F407883

General Info

Members Datasets Scaffolds Average Seq Length
325 187 650 257

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10011409|Ga0207683_100114094
Length 292
Sequence MSQAVQSPITTAPAAGKPILRARGVRKTFRMGDSVIEVLKQIDLTLQPGEFVAIEGRSGSGKSTLLHILAGLDSADAGIVDFDGSDIAPLAAEASRALARSRLPGAELLRLLMLWANAADRRLADIRNTQFGFVFQFYHLLPELNVLENTMLAPMIQHSWLGFRSRSAELRERATSILNDMGLGHRLKHRPNQLSGGERQRVAIARALMNKPKIVFADEPTGNLDTSSGAEVLELFRAAVRNLDQTVVMVTHDPTAASYADAVVFLSDGRVVATLADPTPDGVLDALRGQGA

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
19 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
20 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
43 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
49 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
52 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
53 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
54 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
59 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
60 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
61 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
62 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
63 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
64 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
74 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
75 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
76 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
77 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
78 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
79 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
106 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
150 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
151 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
157 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
158 2643221647 Streptomyces sp. Root369 Isolate Unclassified
159 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
160 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
161 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
162 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
163 2808606448 Streptomyces sp. 193411 Isolate Unclassified
164 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
165 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
166 2862574272 Streptomyces sp. AcE210 Isolate Nodule
167 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
168 2867369537 Streptomyces sp. Z26 Isolate Unclassified
169 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
170 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
171 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
172 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
173 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
174 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
175 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
176 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
177 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
178 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
179 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
180 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
181 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
182 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
183 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
184 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
185 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
186 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
187 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 0
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0.31
Rhizoplane 0.62
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10011409 3300026121 Bacteria 7583
2 JGI25407J50210_10000303 3300003373 Bacteria 8993
3 Ga0070676_10190764 3300005328 Bacteria 1338
4 Ga0070674_100094595 3300005356 Bacteria 2164
5 Ga0070673_100069023 3300005364 Bacteria 2832
6 Ga0070673_100385240 3300005364 Bacteria 1251
7 Ga0070713_100183012 3300005436 Bacteria 1884
8 Ga0070663_100000056 3300005455 Bacteria 49564
9 Ga0070663_100000655 3300005455 Bacteria 18579
10 Ga0070698_100005027 3300005471 Bacteria 14485
11 Ga0068853_100005003 3300005539 Bacteria 10331
12 Ga0070665_100245538 3300005548 Bacteria 1791
13 Ga0081455_10001431 3300005937 Bacteria 29530
14 Ga0081455_10001651 3300005937 Bacteria 27074
15 Ga0081455_10087115 3300005937 Bacteria 2541
16 Ga0081538_10000236 3300005981 Bacteria 62334
17 Ga0081540_1020956 3300005983 Bacteria 3912
18 Ga0075367_10186666 3300006178 Bacteria 1293
19 Ga0075431_100512865 3300006847 Bacteria 1189
20 Ga0111539_10009996 3300009094 Bacteria 11957
21 Ga0111539_10491261 3300009094 Bacteria 1430
22 Ga0105247_10268843 3300009101 Bacteria 1172
23 Ga0157379_10078782 3300014968 Bacteria 2951
24 Ga0183367_1016 3300015688 Bacteria 290198
25 Ga0207694_10325849 3300025924 Bacteria 1268
26 Ga0207664_10013038 3300025929 Bacteria 5957
27 Ga0207644_10033887 3300025931 Bacteria 3572
28 Ga0207669_10136007 3300025937 Bacteria 1697
29 Ga0207691_10262262 3300025940 Bacteria 1489
30 Ga0207651_10046371 3300025960 Bacteria 2922
31 Ga0207639_10007031 3300026041 Bacteria 7672
32 Ga0207678_10000062 3300026067 Bacteria 84389
33 Ga0207678_10001511 3300026067 Bacteria 21311
34 Ga0207698_10024364 3300026142 Bacteria 4247
35 Ga0207698_10112686 3300026142 Bacteria 2284
36 Ga0268266_10366213 3300028379 Bacteria 1357
37 Ga0307517_10005215 3300028786 Bacteria 19679
38 Ga0307515_10002574 3300028794 Bacteria 39147
39 Ga0307511_10000010 3300030521 Bacteria 146716
40 Ga0307511_10082428 3300030521 Bacteria 2249
41 Ga0307512_10004885 3300030522 Bacteria 14354
42 Ga0307512_10066784 3300030522 Bacteria 2713
43 Ga0307513_10007359 3300031456 Bacteria 14288
44 Ga0307513_10218416 3300031456 Bacteria 1730
45 Ga0307509_10008776 3300031507 Bacteria 12782
46 Ga0307509_10022555 3300031507 Bacteria 7093
47 Ga0307509_10215243 3300031507 Bacteria 1741
48 Ga0307508_10014360 3300031616 Bacteria 7225
49 Ga0307516_10085727 3300031730 Bacteria 2987
50 Ga0307518_10226884 3300031838 Bacteria 1213
51 Ga0307416_100372300 3300032002 Bacteria 1455
52 Ga0307507_10014471 3300033179 Bacteria 9400
53 Ga0307507_10028387 3300033179 Bacteria 5965
54 Ga0307510_10001558 3300033180 Bacteria 25339
55 Ga0307510_10028047 3300033180 Bacteria 6436
56 Ga0307510_10055787 3300033180 Bacteria 4122
57 Ga0373948_0027705 3300034817 Bacteria 1124
58 Ga0373931_0401375 3300035691 Bacteria 868
59 Ga0395900_0402881 3300037418 Bacteria 1332
60 Ga0395898_0428805 3300037466 Bacteria 1260
61 Ga0395901_0361442 3300038443 Bacteria 1497
62 Ga0439448_0005238 3300042005 Bacteria 3693
63 Ga0439454_010223 3300042011 Bacteria 1233
64 Ga0450903_000757 3300042138 Bacteria 6341
65 Ga0439458_0001505 3300042157 Bacteria 5848
66 Ga0439440_0037039 3300042993 Bacteria 1176
67 Ga0466969_0074767 3300044656 Bacteria 1625
68 Ga0466972_0117194 3300044658 Bacteria 1257
69 Ga0466965_0009445 3300044683 Bacteria 4534
70 Ga0466959_0009891 3300045049 Bacteria 6798
71 Ga0466967_0750690 3300045976 Bacteria 968
72 Ga0495592_0086809 3300046454 Bacteria 2252
73 Ga0495603_0005550 3300046455 Bacteria 7528
74 Ga0495629_0001822 3300046459 Bacteria 16694
75 Ga0495629_0046095 3300046459 Bacteria 3058
76 Ga0495629_0304774 3300046459 Bacteria 1090
77 Ga0495629_0308851 3300046459 Bacteria 1082
78 Ga0495651_0005523 3300046462 Bacteria 9641
79 Ga0495580_0202575 3300046472 Bacteria 1367
80 Ga0495582_0038056 3300046473 Bacteria 2646
81 Ga0495605_0003175 3300046474 Bacteria 9878
82 Ga0495664_0001064 3300046477 Bacteria 14191
83 Ga0495585_0043875 3300046492 Bacteria 2499
84 Ga0495594_0107777 3300046499 Bacteria 1569
85 Ga0495607_0056230 3300046501 Bacteria 2260
86 Ga0495583_0019577 3300046506 Bacteria 3529
87 Ga0495606_0022998 3300046507 Bacteria 4529
88 Ga0495608_0046175 3300046511 Bacteria 2900
89 Ga0495616_0004699 3300046513 Bacteria 8561
90 Ga0495618_0136772 3300046514 Bacteria 1567
91 Ga0495620_0005210 3300046515 Bacteria 7276
92 Ga0495628_0046415 3300046516 Bacteria 3450
93 Ga0495628_0438015 3300046516 Bacteria 950
94 Ga0495631_0004818 3300046518 Bacteria 7110
95 Ga0495648_0038396 3300046524 Bacteria 3063
96 Ga0495666_0018135 3300046526 Bacteria 3506
97 Ga0495640_0018638 3300046533 Bacteria 5140
98 Ga0495640_0214310 3300046533 Bacteria 1216
99 Ga0495640_0228530 3300046533 Bacteria 1171
100 Ga0495586_0045633 3300046535 Bacteria 2362
101 Ga0495587_0006015 3300046536 Bacteria 7909
102 Ga0495597_0016951 3300046542 Bacteria 3435
103 Ga0495622_0020726 3300046557 Bacteria 3060
104 Ga0495668_0021751 3300046616 Bacteria 3671
105 Ga0495634_0006757 3300046642 Bacteria 8688
106 Ga0495634_0139063 3300046642 Bacteria 1543
107 Ga0495611_0119958 3300046648 Bacteria 1226
108 Ga0495625_0009121 3300046660 Bacteria 8363
109 Ga0495625_0014429 3300046660 Bacteria 6306
110 Ga0495625_0035553 3300046660 Bacteria 3671
111 Ga0495625_0036954 3300046660 Bacteria 3585
112 Ga0495635_0017937 3300046663 Bacteria 4943
113 Ga0495635_0317411 3300046663 Bacteria 1043
114 Ga0495661_0030643 3300046665 Bacteria 3422
115 Ga0495588_0080805 3300046674 Bacteria 1696
116 Ga0495657_0032555 3300046675 Bacteria 3636
117 Ga0495657_0037234 3300046675 Bacteria 3355
118 Ga0495623_0087974 3300046679 Bacteria 1913
119 Ga0495646_0000204 3300046680 Bacteria 29112
120 Ga0495613_0000570 3300046689 Bacteria 30354
121 Ga0495613_0004169 3300046689 Bacteria 10816
122 Ga0495613_0050597 3300046689 Bacteria 3063
123 Ga0495613_0093128 3300046689 Bacteria 2181
124 Ga0495624_0092916 3300046690 Bacteria 1860
125 Ga0495649_0029082 3300046694 Bacteria 3060
126 Ga0495589_0019894 3300046794 Bacteria 3434
127 Ga0495589_0041091 3300046794 Bacteria 2308
128 Ga0495589_0131180 3300046794 Bacteria 1203
129 Ga0495660_0048293 3300046810 Bacteria 2328
130 Ga0495581_0036835 3300047315 Bacteria 2830
131 Ga0495604_0003537 3300047317 Bacteria 12454
132 Ga0495604_0022464 3300047317 Bacteria 5037
133 Ga0495636_0021959 3300047318 Bacteria 2579
134 Ga0495636_0027228 3300047318 Bacteria 2329
135 Ga0495676_0003951 3300047321 Bacteria 13491
136 Ga0495676_0010621 3300047321 Bacteria 8339
137 Ga0495676_0045617 3300047321 Bacteria 3565
138 Ga0495676_0058551 3300047321 Bacteria 3030
139 Ga0495680_0027204 3300047322 Bacteria 4702
140 Ga0495683_0036850 3300047323 Bacteria 2481
141 Ga0495687_002208 3300047443 Bacteria 16078
142 Ga0495687_003152 3300047443 Bacteria 12291
143 Ga0495687_014443 3300047443 Bacteria 4065
144 Ga0495687_014980 3300047443 Bacteria 3961
145 Ga0495685_005975 3300047447 Bacteria 3976
146 Ga0495685_008490 3300047447 Bacteria 3413
147 Ga0495685_023661 3300047447 Bacteria 2115
148 Ga0495681_0003990 3300047470 Bacteria 10156
149 Ga0495684_0290637 3300047471 Bacteria 1177
150 Ga0495686_0107248 3300047472 Bacteria 1678
151 Ga0495593_0055547 3300047673 Bacteria 2083
152 Ga0495593_0086800 3300047673 Bacteria 1613
153 Ga0495602_0210982 3300048088 Bacteria 1474
154 Ga0495614_0012008 3300048089 Bacteria 3804
155 Ga0495614_0081388 3300048089 Bacteria 1403
156 Ga0495614_0177144 3300048089 Bacteria 958
157 Ga0496110_0223701 3300048913 Bacteria 1712
158 Ga0496111_0230498 3300048914 Bacteria 1376
159 Ga0501031_0000360 3300049568 Bacteria 26525
160 Ga0501031_0425687 3300049568 Bacteria 858
161 Ga0501033_0002712 3300049570 Bacteria 14853
162 Ga0501033_0006097 3300049570 Bacteria 9455
163 Ga0501033_0013842 3300049570 Bacteria 6138
164 Ga0501033_0048172 3300049570 Bacteria 3166
165 Ga0501034_0232705 3300049571 Bacteria 1791
166 Ga0501036_0000811 3300049572 Bacteria 23196
167 Ga0501036_0002196 3300049572 Bacteria 15246
168 Ga0501036_0089563 3300049572 Bacteria 2600
169 Ga0501036_0115372 3300049572 Bacteria 2269
170 Ga0501036_0234314 3300049572 Bacteria 1540
171 Ga0501037_0012669 3300049573 Bacteria 6214
172 Ga0501037_0099496 3300049573 Bacteria 2100
173 Ga0501037_0275637 3300049573 Bacteria 1173
174 Ga0501037_0378616 3300049573 Bacteria 973
175 Ga0501038_0000183 3300049574 Bacteria 53678
176 Ga0501038_0005901 3300049574 Bacteria 11320
177 Ga0501038_0024535 3300049574 Bacteria 5379
178 Ga0501038_0026155 3300049574 Bacteria 5199
179 Ga0501038_0383935 3300049574 Bacteria 1089
180 Ga0501039_0000197 3300049575 Bacteria 43481
181 Ga0501039_0000328 3300049575 Bacteria 33856
182 Ga0501040_0000209 3300049576 Bacteria 34062
183 Ga0501040_0000816 3300049576 Bacteria 19445
184 Ga0501040_0003477 3300049576 Bacteria 10163
185 Ga0501040_0353648 3300049576 Bacteria 1052
186 Ga0501041_0000263 3300049577 Bacteria 24851
187 Ga0501041_0001603 3300049577 Bacteria 12627
188 Ga0501041_0228556 3300049577 Bacteria 1168
189 Ga0501042_0000007 3300049578 Bacteria 63673
190 Ga0501042_0000908 3300049578 Bacteria 16559
191 Ga0501042_0060313 3300049578 Bacteria 2709
192 Ga0501043_0255805 3300049579 Bacteria 1348
193 Ga0501043_0376812 3300049579 Bacteria 1075
194 Ga0501046_0005961 3300049580 Bacteria 10844
195 Ga0501047_0065928 3300049581 Bacteria 3490
196 Ga0501047_0074450 3300049581 Bacteria 3269
197 Ga0501047_0091792 3300049581 Bacteria 2915
198 Ga0501047_0498910 3300049581 Bacteria 1044
199 Ga0501047_0561590 3300049581 Bacteria 965
200 Ga0501048_0000421 3300049582 Bacteria 29745
201 Ga0501048_0028392 3300049582 Bacteria 4060
202 Ga0501068_0001751 3300049584 Bacteria 11542
203 Ga0501068_0047275 3300049584 Bacteria 2596
204 Ga0501068_0074568 3300049584 Bacteria 2074
205 Ga0501070_0008104 3300049586 Bacteria 8892
206 Ga0501070_0027544 3300049586 Bacteria 4767
207 Ga0501070_0054729 3300049586 Bacteria 3309
208 Ga0501071_0000182 3300049587 Bacteria 27901
209 Ga0501071_0002018 3300049587 Bacteria 12145
210 Ga0501071_0029608 3300049587 Bacteria 3866
211 Ga0501071_0104741 3300049587 Bacteria 2088
212 Ga0501072_0000195 3300049588 Bacteria 44197
213 Ga0501072_0001730 3300049588 Bacteria 16273
214 Ga0501072_0002484 3300049588 Bacteria 13811
215 Ga0501072_0026474 3300049588 Bacteria 4522
216 Ga0501072_0118420 3300049588 Bacteria 2110
217 Ga0501072_0138571 3300049588 Bacteria 1940
218 Ga0501072_0159062 3300049588 Bacteria 1802
219 Ga0501073_0006581 3300049589 Bacteria 8646
220 Ga0501073_0014647 3300049589 Bacteria 5697
221 Ga0501073_0072722 3300049589 Bacteria 2395
222 Ga0501074_0003472 3300049590 Bacteria 11187
223 Ga0501074_0012682 3300049590 Bacteria 6128
224 Ga0501074_0062705 3300049590 Bacteria 2677
225 Ga0501074_0094112 3300049590 Bacteria 2146
226 Ga0501075_0000497 3300049591 Bacteria 23584
227 Ga0501075_0002302 3300049591 Bacteria 12679
228 Ga0501075_0065496 3300049591 Bacteria 2742
229 Ga0501075_0082949 3300049591 Bacteria 2428
230 Ga0501075_0138902 3300049591 Bacteria 1851
231 Ga0501076_0000217 3300049592 Bacteria 34870
232 Ga0501076_0005472 3300049592 Bacteria 9143
233 Ga0501076_0032781 3300049592 Bacteria 4056
234 Ga0501076_0068290 3300049592 Bacteria 2839
235 Ga0501077_0001573 3300049593 Bacteria 13752
236 Ga0501077_0004838 3300049593 Bacteria 8182
237 Ga0501077_0008551 3300049593 Bacteria 6343
238 Ga0501077_0018020 3300049593 Bacteria 4463
239 Ga0501077_0033732 3300049593 Bacteria 3258
240 Ga0501077_0125744 3300049593 Bacteria 1625
241 Ga0501079_0000200 3300049741 Bacteria 34694
242 Ga0501079_0003311 3300049741 Bacteria 11812
243 Ga0501079_0005749 3300049741 Bacteria 9271
244 Ga0501079_0177515 3300049741 Bacteria 1661
245 Ga0501080_0012876 3300049742 Bacteria 7675
246 Ga0501080_0015709 3300049742 Bacteria 6981
247 Ga0501080_0338670 3300049742 Bacteria 1359
248 Ga0501081_0000172 3300049743 Bacteria 30389
249 Ga0501081_0001415 3300049743 Bacteria 14670
250 Ga0501081_0041065 3300049743 Bacteria 3167
251 Ga0501081_0141525 3300049743 Bacteria 1724
252 Ga0501083_0016451 3300049744 Bacteria 5177
253 Ga0501083_0105277 3300049744 Bacteria 1858
254 Ga0501035_0015789 3300049822 Bacteria 6971
255 Ga0501035_0023342 3300049822 Bacteria 5673
256 Ga0501035_0033724 3300049822 Bacteria 4654
257 Ga0501035_0148496 3300049822 Bacteria 2035
258 Ga0501035_0215940 3300049822 Bacteria 1639
259 Ga0501035_0252491 3300049822 Bacteria 1497
260 Ga0501035_0492869 3300049822 Bacteria 1009
261 Ga0501035_0679821 3300049822 Bacteria 832
262 Ga0501044_0059178 3300049823 Bacteria 3926
263 Ga0501044_0093162 3300049823 Bacteria 3038
264 Ga0501044_0345858 3300049823 Bacteria 1407
265 Ga0501044_0472772 3300049823 Bacteria 1157
266 Ga0501045_0000015 3300049824 Bacteria 72669
267 Ga0501045_0001961 3300049824 Bacteria 13893
268 Ga0501045_0005230 3300049824 Bacteria 8976
269 Ga0501045_0029608 3300049824 Bacteria 3959
270 nmdc:mga06z11_110047_c1 3300050494 Bacteria 1524
271 nmdc:mga0qj67_155897_c1 3300050509 Bacteria 1853
272 nmdc:mga06r32_608420_c1 3300050510 Bacteria 1063
273 nmdc:mga06r32_800783_c1 3300050510 Bacteria 903
274 nmdc:mga08y16_173859_c1 3300050511 Bacteria 2236
275 Ga0495619_0043725 3300053085 Bacteria 2938
276 Ga0500553_109758 3300053101 Bacteria 1164
277 Ga0500560_003112 3300053107 Bacteria 3301
278 Ga0500600_0131747 3300053149 Bacteria 1272
279 Ga0501084_0000331 3300054114 Bacteria 36157
280 Ga0501084_0000576 3300054114 Bacteria 28065
281 Ga0501084_0001561 3300054114 Bacteria 18181
282 Ga0501084_0019726 3300054114 Bacteria 5618
283 Ga0501082_0000373 3300060353 Bacteria 39570
284 Ga0501082_0004138 3300060353 Bacteria 12673
285 Ga0501082_0008985 3300060353 Bacteria 8624
286 Ga0501082_0026411 3300060353 Bacteria 5004
287 Ga0501082_0118497 3300060353 Bacteria 2293
288 Ga0530510_0001025 3300061734 Bacteria 18494
289 Ga0530510_0001360 3300061734 Bacteria 16343
290 Ga0530510_0002633 3300061734 Bacteria 12332
291 Ga0530510_0104293 3300061734 Bacteria 2074
292 Ga0530510_0145425 3300061734 Bacteria 1749
293 2547409283 2547132111 Bacteria 8013147
294 2585303363 2582581313 Bacteria 10042643
295 2616696177 2616644814 Bacteria 11555299
296 2644266688 2643221647 Bacteria 10741251
297 2676484139 2675903059 Bacteria 8644972
298 2784592240 2784132148 Bacteria 8627943
299 2785374196 2784746768 Bacteria 10036182
300 2786674432 2786546132 Bacteria 10419719
301 2809235886 2808606448 Bacteria 8656184
302 2812483023 2811994917 Bacteria 7761064
303 2862282806 2862281513 Bacteria 9621493
304 2862576897 2862574272 Bacteria 10567477
305 2866617912 2866612099 Bacteria 7543886
306 2867375046 2867369537 Bacteria 6501581
307 2912760720 2912757875 Bacteria 7940295
308 2946071729 2946064051 Bacteria 8957905
309 2947228593 2947224130 Bacteria 9938529
310 2954382097 2954380949 Bacteria 10050426
311 2954680974 2954673503 Bacteria 9685905
312 2954683183 2954682443 Bacteria 9862841
313 2954692911 2954691527 Bacteria 10720516
314 2954707984 2954701450 Bacteria 10834262
315 2954712538 2954711539 Bacteria 10867210
316 2954722493 2954721474 Bacteria 10456478
317 2954739365 2954731030 Bacteria 10243860
318 2954758193 2954749733 Bacteria 10366972
319 2954760388 2954759201 Bacteria 9358192
320 3003007142 3002998708 Bacteria 11715108
321 3006495740 3006493962 Bacteria 8825450
322 8023625911 8023623736 Bacteria 8593882
323 8025534647 8025530807 Bacteria 8495698
324 8033688934 8033684223 Bacteria 6906479
325 8053950236 8053945823 Bacteria 8962862
326 Ga0207683_10011409
327 JGI25407J50210_10000303
328 Ga0070676_10190764
329 Ga0070674_100094595
330 Ga0070673_100069023
331 Ga0070673_100385240
332 Ga0070713_100183012
333 Ga0070663_100000056
334 Ga0070663_100000655
335 Ga0070698_100005027
336 Ga0068853_100005003
337 Ga0070665_100245538
338 Ga0081455_10001431
339 Ga0081455_10001651
340 Ga0081455_10087115
341 Ga0081538_10000236
342 Ga0081540_1020956
343 Ga0075367_10186666
344 Ga0075431_100512865
345 Ga0111539_10009996
346 Ga0111539_10491261
347 Ga0105247_10268843
348 Ga0157379_10078782
349 Ga0183367_1016
350 Ga0207694_10325849
351 Ga0207664_10013038
352 Ga0207644_10033887
353 Ga0207669_10136007
354 Ga0207691_10262262
355 Ga0207651_10046371
356 Ga0207639_10007031
357 Ga0207678_10000062
358 Ga0207678_10001511
359 Ga0207698_10024364
360 Ga0207698_10112686
361 Ga0268266_10366213
362 Ga0307517_10005215
363 Ga0307515_10002574
364 Ga0307511_10000010
365 Ga0307511_10082428
366 Ga0307512_10004885
367 Ga0307512_10066784
368 Ga0307513_10007359
369 Ga0307513_10218416
370 Ga0307509_10008776
371 Ga0307509_10022555
372 Ga0307509_10215243
373 Ga0307508_10014360
374 Ga0307516_10085727
375 Ga0307518_10226884
376 Ga0307416_100372300
377 Ga0307507_10014471
378 Ga0307507_10028387
379 Ga0307510_10001558
380 Ga0307510_10028047
381 Ga0307510_10055787
382 Ga0373948_0027705
383 Ga0373931_0401375
384 Ga0395900_0402881
385 Ga0395898_0428805
386 Ga0395901_0361442
387 Ga0439448_0005238
388 Ga0439454_010223
389 Ga0450903_000757
390 Ga0439458_0001505
391 Ga0439440_0037039
392 Ga0466969_0074767
393 Ga0466972_0117194
394 Ga0466965_0009445
395 Ga0466959_0009891
396 Ga0466967_0750690
397 Ga0495592_0086809
398 Ga0495603_0005550
399 Ga0495629_0001822
400 Ga0495629_0046095
401 Ga0495629_0304774
402 Ga0495629_0308851
403 Ga0495651_0005523
404 Ga0495580_0202575
405 Ga0495582_0038056
406 Ga0495605_0003175
407 Ga0495664_0001064
408 Ga0495585_0043875
409 Ga0495594_0107777
410 Ga0495607_0056230
411 Ga0495583_0019577
412 Ga0495606_0022998
413 Ga0495608_0046175
414 Ga0495616_0004699
415 Ga0495618_0136772
416 Ga0495620_0005210
417 Ga0495628_0046415
418 Ga0495628_0438015
419 Ga0495631_0004818
420 Ga0495648_0038396
421 Ga0495666_0018135
422 Ga0495640_0018638
423 Ga0495640_0214310
424 Ga0495640_0228530
425 Ga0495586_0045633
426 Ga0495587_0006015
427 Ga0495597_0016951
428 Ga0495622_0020726
429 Ga0495668_0021751
430 Ga0495634_0006757
431 Ga0495634_0139063
432 Ga0495611_0119958
433 Ga0495625_0009121
434 Ga0495625_0014429
435 Ga0495625_0035553
436 Ga0495625_0036954
437 Ga0495635_0017937
438 Ga0495635_0317411
439 Ga0495661_0030643
440 Ga0495588_0080805
441 Ga0495657_0032555
442 Ga0495657_0037234
443 Ga0495623_0087974
444 Ga0495646_0000204
445 Ga0495613_0000570
446 Ga0495613_0004169
447 Ga0495613_0050597
448 Ga0495613_0093128
449 Ga0495624_0092916
450 Ga0495649_0029082
451 Ga0495589_0019894
452 Ga0495589_0041091
453 Ga0495589_0131180
454 Ga0495660_0048293
455 Ga0495581_0036835
456 Ga0495604_0003537
457 Ga0495604_0022464
458 Ga0495636_0021959
459 Ga0495636_0027228
460 Ga0495676_0003951
461 Ga0495676_0010621
462 Ga0495676_0045617
463 Ga0495676_0058551
464 Ga0495680_0027204
465 Ga0495683_0036850
466 Ga0495687_002208
467 Ga0495687_003152
468 Ga0495687_014443
469 Ga0495687_014980
470 Ga0495685_005975
471 Ga0495685_008490
472 Ga0495685_023661
473 Ga0495681_0003990
474 Ga0495684_0290637
475 Ga0495686_0107248
476 Ga0495593_0055547
477 Ga0495593_0086800
478 Ga0495602_0210982
479 Ga0495614_0012008
480 Ga0495614_0081388
481 Ga0495614_0177144
482 Ga0496110_0223701
483 Ga0496111_0230498
484 Ga0501031_0000360
485 Ga0501031_0425687
486 Ga0501033_0002712
487 Ga0501033_0006097
488 Ga0501033_0013842
489 Ga0501033_0048172
490 Ga0501034_0232705
491 Ga0501036_0000811
492 Ga0501036_0002196
493 Ga0501036_0089563
494 Ga0501036_0115372
495 Ga0501036_0234314
496 Ga0501037_0012669
497 Ga0501037_0099496
498 Ga0501037_0275637
499 Ga0501037_0378616
500 Ga0501038_0000183
501 Ga0501038_0005901
502 Ga0501038_0024535
503 Ga0501038_0026155
504 Ga0501038_0383935
505 Ga0501039_0000197
506 Ga0501039_0000328
507 Ga0501040_0000209
508 Ga0501040_0000816
509 Ga0501040_0003477
510 Ga0501040_0353648
511 Ga0501041_0000263
512 Ga0501041_0001603
513 Ga0501041_0228556
514 Ga0501042_0000007
515 Ga0501042_0000908
516 Ga0501042_0060313
517 Ga0501043_0255805
518 Ga0501043_0376812
519 Ga0501046_0005961
520 Ga0501047_0065928
521 Ga0501047_0074450
522 Ga0501047_0091792
523 Ga0501047_0498910
524 Ga0501047_0561590
525 Ga0501048_0000421
526 Ga0501048_0028392
527 Ga0501068_0001751
528 Ga0501068_0047275
529 Ga0501068_0074568
530 Ga0501070_0008104
531 Ga0501070_0027544
532 Ga0501070_0054729
533 Ga0501071_0000182
534 Ga0501071_0002018
535 Ga0501071_0029608
536 Ga0501071_0104741
537 Ga0501072_0000195
538 Ga0501072_0001730
539 Ga0501072_0002484
540 Ga0501072_0026474
541 Ga0501072_0118420
542 Ga0501072_0138571
543 Ga0501072_0159062
544 Ga0501073_0006581
545 Ga0501073_0014647
546 Ga0501073_0072722
547 Ga0501074_0003472
548 Ga0501074_0012682
549 Ga0501074_0062705
550 Ga0501074_0094112
551 Ga0501075_0000497
552 Ga0501075_0002302
553 Ga0501075_0065496
554 Ga0501075_0082949
555 Ga0501075_0138902
556 Ga0501076_0000217
557 Ga0501076_0005472
558 Ga0501076_0032781
559 Ga0501076_0068290
560 Ga0501077_0001573
561 Ga0501077_0004838
562 Ga0501077_0008551
563 Ga0501077_0018020
564 Ga0501077_0033732
565 Ga0501077_0125744
566 Ga0501079_0000200
567 Ga0501079_0003311
568 Ga0501079_0005749
569 Ga0501079_0177515
570 Ga0501080_0012876
571 Ga0501080_0015709
572 Ga0501080_0338670
573 Ga0501081_0000172
574 Ga0501081_0001415
575 Ga0501081_0041065
576 Ga0501081_0141525
577 Ga0501083_0016451
578 Ga0501083_0105277
579 Ga0501035_0015789
580 Ga0501035_0023342
581 Ga0501035_0033724
582 Ga0501035_0148496
583 Ga0501035_0215940
584 Ga0501035_0252491
585 Ga0501035_0492869
586 Ga0501035_0679821
587 Ga0501044_0059178
588 Ga0501044_0093162
589 Ga0501044_0345858
590 Ga0501044_0472772
591 Ga0501045_0000015
592 Ga0501045_0001961
593 Ga0501045_0005230
594 Ga0501045_0029608
595 nmdc:mga06z11_110047_c1
596 nmdc:mga0qj67_155897_c1
597 nmdc:mga06r32_608420_c1
598 nmdc:mga06r32_800783_c1
599 nmdc:mga08y16_173859_c1
600 Ga0495619_0043725
601 Ga0500553_109758
602 Ga0500560_003112
603 Ga0500600_0131747
604 Ga0501084_0000331
605 Ga0501084_0000576
606 Ga0501084_0001561
607 Ga0501084_0019726
608 Ga0501082_0000373
609 Ga0501082_0004138
610 Ga0501082_0008985
611 Ga0501082_0026411
612 Ga0501082_0118497
613 Ga0530510_0001025
614 Ga0530510_0001360
615 Ga0530510_0002633
616 Ga0530510_0104293
617 Ga0530510_0145425
618 2547409283
619 2585303363
620 2616696177
621 2644266688
622 2676484139
623 2784592240
624 2785374196
625 2786674432
626 2809235886
627 2812483023
628 2862282806
629 2862576897
630 2866617912
631 2867375046
632 2912760720
633 2946071729
634 2947228593
635 2954382097
636 2954680974
637 2954683183
638 2954692911
639 2954707984
640 2954712538
641 2954722493
642 2954739365
643 2954758193
644 2954760388
645 3003007142
646 3006495740
647 8023625911
648 8025534647
649 8033688934
650 8053950236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9476 29 249
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9474 30 245
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9467 29 249
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9464 30 251
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9456 29 251
ID Description Score Start End Superfamily
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 30 263 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9642 29 251 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 31 248 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 27 247 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 29 249 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5C4JFU2-F1-model_v4 ABC transporter ATP-binding protein 0.9942 33 267 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A6B1PVR4-F1-model_v4 deleted 0.987 170 266
AF-A0A5C4JFU2-F1-model_v4 ABC transporter ATP-binding protein 0.9858 33 267 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0G3GLA2-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9849 29 248 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A328A705-F1-model_v4 ABC transporter ATP-binding protein 0.9722 30 266 GO:0005524
GO:0016887

Map