014334 | 3300009176 | Bacteria | 6140 |
| 116 | Ga0105242_10029871 | 3300009176 | Bacteria | 4350 |
| 117 | Ga0105242_10480725 | 3300009176 | Bacteria | 1177 |
| 118 | Ga0105237_10050281 | 3300009545 | Bacteria | 4188 |
| 119 | Ga0105249_10001273 | 3300009553 | Bacteria | 22114 |
| 120 | Ga0105249_10002674 | 3300009553 | Bacteria | 15414 |
| 121 | Ga0105249_10003210 | 3300009553 | Bacteria | 14149 |
| 122 | Ga0105249_10019703 | 3300009553 | Bacteria | 6021 |
| 123 | Ga0105239_10000992 | 3300010375 | Bacteria | 39769 |
| 124 | Ga0105239_10070654 | 3300010375 | Bacteria | 3835 |
| 125 | Ga0157374_10035399 | 3300013296 | Bacteria | 4568 |
| 126 | Ga0157374_10184474 | 3300013296 | Bacteria | 2039 |
| 127 | Ga0157374_10186605 | 3300013296 | Bacteria | 2027 |
| 128 | Ga0157374_10362738 | 3300013296 | Bacteria | 1441 |
| 129 | Ga0157378_10116677 | 3300013297 | Bacteria | 2455 |
| 130 | Ga0157378_10219438 | 3300013297 | Bacteria | 1807 |
| 131 | Ga0157378_10647621 | 3300013297 | Bacteria | 1072 |
| 132 | Ga0163162_10089033 | 3300013306 | Bacteria | 3167 |
| 133 | Ga0157372_10040072 | 3300013307 | Bacteria | 5172 |
| 134 | Ga0157375_10013435 | 3300013308 | Bacteria | 7286 |
| 135 | Ga0157375_10679072 | 3300013308 | Bacteria | 1185 |
| 136 | Ga0157375_10790826 | 3300013308 | Bacteria | 1098 |
| 137 | Ga0163163_10060843 | 3300014325 | Bacteria | 3741 |
| 138 | Ga0157380_10002400 | 3300014326 | Bacteria | 12600 |
| 139 | Ga0157380_10732360 | 3300014326 | Unclassified | 998 |
| 140 | Ga0157377_10002011 | 3300014745 | Bacteria | 8909 |
| 141 | Ga0157377_10074769 | 3300014745 | Unclassified | 1966 |
| 142 | Ga0157379_10258345 | 3300014968 | Bacteria | 1582 |
| 143 | Ga0163161_10005686 | 3300017792 | Bacteria | 8646 |
| 144 | Ga0209646_1002730 | 3300025246 | Bacteria | 3759 |
| 145 | Ga0207697_10094322 | 3300025315 | Bacteria | 1270 |
| 146 | Ga0207682_10086774 | 3300025893 | Bacteria | 1350 |
| 147 | Ga0207642_10109610 | 3300025899 | Bacteria | 1403 |
| 148 | Ga0207642_10487022 | 3300025899 | Bacteria | 753 |
| 149 | Ga0207710_10001084 | 3300025900 | Bacteria | 14005 |
| 150 | Ga0207688_10001032 | 3300025901 | Bacteria | 14255 |
| 151 | Ga0207680_10023597 | 3300025903 | Bacteria | 3362 |
| 152 | Ga0207645_10000529 | 3300025907 | Bacteria | 31798 |
| 153 | Ga0207645_10098930 | 3300025907 | Bacteria | 1881 |
| 154 | Ga0207645_10134465 | 3300025907 | Bacteria | 1610 |
| 155 | Ga0207645_10313669 | 3300025907 | Unclassified | 1045 |
| 156 | Ga0207643_10006052 | 3300025908 | Bacteria | 6464 |
| 157 | Ga0207695_10449760 | 3300025913 | Unclassified | 1171 |
| 158 | Ga0207662_10200261 | 3300025918 | Unclassified | 1292 |
| 159 | Ga0207649_10094636 | 3300025920 | Bacteria | 1963 |
| 160 | Ga0207681_10080689 | 3300025923 | Bacteria | 2295 |
| 161 | Ga0207681_10226682 | 3300025923 | Unclassified | 1448 |
| 162 | Ga0207681_10349996 | 3300025923 | Bacteria | 1182 |
| 163 | Ga0207650_10127870 | 3300025925 | Unclassified | 1985 |
| 164 | Ga0207650_10442223 | 3300025925 | Bacteria | 1081 |
| 165 | Ga0207650_10563760 | 3300025925 | Bacteria | 956 |
| 166 | Ga0207644_10218258 | 3300025931 | Unclassified | 1510 |
| 167 | Ga0207706_10005719 | 3300025933 | Bacteria | 11581 |
| 168 | Ga0207706_10029708 | 3300025933 | Bacteria | 4878 |
| 169 | Ga0207706_10040972 | 3300025933 | Bacteria | 4106 |
| 170 | Ga0207686_10106384 | 3300025934 | Bacteria | 1883 |
| 171 | Ga0207670_10013982 | 3300025936 | Unclassified | 4752 |
| 172 | Ga0207669_10321367 | 3300025937 | Bacteria | 1185 |
| 173 | Ga0207691_10011756 | 3300025940 | Bacteria | 8402 |
| 174 | Ga0207691_10103963 | 3300025940 | Unclassified | 2532 |
| 175 | Ga0207689_10001844 | 3300025942 | Bacteria | 20051 |
| 176 | Ga0207689_10003063 | 3300025942 | Bacteria | 15398 |
| 177 | Ga0207689_10023885 | 3300025942 | Bacteria | 5128 |
| 178 | Ga0207689_10034555 | 3300025942 | Bacteria | 4199 |
| 179 | Ga0207689_10047030 | 3300025942 | Bacteria | 3564 |
| 180 | Ga0207689_10177844 | 3300025942 | Unclassified | 1755 |
| 181 | Ga0207667_10000969 | 3300025949 | Bacteria | 36612 |
| 182 | Ga0207651_10019680 | 3300025960 | Bacteria | 4053 |
| 183 | Ga0207651_10088073 | 3300025960 | Bacteria | 2262 |
| 184 | Ga0207712_10002001 | 3300025961 | Bacteria | 13381 |
| 185 | Ga0207712_10002689 | 3300025961 | Bacteria | 11351 |
| 186 | Ga0207712_10005902 | 3300025961 | Bacteria | 7722 |
| 187 | Ga0207712_10022808 | 3300025961 | Bacteria | 4125 |
| 188 | Ga0207668_10066194 | 3300025972 | Bacteria | 2560 |
| 189 | Ga0207668_10074353 | 3300025972 | Unclassified | 2439 |
| 190 | Ga0207668_10494340 | 3300025972 | Unclassified | 1051 |
| 191 | Ga0207640_10258242 | 3300025981 | Bacteria | 1356 |
| 192 | Ga0207658_10133283 | 3300025986 | Bacteria | 1999 |
| 193 | Ga0207658_10167054 | 3300025986 | Unclassified | 1809 |
| 194 | Ga0207658_10309439 | 3300025986 | Bacteria | 1364 |
| 195 | Ga0207677_10070381 | 3300026023 | Bacteria | 2465 |
| 196 | Ga0207677_10597897 | 3300026023 | Bacteria | 968 |
| 197 | Ga0207703_10133069 | 3300026035 | Bacteria | 2150 |
| 198 | Ga0207708_10034717 | 3300026075 | Unclassified | 3836 |
| 199 | Ga0207702_10049274 | 3300026078 | Bacteria | 3554 |
| 200 | Ga0207641_10245381 | 3300026088 | Bacteria | 1671 |
| 201 | Ga0207648_10007341 | 3300026089 | Bacteria | 10853 |
| 202 | Ga0207648_10045096 | 3300026089 | Unclassified | 3868 |
| 203 | Ga0207648_10061278 | 3300026089 | Bacteria | 3281 |
| 204 | Ga0207648_10104696 | 3300026089 | Unclassified | 2482 |
| 205 | Ga0207648_10648521 | 3300026089 | Unclassified | 976 |
| 206 | Ga0207674_10004270 | 3300026116 | Bacteria | 17239 |
| 207 | Ga0207674_10022366 | 3300026116 | Bacteria | 6789 |
| 208 | Ga0207674_10047265 | 3300026116 | Bacteria | 4413 |
| 209 | Ga0207674_10672585 | 3300026116 | Bacteria | 1000 |
| 210 | Ga0207675_100000646 | 3300026118 | Bacteria | 34270 |
| 211 | Ga0207675_100002469 | 3300026118 | Bacteria | 18305 |
| 212 | Ga0207675_100018789 | 3300026118 | Bacteria | 6450 |
| 213 | Ga0207683_10002257 | 3300026121 | Bacteria | 16909 |
| 214 | Ga0207683_10008246 | 3300026121 | Bacteria | 8910 |
| 215 | Ga0207698_10667513 | 3300026142 | Unclassified | 1031 |
| 216 | Ga0268266_10111383 | 3300028379 | Bacteria | 2425 |
| 217 | Ga0268266_10633903 | 3300028379 | Bacteria | 1028 |
| 218 | Ga0268265_10024291 | 3300028380 | Bacteria | 4287 |
| 219 | Ga0268264_10036593 | 3300028381 | Bacteria | 4045 |
| 220 | Ga0268264_10217932 | 3300028381 | Bacteria | 1755 |
| 221 | Ga0268264_10302954 | 3300028381 | Bacteria | 1505 |
| 222 | Ga0307513_10051117 | 3300031456 | Bacteria | 4462 |
| 223 | Ga0307513_10099018 | 3300031456 | Bacteria | 2945 |
| 224 | Ga0307513_10101549 | 3300031456 | Bacteria | 2898 |
| 225 | Ga0307513_10362494 | 3300031456 | Bacteria | 1194 |
| 226 | Ga0307509_10025235 | 3300031507 | Bacteria | 6642 |
| 227 | Ga0373956_0169755 | 3300035119 | Bacteria | 1030 |
| 228 | Ga0373955_0022926 | 3300035172 | Unclassified | 3174 |
| 229 | Ga0373935_0601933 | 3300035692 | Unclassified | 804 |
| 230 | Ga0373933_0014213 | 3300035724 | Bacteria | 4422 |
| 231 | Ga0373937_0071297 | 3300036401 | Unclassified | 3204 |
| 232 | Ga0439436_0014836 | 3300041404 | Bacteria | 2347 |
| 233 | Ga0439439_0000467 | 3300041406 | Bacteria | 6911 |
| 234 | Ga0439439_0023858 | 3300041406 | Bacteria | 1534 |
| 235 | Ga0439465_0004571 | 3300041413 | Bacteria | 4471 |
| 236 | Ga0451797_1102267 | 3300041453 | Bacteria | 1034 |
| 237 | Ga0451800_1287260 | 3300041459 | Bacteria | 1530 |
| 238 | Ga0451851_0380242 | 3300041507 | Bacteria | 1266 |
| 239 | Ga0439449_0021213 | 3300042007 | Bacteria | 2432 |
| 240 | Ga0439449_0047123 | 3300042007 | Bacteria | 1596 |
| 241 | Ga0439449_0057922 | 3300042007 | Bacteria | 1430 |
| 242 | Ga0439454_013410 | 3300042011 | Viruses | 1125 |
| 243 | Ga0439455_0051799 | 3300042012 | Bacteria | 1074 |
| 244 | Ga0439457_045199 | 3300042014 | Viruses | 984 |
| 245 | Ga0450894_026582 | 3300042131 | Viruses | 795 |
| 246 | Ga0450898_001928 | 3300042134 | Bacteria | 2825 |
| 247 | Ga0439434_0008924 | 3300042435 | Bacteria | 2946 |
| 248 | Ga0466969_0000110 | 3300044656 | Bacteria | 43267 |
| 249 | Ga0466972_0000049 | 3300044658 | Bacteria | 118829 |
| 250 | Ga0466965_0448820 | 3300044683 | Bacteria | 718 |
| 251 | Ga0466966_0000015 | 3300044684 | Bacteria | 127402 |
| 252 | Ga0466968_0008793 | 3300044735 | Bacteria | 3874 |
| 253 | Ga0466957_0011189 | 3300044842 | Bacteria | 5169 |
| 254 | Ga0466959_0000030 | 3300045049 | Bacteria | 111343 |
| 255 | Ga0495638_0246110 | 3300046460 | Bacteria | 988 |
| 256 | Ga0495650_0026388 | 3300046471 | Bacteria | 2704 |
| 257 | Ga0495580_0268113 | 3300046472 | Bacteria | 1167 |
| 258 | Ga0495608_0047157 | 3300046511 | Unclassified | 2865 |
| 259 | Ga0495628_0056871 | 3300046516 | Unclassified | 3078 |
| 260 | Ga0495630_0039766 | 3300046517 | Bacteria | 3516 |
| 261 | Ga0495632_0111536 | 3300046519 | Bacteria | 1284 |
| 262 | Ga0495643_0050523 | 3300046522 | Bacteria | 2239 |
| 263 | Ga0495640_0152501 | 3300046533 | Unclassified | 1484 |
| 264 | Ga0495586_0279665 | 3300046535 | Unclassified | 955 |
| 265 | Ga0495587_0376577 | 3300046536 | Unclassified | 790 |
| 266 | Ga0495634_0053659 | 3300046642 | Unclassified | 2700 |
| 267 | Ga0495635_0145624 | 3300046663 | Bacteria | 1613 |
| 268 | Ga0495646_0175474 | 3300046680 | Bacteria | 1179 |
| 269 | Ga0495613_0127047 | 3300046689 | Bacteria | 1828 |
| 270 | Ga0495674_0175350 | 3300047319 | Unclassified | 1787 |
| 271 | Ga0495672_0014460 | 3300047320 | Bacteria | 5404 |
| 272 | Ga0495680_0179563 | 3300047322 | Unclassified | 1529 |
| 273 | Ga0495684_0065495 | 3300047471 | Unclassified | 2762 |
| 274 | Ga0501031_0053095 | 3300049568 | Bacteria | 2640 |
| 275 | Ga0501032_0056039 | 3300049569 | Bacteria | 2650 |
| 276 | Ga0501032_0108900 | 3300049569 | Bacteria | 1834 |
| 277 | Ga0501034_0001968 | 3300049571 | Bacteria | 26034 |
| 278 | Ga0501036_0025419 | 3300049572 | Bacteria | 4994 |
| 279 | Ga0501036_0337091 | 3300049572 | Bacteria | 1259 |
| 280 | Ga0501037_0020842 | 3300049573 | Bacteria | 4840 |
| 281 | Ga0501037_0167186 | 3300049573 | Bacteria | 1565 |
| 282 | Ga0501038_0043476 | 3300049574 | Bacteria | 3906 |
| 283 | Ga0501039_0200127 | 3300049575 | Unclassified | 1570 |
| 284 | Ga0501042_0079325 | 3300049578 | Bacteria | 2352 |
| 285 | Ga0501043_0147388 | 3300049579 | Unclassified | 1842 |
| 286 | Ga0501043_0457890 | 3300049579 | Bacteria | 957 |
| 287 | Ga0501046_0043716 | 3300049580 | Bacteria | 3565 |
| 288 | Ga0501047_0002429 | 3300049581 | Bacteria | 17803 |
| 289 | Ga0501047_0496988 | 3300049581 | Bacteria | 1046 |
| 290 | Ga0501048_0006145 | 3300049582 | Bacteria | 9144 |
| 291 | Ga0501068_0224317 | 3300049584 | Bacteria | 1195 |
| 292 | Ga0501072_0219919 | 3300049588 | Bacteria | 1514 |
| 293 | Ga0501072_0434806 | 3300049588 | Bacteria | 1040 |
| 294 | Ga0501073_0075784 | 3300049589 | Bacteria | 2341 |
| 295 | Ga0501074_0001160 | 3300049590 | Bacteria | 17257 |
| 296 | Ga0501225_0001109 | 3300049705 | Bacteria | 8448 |
| 297 | Ga0501079_0420582 | 3300049741 | Bacteria | 1049 |
| 298 | Ga0501083_0001132 | 3300049744 | Bacteria | 17866 |
| 299 | Ga0501035_0061176 | 3300049822 | Bacteria | 3352 |
| 300 | Ga0501035_0345766 | 3300049822 | Bacteria | 1245 |
| 301 | Ga0501044_0005315 | 3300049823 | Bacteria | 14325 |
| 302 | nmdc:mga0k408_101973_c1 | 3300050493 | Bacteria | 1692 |
| 303 | nmdc:mga0k408_15721_c1 | 3300050493 | Bacteria | 4189 |
| 304 | nmdc:mga0k408_44507_c1 | 3300050493 | Bacteria | 2560 |
| 305 | nmdc:mga05p37_1790_c2 | 3300050507 | Bacteria | 13235 |
| 306 | nmdc:mga08y16_61093_c1 | 3300050511 | Unclassified | 3935 |
| 307 | Ga0495619_0259329 | 3300053085 | Bacteria | 1205 |
| 308 | Ga0500578_0000063 | 3300053086 | Bacteria | 117869 |
| 309 | Ga0500578_0087486 | 3300053086 | Bacteria | 1979 |
| 310 | Ga0500583_0000153 | 3300053092 | Bacteria | 28587 |
| 311 | Ga0500556_0200481 | 3300053104 | Bacteria | 789 |
| 312 | Ga0500572_036433 | 3300053111 | Bacteria | 1405 |
| 313 | Ga0500628_018384 | 3300053129 | Bacteria | 1378 |
| 314 | Ga0500652_005512 | 3300053131 | Bacteria | 3993 |
| 315 | Ga0500568_0000080 | 3300053139 | Bacteria | 92694 |
| 316 | Ga0500589_009686 | 3300053147 | Bacteria | 4085 |
| 317 | Ga0500589_058562 | 3300053147 | Unclassified | 1771 |
| 318 | Ga0500622_0039413 | 3300053156 | Bacteria | 2463 |
| 319 | Ga0500622_0101555 | 3300053156 | Bacteria | 1415 |
| 320 | Ga0500636_0183753 | 3300053177 | Bacteria | 1120 |
| 321 | Ga0500637_0190258 | 3300053178 | Bacteria | 1173 |
| 322 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 323 | Ga0500611_098680 | 3300053727 | Bacteria | 753 |
| 324 | Ga0501084_0282005 | 3300054114 | Bacteria | 1403 |
| 325 | Ga0590075_108393 | 3300059424 | Unclassified | 724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10362738 | Ga0157374_103627381 | 177 |
| 2 | 3300005328 | Ga0070676_10148966 | Ga0070676_101489662 | 183 |
| 3 | 3300005330 | Ga0070690_100036376 | Ga0070690_1000363762 | 183 |
| 4 | 3300005331 | Ga0070670_100047942 | Ga0070670_1000479422 | 183 |
| 5 | 3300005334 | Ga0068869_100091498 | Ga0068869_1000914982 | 183 |
| 6 | 3300005338 | Ga0068868_100022282 | Ga0068868_1000222823 | 183 |
| 7 | 3300005355 | Ga0070671_100023840 | Ga0070671_1000238402 | 183 |
| 8 | 3300005364 | Ga0070673_100035123 | Ga0070673_1000351231 | 183 |
| 9 | 3300005456 | Ga0070678_100391913 | Ga0070678_1003919132 | 183 |
| 10 | 3300005457 | Ga0070662_100045395 | Ga0070662_1000453953 | 183 |
| 11 | 3300005544 | Ga0070686_100199938 | Ga0070686_1001999382 | 183 |
| 12 | 3300005578 | Ga0068854_100052321 | Ga0068854_1000523213 | 183 |
| 13 | 3300006237 | Ga0097621_100112559 | Ga0097621_1001125592 | 183 |
| 14 | 3300009093 | Ga0105240_10636654 | Ga0105240_106366542 | 183 |
| 15 | 3300009176 | Ga0105242_10480725 | Ga0105242_104807251 | 183 |
| 16 | 3300010375 | Ga0105239_10070654 | Ga0105239_100706543 | 183 |
| 17 | 3300013296 | Ga0157374_10184474 | Ga0157374_101844742 | 183 |
| 18 | 3300013297 | Ga0157378_10116677 | Ga0157378_101166774 | 183 |
| 19 | 3300013306 | Ga0163162_10089033 | Ga0163162_100890332 | 183 |
| 20 | 3300013307 | Ga0157372_10040072 | Ga0157372_100400723 | 183 |
| 21 | 3300014325 | Ga0163163_10060843 | Ga0163163_100608433 | 183 |
| 22 | 3300014745 | Ga0157377_10074769 | Ga0157377_100747692 | 183 |
| 23 | 3300017792 | Ga0163161_10005686 | Ga0163161_100056866 | 183 |
| 24 | 3300025907 | Ga0207645_10098930 | Ga0207645_100989302 | 183 |
| 25 | 3300025913 | Ga0207695_10449760 | Ga0207695_104497602 | 183 |
| 26 | 3300025920 | Ga0207649_10094636 | Ga0207649_100946362 | 183 |
| 27 | 3300025931 | Ga0207644_10218258 | Ga0207644_102182582 | 183 |
| 28 | 3300025933 | Ga0207706_10040972 | Ga0207706_100409722 | 183 |
| 29 | 3300025934 | Ga0207686_10106384 | Ga0207686_101063842 | 183 |
| 30 | 3300025942 | Ga0207689_10034555 | Ga0207689_100345552 | 183 |
| 31 | 3300025960 | Ga0207651_10019680 | Ga0207651_100196803 | 183 |
| 32 | 3300026023 | Ga0207677_10070381 | Ga0207677_100703812 | 183 |
| 33 | 3300026089 | Ga0207648_10648521 | Ga0207648_106485211 | 183 |
| 34 | 3300026121 | Ga0207683_10002257 | Ga0207683_100022576 | 183 |
| 35 | 3300053727 | Ga0500611_098680 | Ga0500611_098680_98_694 | 183 |
| 36 | 3300005367 | Ga0070667_100286576 | Ga0070667_1002865761 | 184 |
| 37 | 3300025986 | Ga0207658_10167054 | Ga0207658_101670542 | 184 |
| 38 | 3300003323 | rootH1_10121894 | rootH1_101218942 | 186 |
| 39 | 3300005331 | Ga0070670_100708959 | Ga0070670_1007089591 | 186 |
| 40 | 3300053727 | Ga0500611_000003 | Ga0500611_000003_327221_327862 | 188 |
| 41 | 3300003316 | rootH1_10007419 | rootH1_100074193 | 190 |
| 42 | 3300041404 | Ga0439436_0014836 | Ga0439436_0014836_94_684 | 190 |
| 43 | 3300042007 | Ga0439449_0021213 | Ga0439449_0021213_1430_2020 | 190 |
| 44 | 3300049578 | Ga0501042_0079325 | Ga0501042_0079325_24_614 | 190 |
| 45 | 3300050493 | nmdc:mga0k408_101973_c1 | nmdc:mga0k408_101973_c1_275_862 | 190 |
| 46 | 3300050493 | nmdc:mga0k408_44507_c1 | nmdc:mga0k408_44507_c1_1566_2156 | 190 |
| 47 | 3300041507 | Ga0451851_0380242 | Ga0451851_0380242_332_925 | 191 |
| 48 | 3300053156 | Ga0500622_0039413 | Ga0500622_0039413_119_712 | 191 |
| 49 | 3300031456 | Ga0307513_10362494 | Ga0307513_103624942 | 192 |
| 50 | 3300041459 | Ga0451800_1287260 | Ga0451800_1287260_142_735 | 192 |
| 51 | 3300044683 | Ga0466965_0448820 | Ga0466965_0448820_66_695 | 192 |
| 52 | 3300046460 | Ga0495638_0246110 | Ga0495638_0246110_113_706 | 192 |
| 53 | 3300046519 | Ga0495632_0111536 | Ga0495632_0111536_207_803 | 192 |
| 54 | 3300047320 | Ga0495672_0014460 | Ga0495672_0014460_4260_4907 | 192 |
| 55 | 3300053092 | Ga0500583_0000153 | Ga0500583_0000153_19491_20087 | 192 |
| 56 | 3300053104 | Ga0500556_0200481 | Ga0500556_0200481_118_714 | 192 |
| 57 | 3300053131 | Ga0500652_005512 | Ga0500652_005512_3009_3605 | 192 |
| 58 | 3300053147 | Ga0500589_009686 | Ga0500589_009686_621_1214 | 192 |
| 59 | 3300053156 | Ga0500622_0101555 | Ga0500622_0101555_704_1297 | 192 |
| 60 | 3300005718 | Ga0068866_10434353 | Ga0068866_104343531 | 195 |
| 61 | 3300025899 | Ga0207642_10487022 | Ga0207642_104870222 | 195 |
| 62 | 3300025918 | Ga0207662_10200261 | Ga0207662_102002612 | 196 |
| 63 | 3300046471 | Ga0495650_0026388 | Ga0495650_0026388_2014_2646 | 197 |
| 64 | 3300026088 | Ga0207641_10245381 | Ga0207641_102453812 | 199 |
| 65 | 3300005459 | Ga0068867_100553285 | Ga0068867_1005532852 | 200 |
| 66 | 3300005844 | Ga0068862_100034005 | Ga0068862_1000340054 | 200 |
| 67 | 3300009553 | Ga0105249_10019703 | Ga0105249_100197034 | 200 |
| 68 | 3300025961 | Ga0207712_10022808 | Ga0207712_100228081 | 200 |
| 69 | 3300025972 | Ga0207668_10066194 | Ga0207668_100661942 | 200 |
| 70 | 3300025986 | Ga0207658_10133283 | Ga0207658_101332832 | 200 |
| 71 | 3300028380 | Ga0268265_10024291 | Ga0268265_100242914 | 200 |
| 72 | iso_pu_bacteria | 2738541278 | 2738725578 | 201 |
| 73 | 3300049588 | Ga0501072_0434806 | Ga0501072_0434806_409_1029 | 202 |
| 74 | 3300006195 | Ga0075366_10215716 | Ga0075366_102157162 | 203 |
| 75 | 3300049569 | Ga0501032_0056039 | Ga0501032_0056039_484_1122 | 203 |
| 76 | 3300049571 | Ga0501034_0001968 | Ga0501034_0001968_19609_20247 | 203 |
| 77 | 3300049572 | Ga0501036_0025419 | Ga0501036_0025419_2584_3222 | 203 |
| 78 | 3300049573 | Ga0501037_0020842 | Ga0501037_0020842_2431_3069 | 203 |
| 79 | 3300049579 | Ga0501043_0457890 | Ga0501043_0457890_146_784 | 203 |
| 80 | 3300049580 | Ga0501046_0043716 | Ga0501046_0043716_1529_2167 | 203 |
| 81 | 3300049581 | Ga0501047_0002429 | Ga0501047_0002429_11226_11864 | 203 |
| 82 | 3300049582 | Ga0501048_0006145 | Ga0501048_0006145_2292_2930 | 203 |
| 83 | 3300049588 | Ga0501072_0219919 | Ga0501072_0219919_349_987 | 203 |
| 84 | 3300049589 | Ga0501073_0075784 | Ga0501073_0075784_1530_2168 | 203 |
| 85 | 3300049590 | Ga0501074_0001160 | Ga0501074_0001160_3567_4205 | 203 |
| 86 | 3300049741 | Ga0501079_0420582 | Ga0501079_0420582_39_677 | 203 |
| 87 | 3300049744 | Ga0501083_0001132 | Ga0501083_0001132_6467_7105 | 203 |
| 88 | 3300049822 | Ga0501035_0061176 | Ga0501035_0061176_423_1061 | 203 |
| 89 | 3300049823 | Ga0501044_0005315 | Ga0501044_0005315_1362_2000 | 203 |
| 90 | 3300054114 | Ga0501084_0282005 | Ga0501084_0282005_189_827 | 203 |
| 91 | 3300001977 | JGI24746J21847_1032756 | JGI24746J21847_10327561 | 204 |
| 92 | 3300005543 | Ga0070672_100171014 | Ga0070672_1001710142 | 204 |
| 93 | 3300005578 | Ga0068854_100313764 | Ga0068854_1003137641 | 204 |
| 94 | 3300005937 | Ga0081455_10516139 | Ga0081455_105161392 | 204 |
| 95 | 3300006195 | Ga0075366_10020949 | Ga0075366_100209492 | 204 |
| 96 | 3300025923 | Ga0207681_10226682 | Ga0207681_102266822 | 204 |
| 97 | 3300025937 | Ga0207669_10321367 | Ga0207669_103213672 | 204 |
| 98 | 3300025981 | Ga0207640_10258242 | Ga0207640_102582422 | 204 |
| 99 | 3300026023 | Ga0207677_10597897 | Ga0207677_105978972 | 204 |
| 100 | 3300041406 | Ga0439439_0000467 | Ga0439439_0000467_3224_3862 | 204 |
| 101 | 3300059424 | Ga0590075_108393 | Ga0590075_108393_43_681 | 204 |
| 102 | 3300003320 | rootH2_10136073 | rootH2_101360732 | 205 |
| 103 | 3300003322 | rootL2_10015226 | rootL2_100152262 | 205 |
| 104 | 3300005459 | Ga0068867_100130136 | Ga0068867_1001301363 | 205 |
| 105 | 3300005471 | Ga0070698_100109631 | Ga0070698_1001096313 | 205 |
| 106 | 3300005563 | Ga0068855_100007850 | Ga0068855_10000785013 | 205 |
| 107 | 3300005577 | Ga0068857_100016759 | Ga0068857_1000167591 | 205 |
| 108 | 3300005614 | Ga0068856_100010240 | Ga0068856_1000102407 | 205 |
| 109 | 3300005843 | Ga0068860_100371028 | Ga0068860_1003710282 | 205 |
| 110 | 3300006195 | Ga0075366_10017856 | Ga0075366_100178562 | 205 |
| 111 | 3300009147 | Ga0114129_10010459 | Ga0114129_100104599 | 205 |
| 112 | 3300009174 | Ga0105241_10045504 | Ga0105241_100455044 | 205 |
| 113 | 3300009545 | Ga0105237_10050281 | Ga0105237_100502812 | 205 |
| 114 | 3300010375 | Ga0105239_10000992 | Ga0105239_1000099224 | 205 |
| 115 | 3300013296 | Ga0157374_10035399 | Ga0157374_100353995 | 205 |
| 116 | 3300025246 | Ga0209646_1002730 | Ga0209646_10027305 | 205 |
| 117 | 3300025949 | Ga0207667_10000969 | Ga0207667_1000096912 | 205 |
| 118 | 3300026078 | Ga0207702_10049274 | Ga0207702_100492742 | 205 |
| 119 | 3300026089 | Ga0207648_10061278 | Ga0207648_100612782 | 205 |
| 120 | 3300026116 | Ga0207674_10022366 | Ga0207674_100223662 | 205 |
| 121 | 3300028381 | Ga0268264_10302954 | Ga0268264_103029542 | 205 |
| 122 | 3300031456 | Ga0307513_10051117 | Ga0307513_100511172 | 205 |
| 123 | 3300031456 | Ga0307513_10099018 | Ga0307513_100990183 | 205 |
| 124 | 3300031456 | Ga0307513_10101549 | Ga0307513_101015492 | 205 |
| 125 | 3300031507 | Ga0307509_10025235 | Ga0307509_100252353 | 205 |
| 126 | 3300041453 | Ga0451797_1102267 | Ga0451797_1102267_130_771 | 205 |
| 127 | 3300042007 | Ga0439449_0047123 | Ga0439449_0047123_288_926 | 205 |
| 128 | 3300042012 | Ga0439455_0051799 | Ga0439455_0051799_380_1021 | 205 |
| 129 | 3300044656 | Ga0466969_0000110 | Ga0466969_0000110_28523_29155 | 205 |
| 130 | 3300044658 | Ga0466972_0000049 | Ga0466972_0000049_19386_20030 | 205 |
| 131 | 3300044684 | Ga0466966_0000015 | Ga0466966_0000015_59428_60060 | 205 |
| 132 | 3300044842 | Ga0466957_0011189 | Ga0466957_0011189_4096_4737 | 205 |
| 133 | 3300045049 | Ga0466959_0000030 | Ga0466959_0000030_78639_79271 | 205 |
| 134 | 3300046680 | Ga0495646_0175474 | Ga0495646_0175474_156_776 | 205 |
| 135 | 3300049705 | Ga0501225_0001109 | Ga0501225_0001109_5226_5864 | 205 |
| 136 | 3300050493 | nmdc:mga0k408_15721_c1 | nmdc:mga0k408_15721_c1_1381_2016 | 205 |
| 137 | 3300050507 | nmdc:mga05p37_1790_c2 | nmdc:mga05p37_1790_c2_7737_8372 | 205 |
| 138 | 3300053086 | Ga0500578_0000063 | Ga0500578_0000063_40148_40789 | 205 |
| 139 | 3300053111 | Ga0500572_036433 | Ga0500572_036433_349_990 | 205 |
| 140 | 3300053147 | Ga0500589_058562 | Ga0500589_058562_547_1185 | 205 |
| 141 | 3300053177 | Ga0500636_0183753 | Ga0500636_0183753_76_717 | 205 |
| 142 | 3300005328 | Ga0070676_10142478 | Ga0070676_101424782 | 206 |
| 143 | 3300005331 | Ga0070670_100187348 | Ga0070670_1001873483 | 206 |
| 144 | 3300005347 | Ga0070668_100127243 | Ga0070668_1001272432 | 206 |
| 145 | 3300005367 | Ga0070667_100138758 | Ga0070667_1001387582 | 206 |
| 146 | 3300009174 | Ga0105241_10416275 | Ga0105241_104162752 | 206 |
| 147 | 3300009176 | Ga0105242_10014334 | Ga0105242_100143346 | 206 |
| 148 | 3300013296 | Ga0157374_10186605 | Ga0157374_101866053 | 206 |
| 149 | 3300013308 | Ga0157375_10679072 | Ga0157375_106790722 | 206 |
| 150 | 3300025899 | Ga0207642_10109610 | Ga0207642_101096102 | 206 |
| 151 | 3300025986 | Ga0207658_10309439 | Ga0207658_103094392 | 206 |
| 152 | 3300035119 | Ga0373956_0169755 | Ga0373956_0169755_116_739 | 206 |
| 153 | 3300035172 | Ga0373955_0022926 | Ga0373955_0022926_2381_3004 | 206 |
| 154 | 3300035692 | Ga0373935_0601933 | Ga0373935_0601933_146_769 | 206 |
| 155 | 3300035724 | Ga0373933_0014213 | Ga0373933_0014213_2336_2959 | 206 |
| 156 | 3300036401 | Ga0373937_0071297 | Ga0373937_0071297_126_749 | 206 |
| 157 | 3300044735 | Ga0466968_0008793 | Ga0466968_0008793_3063_3704 | 206 |
| 158 | 3300046472 | Ga0495580_0268113 | Ga0495580_0268113_56_691 | 206 |
| 159 | 3300046511 | Ga0495608_0047157 | Ga0495608_0047157_2143_2766 | 206 |
| 160 | 3300046516 | Ga0495628_0056871 | Ga0495628_0056871_37_660 | 206 |
| 161 | 3300046517 | Ga0495630_0039766 | Ga0495630_0039766_779_1402 | 206 |
| 162 | 3300046533 | Ga0495640_0152501 | Ga0495640_0152501_779_1402 | 206 |
| 163 | 3300046535 | Ga0495586_0279665 | Ga0495586_0279665_312_935 | 206 |
| 164 | 3300046536 | Ga0495587_0376577 | Ga0495587_0376577_38_661 | 206 |
| 165 | 3300046642 | Ga0495634_0053659 | Ga0495634_0053659_1774_2397 | 206 |
| 166 | 3300046663 | Ga0495635_0145624 | Ga0495635_0145624_436_1059 | 206 |
| 167 | 3300046689 | Ga0495613_0127047 | Ga0495613_0127047_247_870 | 206 |
| 168 | 3300047319 | Ga0495674_0175350 | Ga0495674_0175350_1150_1773 | 206 |
| 169 | 3300047322 | Ga0495680_0179563 | Ga0495680_0179563_773_1396 | 206 |
| 170 | 3300047471 | Ga0495684_0065495 | Ga0495684_0065495_1871_2494 | 206 |
| 171 | 3300053085 | Ga0495619_0259329 | Ga0495619_0259329_304_927 | 206 |
| 172 | 3300053086 | Ga0500578_0087486 | Ga0500578_0087486_923_1567 | 206 |
| 173 | 3300053178 | Ga0500637_0190258 | Ga0500637_0190258_144_788 | 206 |
| 174 | 3300025907 | Ga0207645_10313669 | Ga0207645_103136692 | 208 |
| 175 | 3300005330 | Ga0070690_100598793 | Ga0070690_1005987931 | 209 |
| 176 | 3300005331 | Ga0070670_100012200 | Ga0070670_10001220010 | 209 |
| 177 | 3300005335 | Ga0070666_10007984 | Ga0070666_100079846 | 209 |
| 178 | 3300005338 | Ga0068868_100008955 | Ga0068868_1000089553 | 209 |
| 179 | 3300005347 | Ga0070668_100003950 | Ga0070668_10000395012 | 209 |
| 180 | 3300005353 | Ga0070669_100006032 | Ga0070669_1000060322 | 209 |
| 181 | 3300005354 | Ga0070675_100103510 | Ga0070675_1001035101 | 209 |
| 182 | 3300005356 | Ga0070674_100008285 | Ga0070674_1000082853 | 209 |
| 183 | 3300005364 | Ga0070673_100003907 | Ga0070673_1000039079 | 209 |
| 184 | 3300005456 | Ga0070678_100153728 | Ga0070678_1001537282 | 209 |
| 185 | 3300005457 | Ga0070662_100078615 | Ga0070662_1000786152 | 209 |
| 186 | 3300005539 | Ga0068853_100038148 | Ga0068853_1000381484 | 209 |
| 187 | 3300005548 | Ga0070665_100046206 | Ga0070665_1000462062 | 209 |
| 188 | 3300005617 | Ga0068859_100044134 | Ga0068859_1000441342 | 209 |
| 189 | 3300005718 | Ga0068866_10105318 | Ga0068866_101053182 | 209 |
| 190 | 3300005719 | Ga0068861_100017420 | Ga0068861_1000174202 | 209 |
| 191 | 3300005719 | Ga0068861_100025993 | Ga0068861_1000259932 | 209 |
| 192 | 3300005840 | Ga0068870_10007092 | Ga0068870_100070925 | 209 |
| 193 | 3300005841 | Ga0068863_100128814 | Ga0068863_1001288144 | 209 |
| 194 | 3300005843 | Ga0068860_100252382 | Ga0068860_1002523823 | 209 |
| 195 | 3300006237 | Ga0097621_100018051 | Ga0097621_1000180512 | 209 |
| 196 | 3300006358 | Ga0068871_100039436 | Ga0068871_1000394363 | 209 |
| 197 | 3300006881 | Ga0068865_100133940 | Ga0068865_1001339402 | 209 |
| 198 | 3300006931 | Ga0097620_100044135 | Ga0097620_1000441352 | 209 |
| 199 | 3300009176 | Ga0105242_10029871 | Ga0105242_100298712 | 209 |
| 200 | 3300009553 | Ga0105249_10002674 | Ga0105249_1000267412 | 209 |
| 201 | 3300013308 | Ga0157375_10790826 | Ga0157375_107908262 | 209 |
| 202 | 3300025315 | Ga0207697_10094322 | Ga0207697_100943222 | 209 |
| 203 | 3300025893 | Ga0207682_10086774 | Ga0207682_100867742 | 209 |
| 204 | 3300025901 | Ga0207688_10001032 | Ga0207688_1000103211 | 209 |
| 205 | 3300025903 | Ga0207680_10023597 | Ga0207680_100235972 | 209 |
| 206 | 3300025907 | Ga0207645_10000529 | Ga0207645_1000052917 | 209 |
| 207 | 3300025908 | Ga0207643_10006052 | Ga0207643_100060522 | 209 |
| 208 | 3300025923 | Ga0207681_10080689 | Ga0207681_100806892 | 209 |
| 209 | 3300025925 | Ga0207650_10563760 | Ga0207650_105637602 | 209 |
| 210 | 3300025933 | Ga0207706_10029708 | Ga0207706_100297084 | 209 |
| 211 | 3300025940 | Ga0207691_10011756 | Ga0207691_100117562 | 209 |
| 212 | 3300025942 | Ga0207689_10001844 | Ga0207689_100018447 | 209 |
| 213 | 3300025942 | Ga0207689_10003063 | Ga0207689_100030639 | 209 |
| 214 | 3300025961 | Ga0207712_10002689 | Ga0207712_1000268912 | 209 |
| 215 | 3300026089 | Ga0207648_10007341 | Ga0207648_100073418 | 209 |
| 216 | 3300026116 | Ga0207674_10047265 | Ga0207674_100472655 | 209 |
| 217 | 3300026118 | Ga0207675_100002469 | Ga0207675_1000024699 | 209 |
| 218 | 3300026118 | Ga0207675_100018789 | Ga0207675_1000187897 | 209 |
| 219 | 3300026121 | Ga0207683_10008246 | Ga0207683_100082467 | 209 |
| 220 | 3300026142 | Ga0207698_10667513 | Ga0207698_106675131 | 209 |
| 221 | 3300028379 | Ga0268266_10111383 | Ga0268266_101113833 | 209 |
| 222 | 3300041406 | Ga0439439_0023858 | Ga0439439_0023858_787_1437 | 209 |
| 223 | 3300042007 | Ga0439449_0057922 | Ga0439449_0057922_17_661 | 209 |
| 224 | 3300042011 | Ga0439454_013410 | Ga0439454_013410_22_666 | 209 |
| 225 | 3300042014 | Ga0439457_045199 | Ga0439457_045199_135_779 | 209 |
| 226 | 3300042131 | Ga0450894_026582 | Ga0450894_026582_37_687 | 209 |
| 227 | 3300042134 | Ga0450898_001928 | Ga0450898_001928_1787_2431 | 209 |
| 228 | 3300042435 | Ga0439434_0008924 | Ga0439434_0008924_1559_2203 | 209 |
| 229 | 3300005328 | Ga0070676_10047122 | Ga0070676_100471222 | 210 |
| 230 | 3300005331 | Ga0070670_100499657 | Ga0070670_1004996572 | 210 |
| 231 | 3300005331 | Ga0070670_100521187 | Ga0070670_1005211872 | 210 |
| 232 | 3300005334 | Ga0068869_100010197 | Ga0068869_1000101976 | 210 |
| 233 | 3300005334 | Ga0068869_100035276 | Ga0068869_1000352762 | 210 |
| 234 | 3300005353 | Ga0070669_100012225 | Ga0070669_1000122252 | 210 |
| 235 | 3300005367 | Ga0070667_100473115 | Ga0070667_1004731151 | 210 |
| 236 | 3300005617 | Ga0068859_100034405 | Ga0068859_1000344054 | 210 |
| 237 | 3300005617 | Ga0068859_100349524 | Ga0068859_1003495242 | 210 |
| 238 | 3300005618 | Ga0068864_100011380 | Ga0068864_1000113802 | 210 |
| 239 | 3300005842 | Ga0068858_100365053 | Ga0068858_1003650532 | 210 |
| 240 | 3300005842 | Ga0068858_100395165 | Ga0068858_1003951652 | 210 |
| 241 | 3300005843 | Ga0068860_100056149 | Ga0068860_1000561492 | 210 |
| 242 | 3300005843 | Ga0068860_100142909 | Ga0068860_1001429092 | 210 |
| 243 | 3300006358 | Ga0068871_100542614 | Ga0068871_1005426142 | 210 |
| 244 | 3300006931 | Ga0097620_100034407 | Ga0097620_1000344074 | 210 |
| 245 | 3300006931 | Ga0097620_100349522 | Ga0097620_1003495222 | 210 |
| 246 | 3300009101 | Ga0105247_10002017 | Ga0105247_100020175 | 210 |
| 247 | 3300009174 | Ga0105241_10063146 | Ga0105241_100631463 | 210 |
| 248 | 3300009176 | Ga0105242_10002072 | Ga0105242_1000207213 | 210 |
| 249 | 3300009553 | Ga0105249_10001273 | Ga0105249_100012735 | 210 |
| 250 | 3300013297 | Ga0157378_10219438 | Ga0157378_102194382 | 210 |
| 251 | 3300013297 | Ga0157378_10647621 | Ga0157378_106476212 | 210 |
| 252 | 3300014968 | Ga0157379_10258345 | Ga0157379_102583452 | 210 |
| 253 | 3300025900 | Ga0207710_10001084 | Ga0207710_1000108412 | 210 |
| 254 | 3300025907 | Ga0207645_10134465 | Ga0207645_101344652 | 210 |
| 255 | 3300025923 | Ga0207681_10349996 | Ga0207681_103499962 | 210 |
| 256 | 3300025925 | Ga0207650_10442223 | Ga0207650_104422232 | 210 |
| 257 | 3300025942 | Ga0207689_10023885 | Ga0207689_100238852 | 210 |
| 258 | 3300025942 | Ga0207689_10047030 | Ga0207689_100470302 | 210 |
| 259 | 3300025961 | Ga0207712_10002001 | Ga0207712_100020017 | 210 |
| 260 | 3300026035 | Ga0207703_10133069 | Ga0207703_101330692 | 210 |
| 261 | 3300026089 | Ga0207648_10104696 | Ga0207648_101046964 | 210 |
| 262 | 3300026116 | Ga0207674_10672585 | Ga0207674_106725852 | 210 |
| 263 | 3300028381 | Ga0268264_10036593 | Ga0268264_100365933 | 210 |
| 264 | 3300028381 | Ga0268264_10217932 | Ga0268264_102179322 | 210 |
| 265 | 3300049568 | Ga0501031_0053095 | Ga0501031_0053095_158_802 | 210 |
| 266 | 3300049569 | Ga0501032_0108900 | Ga0501032_0108900_271_915 | 210 |
| 267 | 3300049572 | Ga0501036_0337091 | Ga0501036_0337091_566_1210 | 210 |
| 268 | 3300049573 | Ga0501037_0167186 | Ga0501037_0167186_687_1331 | 210 |
| 269 | 3300049574 | Ga0501038_0043476 | Ga0501038_0043476_2643_3287 | 210 |
| 270 | 3300049575 | Ga0501039_0200127 | Ga0501039_0200127_653_1297 | 210 |
| 271 | 3300049579 | Ga0501043_0147388 | Ga0501043_0147388_579_1223 | 210 |
| 272 | 3300049581 | Ga0501047_0496988 | Ga0501047_0496988_190_834 | 210 |
| 273 | 3300049584 | Ga0501068_0224317 | Ga0501068_0224317_430_1074 | 210 |
| 274 | 3300049822 | Ga0501035_0345766 | Ga0501035_0345766_27_671 | 210 |
| 275 | 3300053129 | Ga0500628_018384 | Ga0500628_018384_367_1002 | 210 |
| 276 | 3300005290 | Ga0065712_10068802 | Ga0065712_100688028 | 211 |
| 277 | 3300005295 | Ga0065707_10114435 | Ga0065707_101144353 | 211 |
| 278 | 3300005328 | Ga0070676_10011797 | Ga0070676_100117973 | 211 |
| 279 | 3300005331 | Ga0070670_100031969 | Ga0070670_1000319692 | 211 |
| 280 | 3300005334 | Ga0068869_100069601 | Ga0068869_1000696013 | 211 |
| 281 | 3300005340 | Ga0070689_100041802 | Ga0070689_1000418023 | 211 |
| 282 | 3300005347 | Ga0070668_100254009 | Ga0070668_1002540092 | 211 |
| 283 | 3300005353 | Ga0070669_100011389 | Ga0070669_1000113896 | 211 |
| 284 | 3300005354 | Ga0070675_100003918 | Ga0070675_1000039189 | 211 |
| 285 | 3300005356 | Ga0070674_100552712 | Ga0070674_1005527122 | 211 |
| 286 | 3300005364 | Ga0070673_100209251 | Ga0070673_1002092513 | 211 |
| 287 | 3300005365 | Ga0070688_100004791 | Ga0070688_1000047916 | 211 |
| 288 | 3300005441 | Ga0070700_100052719 | Ga0070700_1000527192 | 211 |
| 289 | 3300005444 | Ga0070694_100320301 | Ga0070694_1003203011 | 211 |
| 290 | 3300005457 | Ga0070662_100006612 | Ga0070662_1000066121 | 211 |
| 291 | 3300005459 | Ga0068867_100026586 | Ga0068867_1000265864 | 211 |
| 292 | 3300005548 | Ga0070665_100365499 | Ga0070665_1003654992 | 211 |
| 293 | 3300005577 | Ga0068857_100004492 | Ga0068857_1000044923 | 211 |
| 294 | 3300005719 | Ga0068861_100013519 | Ga0068861_1000135194 | 211 |
| 295 | 3300025933 | Ga0207706_10005719 | Ga0207706_1000571911 | 211 |
| 296 | 3300025940 | Ga0207691_10103963 | Ga0207691_101039633 | 211 |
| 297 | 3300025961 | Ga0207712_10005902 | Ga0207712_100059026 | 211 |
| 298 | 3300025972 | Ga0207668_10074353 | Ga0207668_100743533 | 211 |
| 299 | 3300026075 | Ga0207708_10034717 | Ga0207708_100347173 | 211 |
| 300 | 3300026116 | Ga0207674_10004270 | Ga0207674_1000427018 | 211 |
| 301 | 3300026118 | Ga0207675_100000646 | Ga0207675_1000006464 | 211 |
| 302 | 3300028379 | Ga0268266_10633903 | Ga0268266_106339032 | 211 |
| 303 | 3300041413 | Ga0439465_0004571 | Ga0439465_0004571_1320_1961 | 211 |
| 304 | 3300005347 | Ga0070668_100538073 | Ga0070668_1005380732 | 212 |
| 305 | 3300005548 | Ga0070665_101080134 | Ga0070665_1010801342 | 212 |
| 306 | 3300025972 | Ga0207668_10494340 | Ga0207668_104943402 | 212 |
| 307 | 3300053139 | Ga0500568_0000080 | Ga0500568_0000080_91022_91666 | 212 |
| 308 | 3300046522 | Ga0495643_0050523 | Ga0495643_0050523_68_715 | 213 |
| 309 | 3300014326 | Ga0157380_10732360 | Ga0157380_107323601 | 214 |
| 310 | 3300025960 | Ga0207651_10088073 | Ga0207651_100880733 | 219 |
| 311 | 2162886011 | MRS1b_contig_3359027 | MRS1b_0194.00000480 | 226 |
| 312 | 3300002155 | JGI24033J26618_1019922 | JGI24033J26618_10199222 | 226 |
| 313 | 3300005343 | Ga0070687_100316291 | Ga0070687_1003162912 | 226 |
| 314 | 3300005438 | Ga0070701_10021670 | Ga0070701_100216703 | 226 |
| 315 | 3300005617 | Ga0068859_100029185 | Ga0068859_1000291855 | 226 |
| 316 | 3300006931 | Ga0097620_100029185 | Ga0097620_1000291855 | 226 |
| 317 | 3300009094 | Ga0111539_10000458 | Ga0111539_1000045830 | 226 |
| 318 | 3300009553 | Ga0105249_10003210 | Ga0105249_1000321012 | 226 |
| 319 | 3300013308 | Ga0157375_10013435 | Ga0157375_100134354 | 226 |
| 320 | 3300014326 | Ga0157380_10002400 | Ga0157380_1000240012 | 226 |
| 321 | 3300014745 | Ga0157377_10002011 | Ga0157377_100020112 | 226 |
| 322 | 3300025925 | Ga0207650_10127870 | Ga0207650_101278702 | 226 |
| 323 | 3300025936 | Ga0207670_10013982 | Ga0207670_100139823 | 226 |
| 324 | 3300025942 | Ga0207689_10177844 | Ga0207689_101778442 | 226 |
| 325 | 3300026089 | Ga0207648_10045096 | Ga0207648_100450962 | 226 |
| 326 | 3300050511 | nmdc:mga08y16_61093_c1 | nmdc:mga08y16_61093_c1_561_1241 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fov-assembly1.cif.gz_A | abeh (tryptophan-5-halogenase) bound to fad and cl | 0.6789 | 188 | 225 |
| 2vx8-assembly5.cif.gz_D | vamp7 longin domain hrb peptide complex | 0.6727 | 198 | 225 |
| 6ioz-assembly1.cif.gz_A | structural insights of idursulfase beta | 0.6702 | 149 | 187 |
| 5fql-assembly1.cif.gz_A-2 | insights into hunter syndrome from the structure of iduronate-2- sulfatase | 0.6582 | 149 | 187 |
| 8fox-assembly4.cif.gz_D | abeh (tryptophan-5-halogenase) | 0.6579 | 188 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L4D0_610_722_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.7841 | 188 | 225 | 2.30.29.30 |
| af_Q4DPK8_1_127_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7305 | 198 | 222 | 3.30.450.50 |
| af_P53318_26_290_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7172 | 186 | 225 | 3.50.50.60 |
| af_Q4DVH6_123_446_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.68 | 142 | 185 | 3.60.21.10 |
| af_Q4CT13_9_352_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.6648 | 200 | 225 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519IW15-F1-model_v4 | deleted | 0.9614 | 105 | 226 |
|
| AF-A0A7Y2MT83-F1-model_v4 | DUF2911 domain-containing protein | 0.9599 | 96 | 226 |
|
| AF-A0A359E6J8-F1-model_v4 | DUF2911 domain-containing protein | 0.9562 | 136 | 226 |
|
| AF-A0A537J7S9-F1-model_v4 | DUF2911 domain-containing protein | 0.9559 | 116 | 226 |
|
| AF-A0A1D8P8D3-F1-model_v4 | DUF2911 domain-containing protein | 0.9541 | 96 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar