F407838

General Info

Members Datasets Scaffolds Average Seq Length
325 183 650 376

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10010554|Ga0182008_100105545
Length 417
Sequence VRDEQLDRPLERREQLAYALLVLGPEDRHHPTLEALGSAPMPAVLIYADTLRSPEMRHELPLPVPDPLLYVEHDGFRAVVASAFELQRITEAAPDVETFAPDHFGIDELLRSGMTFDEAELEVAVRALNRFGITSASVPWSFPLELADHLRANGIDVAADRDLFDERRRRKNAAEIAGLRRAQRACEAALDVARDMLRRARANGVLTLGGAPLTSERIKLEIERVFSEHGVVGDEFIVSHGAQTAVGHEMGSGPLQPDEPIVFDLFPRDRETGVYSDMTRTYVVGEPSDELREYHRLVKVALERTTAATKPGVNGRELMQLACDLFHEHGYKTQLHKEPGEVLDSGFFHGLGHGVGLEVHEKPALSRSGDDLVPGDVITLEPGLYRAGYGGVRLEDILIVTEGGAEVVTDYPYDLEP

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.15
Metatranscriptomes 1.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 10.15
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10010554 3300014497 Bacteria 4942
2 Ga0070658_10003872 3300005327 Bacteria 12271
3 Ga0070658_10022198 3300005327 Bacteria 5093
4 Ga0070658_10062679 3300005327 Bacteria 3030
5 Ga0070683_100000386 3300005329 Bacteria 30508
6 Ga0070683_100019318 3300005329 Bacteria 6052
7 Ga0070683_100052401 3300005329 Bacteria 3780
8 Ga0070683_100110021 3300005329 Bacteria 2599
9 Ga0070690_100030021 3300005330 Bacteria 3376
10 Ga0070666_10064553 3300005335 Unclassified 2483
11 Ga0070660_100003886 3300005339 Bacteria 10322
12 Ga0070660_100016119 3300005339 Bacteria 5418
13 Ga0070660_100039676 3300005339 Bacteria 3579
14 Ga0070689_100032221 3300005340 Bacteria 3985
15 Ga0070669_100105895 3300005353 Bacteria 2128
16 Ga0070674_100061653 3300005356 Bacteria 2618
17 Ga0070688_100021060 3300005365 Bacteria 3802
18 Ga0070659_100050176 3300005366 Bacteria 3281
19 Ga0070659_100134419 3300005366 Bacteria 2011
20 Ga0070709_10040385 3300005434 Bacteria 2868
21 Ga0070709_10151231 3300005434 Unclassified 1604
22 Ga0070714_100028207 3300005435 Bacteria 4655
23 Ga0070714_100034006 3300005435 Bacteria 4267
24 Ga0070713_100119027 3300005436 Bacteria 2313
25 Ga0070713_100148084 3300005436 Bacteria 2086
26 Ga0070713_100236276 3300005436 Unclassified 1663
27 Ga0070705_100180479 3300005440 Bacteria 1429
28 Ga0070700_100000793 3300005441 Bacteria 15518
29 Ga0070708_100124267 3300005445 Bacteria 2384
30 Ga0070678_100005429 3300005456 Bacteria 7366
31 Ga0070681_10089451 3300005458 Bacteria 3030
32 Ga0070681_10175364 3300005458 Bacteria 2066
33 Ga0070706_100036001 3300005467 Bacteria 4571
34 Ga0070707_100095394 3300005468 Bacteria 2881
35 Ga0070707_100120462 3300005468 Bacteria 2548
36 Ga0070707_100365352 3300005468 Unclassified 1402
37 Ga0070698_100012630 3300005471 Bacteria 8943
38 Ga0070698_100015109 3300005471 Bacteria 8163
39 Ga0070698_100059450 3300005471 Bacteria 3860
40 Ga0070698_100073541 3300005471 Bacteria 3424
41 Ga0070698_100219448 3300005471 Bacteria 1835
42 Ga0070698_100304375 3300005471 Bacteria 1525
43 Ga0070699_100036702 3300005518 Bacteria 4239
44 Ga0070679_100066252 3300005530 Bacteria 3600
45 Ga0070679_100096406 3300005530 Bacteria 2945
46 Ga0070684_100002479 3300005535 Bacteria 13597
47 Ga0070684_100019024 3300005535 Bacteria 5674
48 Ga0070684_100123427 3300005535 Bacteria 2331
49 Ga0070684_100276299 3300005535 Bacteria 1538
50 Ga0070686_100012481 3300005544 Bacteria 4842
51 Ga0070665_100009693 3300005548 Bacteria 9731
52 Ga0070704_100022731 3300005549 Bacteria 4084
53 Ga0068855_100008503 3300005563 Bacteria 12408
54 Ga0068855_100062747 3300005563 Bacteria 4338
55 Ga0068855_100106630 3300005563 Bacteria 3220
56 Ga0068857_100005679 3300005577 Bacteria 10665
57 Ga0068857_100144356 3300005577 Bacteria 2153
58 Ga0068854_100059697 3300005578 Bacteria 2757
59 Ga0070702_100018851 3300005615 Bacteria 3587
60 Ga0068866_10000474 3300005718 Bacteria 18425
61 Ga0081538_10000846 3300005981 Bacteria 33031
62 Ga0081538_10039579 3300005981 Bacteria 3022
63 Ga0081540_1014185 3300005983 Bacteria 5123
64 Ga0081539_10000913 3300005985 Bacteria 55913
65 Ga0070717_10094986 3300006028 Bacteria 2523
66 Ga0075365_10015326 3300006038 Bacteria 4635
67 Ga0075365_10056387 3300006038 Bacteria 2611
68 Ga0075364_10027288 3300006051 Bacteria 3646
69 Ga0070712_100054432 3300006175 Bacteria 2797
70 Ga0070712_100116516 3300006175 Unclassified 2004
71 Ga0070712_100265488 3300006175 Unclassified 1377
72 Ga0075362_10013218 3300006177 Bacteria 3300
73 Ga0097621_100002348 3300006237 Bacteria 12972
74 Ga0068871_100039348 3300006358 Bacteria 3783
75 Ga0075433_10033343 3300006852 Bacteria 4414
76 Ga0075434_100364956 3300006871 Archaea 1465
77 Ga0068865_100062646 3300006881 Bacteria 2611
78 Ga0075436_100010280 3300006914 Bacteria 6407
79 Ga0105240_10086663 3300009093 Bacteria 3835
80 Ga0105240_10112447 3300009093 Bacteria 3292
81 Ga0111539_10062098 3300009094 Bacteria 4424
82 Ga0111539_10184236 3300009094 Bacteria 2438
83 Ga0105245_10024026 3300009098 Bacteria 5350
84 Ga0105245_10035371 3300009098 Bacteria 4433
85 Ga0105245_10064769 3300009098 Bacteria 3304
86 Ga0114129_10027574 3300009147 Bacteria 8042
87 Ga0114129_10068401 3300009147 Bacteria 4952
88 Ga0114129_10329242 3300009147 Bacteria 2029
89 Ga0105243_10013509 3300009148 Bacteria 6176
90 Ga0105242_10003264 3300009176 Bacteria 12643
91 Ga0105248_10040580 3300009177 Bacteria 5217
92 Ga0105237_10106093 3300009545 Bacteria 2801
93 Ga0105239_10008816 3300010375 Bacteria 11413
94 Ga0163162_10001280 3300013306 Bacteria 23542
95 Ga0157375_10007650 3300013308 Bacteria 9451
96 Ga0157377_10007182 3300014745 Bacteria 5362
97 Ga0157379_10303381 3300014968 Unclassified 1456
98 Ga0157376_10002558 3300014969 Bacteria 12350
99 Ga0197907_10604797 3300020069 Bacteria 1473
100 Ga0206356_10430776 3300020070 Bacteria 6701
101 Ga0206354_11378013 3300020081 Bacteria 4561
102 Ga0206353_11066294 3300020082 Bacteria 15954
103 Ga0206353_11692961 3300020082 Bacteria 5809
104 Ga0224712_10009633 3300022467 Bacteria 2920
105 Ga0207692_10103552 3300025898 Bacteria 1567
106 Ga0207642_10001359 3300025899 Bacteria 7588
107 Ga0207688_10129903 3300025901 Bacteria 1476
108 Ga0207699_10019398 3300025906 Bacteria 3625
109 Ga0207699_10116013 3300025906 Bacteria 1724
110 Ga0207684_10111516 3300025910 Bacteria 2341
111 Ga0207684_10214120 3300025910 Bacteria 1662
112 Ga0207707_10088996 3300025912 Bacteria 2698
113 Ga0207695_10032943 3300025913 Bacteria 5662
114 Ga0207695_10086833 3300025913 Bacteria 3153
115 Ga0207671_10077978 3300025914 Bacteria 2481
116 Ga0207693_10001256 3300025915 Bacteria 22567
117 Ga0207660_10003185 3300025917 Bacteria 10735
118 Ga0207657_10002716 3300025919 Bacteria 19059
119 Ga0207657_10007538 3300025919 Bacteria 11153
120 Ga0207657_10024800 3300025919 Bacteria 5544
121 Ga0207649_10057187 3300025920 Bacteria 2438
122 Ga0207652_10055264 3300025921 Bacteria 3414
123 Ga0207652_10062126 3300025921 Bacteria 3228
124 Ga0207646_10028151 3300025922 Bacteria 5117
125 Ga0207646_10175931 3300025922 Bacteria 1933
126 Ga0207687_10036993 3300025927 Bacteria 3328
127 Ga0207687_10075624 3300025927 Bacteria 2417
128 Ga0207687_10104624 3300025927 Bacteria 2090
129 Ga0207664_10012279 3300025929 Bacteria 6122
130 Ga0207664_10057270 3300025929 Bacteria 3097
131 Ga0207690_10032297 3300025932 Bacteria 3358
132 Ga0207706_10171985 3300025933 Bacteria 1903
133 Ga0207706_10178665 3300025933 Bacteria 1864
134 Ga0207686_10023753 3300025934 Bacteria 3543
135 Ga0207686_10117481 3300025934 Bacteria 1805
136 Ga0207709_10006615 3300025935 Bacteria 6504
137 Ga0207669_10034971 3300025937 Bacteria 2853
138 Ga0207661_10024742 3300025944 Bacteria 4554
139 Ga0207661_10040860 3300025944 Bacteria 3649
140 Ga0207661_10047355 3300025944 Bacteria 3412
141 Ga0207661_10057140 3300025944 Bacteria 3136
142 Ga0207661_10112651 3300025944 Bacteria 2304
143 Ga0207661_10126149 3300025944 Bacteria 2186
144 Ga0207667_10093361 3300025949 Bacteria 3108
145 Ga0207677_10076264 3300026023 Bacteria 2386
146 Ga0207678_10010658 3300026067 Bacteria 8075
147 Ga0207708_10000515 3300026075 Bacteria 29848
148 Ga0207702_10111481 3300026078 Bacteria 2433
149 Ga0207648_10000705 3300026089 Bacteria 37489
150 Ga0207648_10136565 3300026089 Unclassified 2160
151 Ga0207674_10002109 3300026116 Bacteria 25169
152 Ga0207674_10284463 3300026116 Bacteria 1602
153 Ga0207683_10001271 3300026121 Bacteria 22865
154 Ga0265334_10010067 3300028573 Bacteria 3994
155 Ga0265338_10000938 3300028800 Bacteria 49159
156 Ga0265338_10010639 3300028800 Bacteria 10751
157 Ga0265338_10024499 3300028800 Bacteria 6162
158 Ga0265338_10031578 3300028800 Bacteria 5189
159 Ga0265324_10031517 3300029957 Bacteria 1857
160 Ga0265332_10003599 3300031238 Bacteria 7432
161 Ga0265320_10014260 3300031240 Bacteria 4531
162 Ga0265339_10037907 3300031249 Bacteria 2691
163 Ga0265339_10040105 3300031249 Bacteria 2603
164 Ga0265331_10002404 3300031250 Bacteria 12684
165 Ga0265316_10006452 3300031344 Bacteria 11206
166 Ga0265313_10009887 3300031595 Bacteria 6132
167 Ga0265342_10017864 3300031712 Bacteria 4605
168 Ga0307416_100006354 3300032002 Bacteria 7389
169 Ga0395899_0023756 3300037312 Bacteria 4640
170 Ga0395899_0024733 3300037312 Bacteria 4539
171 Ga0395899_0026211 3300037312 Bacteria 4399
172 Ga0395899_0031682 3300037312 Bacteria 3973
173 Ga0395899_0095440 3300037312 Bacteria 2151
174 Ga0395899_0137846 3300037312 Bacteria 1738
175 Ga0395900_0007182 3300037418 Bacteria 11545
176 Ga0395900_0008154 3300037418 Bacteria 10780
177 Ga0395900_0020594 3300037418 Bacteria 6737
178 Ga0395900_0025558 3300037418 Bacteria 6045
179 Ga0395900_0051643 3300037418 Bacteria 4234
180 Ga0395900_0058349 3300037418 Bacteria 3973
181 Ga0395900_0067670 3300037418 Bacteria 3669
182 Ga0395900_0073910 3300037418 Bacteria 3505
183 Ga0395900_0107410 3300037418 Bacteria 2867
184 Ga0395900_0111499 3300037418 Bacteria 2810
185 Ga0395900_0146999 3300037418 Bacteria 2410
186 Ga0395900_0311505 3300037418 Bacteria 1557
187 Ga0395898_0003473 3300037466 Bacteria 17600
188 Ga0395898_0003692 3300037466 Bacteria 17010
189 Ga0395898_0008254 3300037466 Bacteria 11013
190 Ga0395898_0014685 3300037466 Bacteria 8042
191 Ga0395898_0052941 3300037466 Bacteria 3964
192 Ga0395898_0097203 3300037466 Bacteria 2828
193 Ga0395898_0138282 3300037466 Bacteria 2332
194 Ga0395898_0157346 3300037466 Bacteria 2173
195 Ga0395898_0170077 3300037466 Bacteria 2083
196 Ga0395905_0012584 3300037471 Bacteria 8140
197 Ga0395905_0043129 3300037471 Bacteria 4232
198 Ga0395905_0052037 3300037471 Bacteria 3835
199 Ga0395905_0061384 3300037471 Bacteria 3516
200 Ga0395905_0064308 3300037471 Bacteria 3433
201 Ga0395905_0269235 3300037471 Bacteria 1589
202 Ga0395905_0269822 3300037471 Bacteria 1587
203 Ga0395901_0001042 3300038443 Bacteria 29911
204 Ga0395901_0003539 3300038443 Bacteria 15741
205 Ga0395901_0008988 3300038443 Bacteria 10115
206 Ga0395901_0030047 3300038443 Bacteria 5597
207 Ga0395901_0030847 3300038443 Bacteria 5524
208 Ga0395901_0037939 3300038443 Bacteria 4982
209 Ga0395901_0041857 3300038443 Bacteria 4748
210 Ga0395901_0047913 3300038443 Bacteria 4437
211 Ga0395901_0071096 3300038443 Bacteria 3625
212 Ga0395901_0073189 3300038443 Bacteria 3573
213 Ga0395901_0081648 3300038443 Bacteria 3377
214 Ga0395901_0131176 3300038443 Bacteria 2633
215 Ga0395901_0247181 3300038443 Bacteria 1859
216 Ga0395901_0248894 3300038443 Bacteria 1852
217 Ga0439439_0001287 3300041406 Bacteria 4905
218 Ga0439453_0001093 3300041408 Bacteria 3365
219 Ga0451853_0477976 3300041512 Unclassified 3464
220 Ga0439446_0002399 3300042156 Bacteria 4492
221 Ga0466966_0001800 3300044684 Bacteria 13885
222 Ga0466963_0002492 3300044694 Bacteria 10297
223 Ga0466963_0003311 3300044694 Bacteria 9190
224 Ga0466963_0086538 3300044694 Bacteria 2130
225 Ga0466968_0009681 3300044735 Bacteria 3713
226 Ga0466968_0076170 3300044735 Bacteria 1468
227 Ga0466970_0087174 3300044765 Bacteria 1693
228 Ga0466957_0023296 3300044842 Bacteria 3660
229 Ga0466957_0030815 3300044842 Bacteria 3203
230 Ga0466959_0014044 3300045049 Bacteria 5814
231 Ga0466958_0038576 3300045836 Bacteria 2867
232 Ga0466967_0000829 3300045976 Bacteria 16292
233 Ga0466967_0007361 3300045976 Bacteria 7930
234 Ga0466967_0011471 3300045976 Bacteria 6715
235 Ga0466967_0022129 3300045976 Bacteria 5180
236 Ga0466967_0048337 3300045976 Bacteria 3714
237 Ga0466967_0056902 3300045976 Unclassified 3450
238 Ga0466967_0100938 3300045976 Bacteria 2637
239 Ga0466967_0149505 3300045976 Bacteria 2182
240 Ga0495603_0057905 3300046455 Unclassified 2292
241 Ga0495639_0045108 3300046475 Bacteria 1994
242 Ga0495594_0182625 3300046499 Bacteria 1194
243 Ga0495630_0002755 3300046517 Bacteria 12186
244 Ga0495663_0011763 3300046525 Bacteria 2436
245 Ga0495665_0108548 3300046531 Bacteria 1456
246 Ga0495656_0031958 3300046615 Bacteria 2139
247 Ga0495611_0111111 3300046648 Archaea 1276
248 Ga0495659_0014284 3300046664 Bacteria 2598
249 Ga0495670_0058836 3300046691 Bacteria 1929
250 Ga0495671_0029828 3300046692 Bacteria 2798
251 Ga0495649_0139499 3300046694 Bacteria 1277
252 Ga0495581_0000094 3300047315 Bacteria 36744
253 Ga0495676_0133480 3300047321 Bacteria 1789
254 Ga0495676_0248039 3300047321 Bacteria 1216
255 Ga0496100_0023656 3300048903 Bacteria 3735
256 Ga0496100_0107224 3300048903 Bacteria 1935
257 Ga0496100_0114599 3300048903 Bacteria 1878
258 Ga0496101_0111679 3300048904 Bacteria 2058
259 Ga0496101_0166149 3300048904 Unclassified 1694
260 Ga0496102_0034272 3300048905 Bacteria 4565
261 Ga0496103_0042208 3300048906 Bacteria 2806
262 Ga0496104_0007652 3300048907 Bacteria 9565
263 Ga0496104_0112152 3300048907 Bacteria 2615
264 Ga0496105_0150663 3300048908 Bacteria 1912
265 Ga0496105_0203339 3300048908 Unclassified 1616
266 Ga0496107_0040989 3300048910 Bacteria 3324
267 Ga0496107_0146383 3300048910 Bacteria 1747
268 Ga0496108_0078838 3300048911 Bacteria 2788
269 Ga0496108_0091157 3300048911 Bacteria 2591
270 Ga0496108_0231554 3300048911 Bacteria 1606
271 Ga0496109_0005055 3300048912 Bacteria 11016
272 Ga0496109_0006749 3300048912 Bacteria 9666
273 Ga0496109_0018657 3300048912 Bacteria 6097
274 Ga0496110_0011269 3300048913 Bacteria 7309
275 Ga0496110_0168910 3300048913 Bacteria 1984
276 Ga0496111_0000944 3300048914 Bacteria 15882
277 Ga0496111_0006906 3300048914 Bacteria 7407
278 Ga0496111_0110201 3300048914 Bacteria 2027
279 Ga0496112_0002855 3300048915 Bacteria 14040
280 Ga0496112_0024681 3300048915 Bacteria 5763
281 Ga0496112_0056048 3300048915 Bacteria 3878
282 Ga0496113_0062514 3300048916 Bacteria 2812
283 Ga0496113_0106754 3300048916 Unclassified 2175
284 Ga0496114_0100819 3300048917 Bacteria 2464
285 Ga0496114_0126139 3300048917 Bacteria 2207
286 Ga0496114_0209830 3300048917 Bacteria 1708
287 Ga0496115_0071754 3300048918 Bacteria 2808
288 Ga0501031_0005395 3300049568 Bacteria 8322
289 Ga0501032_0008053 3300049569 Bacteria 7682
290 Ga0501033_0004771 3300049570 Bacteria 10834
291 Ga0501036_0013360 3300049572 Bacteria 6821
292 Ga0501037_0003648 3300049573 Bacteria 11167
293 Ga0501038_0032198 3300049574 Bacteria 4627
294 Ga0501040_0005743 3300049576 Bacteria 8026
295 Ga0501043_0007710 3300049579 Bacteria 8523
296 Ga0501046_0009343 3300049580 Bacteria 8482
297 Ga0501067_0136794 3300049583 Bacteria 1364
298 Ga0501068_0001136 3300049584 Bacteria 14097
299 Ga0501069_0018219 3300049585 Bacteria 3788
300 Ga0501069_0031983 3300049585 Bacteria 2896
301 Ga0501070_0000104 3300049586 Bacteria 74572
302 Ga0501070_0013400 3300049586 Bacteria 6914
303 Ga0501070_0014127 3300049586 Bacteria 6721
304 Ga0501072_0025507 3300049588 Bacteria 4604
305 Ga0501073_0010236 3300049589 Bacteria 6891
306 Ga0501073_0086087 3300049589 Bacteria 2186
307 Ga0501074_0006260 3300049590 Bacteria 8592
308 Ga0501076_0065846 3300049592 Bacteria 2890
309 Ga0501076_0185710 3300049592 Bacteria 1696
310 Ga0501079_0068567 3300049741 Bacteria 2738
311 Ga0501081_0057615 3300049743 Bacteria 2687
312 Ga0501083_0003994 3300049744 Bacteria 10363
313 Ga0501083_0008092 3300049744 Bacteria 7435
314 Ga0501035_0004076 3300049822 Bacteria 13891
315 Ga0501045_0008660 3300049824 Bacteria 7094
316 nmdc:mga05p37_161947_c1 3300050507 Bacteria 2732
317 nmdc:mga05p37_538369_c1 3300050507 Bacteria 1332
318 nmdc:mga05p37_73981_c1 3300050507 Bacteria 4194
319 nmdc:mga0qj67_18971_c1 3300050509 Bacteria 5248
320 nmdc:mga06r32_16761_c1 3300050510 Bacteria 6680
321 nmdc:mga08y16_314930_c1 3300050511 Bacteria 1611
322 nmdc:mga0n895_129239_c1 3300050512 Bacteria 2551
323 nmdc:mga08x19_97859_c1 3300050514 Bacteria 1943
324 Ga0495619_0029325 3300053085 Bacteria 3554
325 Ga0501082_0009794 3300060353 Bacteria 8256
326 Ga0182008_10010554
327 Ga0070658_10003872
328 Ga0070658_10022198
329 Ga0070658_10062679
330 Ga0070683_100000386
331 Ga0070683_100019318
332 Ga0070683_100052401
333 Ga0070683_100110021
334 Ga0070690_100030021
335 Ga0070666_10064553
336 Ga0070660_100003886
337 Ga0070660_100016119
338 Ga0070660_100039676
339 Ga0070689_100032221
340 Ga0070669_100105895
341 Ga0070674_100061653
342 Ga0070688_100021060
343 Ga0070659_100050176
344 Ga0070659_100134419
345 Ga0070709_10040385
346 Ga0070709_10151231
347 Ga0070714_100028207
348 Ga0070714_100034006
349 Ga0070713_100119027
350 Ga0070713_100148084
351 Ga0070713_100236276
352 Ga0070705_100180479
353 Ga0070700_100000793
354 Ga0070708_100124267
355 Ga0070678_100005429
356 Ga0070681_10089451
357 Ga0070681_10175364
358 Ga0070706_100036001
359 Ga0070707_100095394
360 Ga0070707_100120462
361 Ga0070707_100365352
362 Ga0070698_100012630
363 Ga0070698_100015109
364 Ga0070698_100059450
365 Ga0070698_100073541
366 Ga0070698_100219448
367 Ga0070698_100304375
368 Ga0070699_100036702
369 Ga0070679_100066252
370 Ga0070679_100096406
371 Ga0070684_100002479
372 Ga0070684_100019024
373 Ga0070684_100123427
374 Ga0070684_100276299
375 Ga0070686_100012481
376 Ga0070665_100009693
377 Ga0070704_100022731
378 Ga0068855_100008503
379 Ga0068855_100062747
380 Ga0068855_100106630
381 Ga0068857_100005679
382 Ga0068857_100144356
383 Ga0068854_100059697
384 Ga0070702_100018851
385 Ga0068866_10000474
386 Ga0081538_10000846
387 Ga0081538_10039579
388 Ga0081540_1014185
389 Ga0081539_10000913
390 Ga0070717_10094986
391 Ga0075365_10015326
392 Ga0075365_10056387
393 Ga0075364_10027288
394 Ga0070712_100054432
395 Ga0070712_100116516
396 Ga0070712_100265488
397 Ga0075362_10013218
398 Ga0097621_100002348
399 Ga0068871_100039348
400 Ga0075433_10033343
401 Ga0075434_100364956
402 Ga0068865_100062646
403 Ga0075436_100010280
404 Ga0105240_10086663
405 Ga0105240_10112447
406 Ga0111539_10062098
407 Ga0111539_10184236
408 Ga0105245_10024026
409 Ga0105245_10035371
410 Ga0105245_10064769
411 Ga0114129_10027574
412 Ga0114129_10068401
413 Ga0114129_10329242
414 Ga0105243_10013509
415 Ga0105242_10003264
416 Ga0105248_10040580
417 Ga0105237_10106093
418 Ga0105239_10008816
419 Ga0163162_10001280
420 Ga0157375_10007650
421 Ga0157377_10007182
422 Ga0157379_10303381
423 Ga0157376_10002558
424 Ga0197907_10604797
425 Ga0206356_10430776
426 Ga0206354_11378013
427 Ga0206353_11066294
428 Ga0206353_11692961
429 Ga0224712_10009633
430 Ga0207692_10103552
431 Ga0207642_10001359
432 Ga0207688_10129903
433 Ga0207699_10019398
434 Ga0207699_10116013
435 Ga0207684_10111516
436 Ga0207684_10214120
437 Ga0207707_10088996
438 Ga0207695_10032943
439 Ga0207695_10086833
440 Ga0207671_10077978
441 Ga0207693_10001256
442 Ga0207660_10003185
443 Ga0207657_10002716
444 Ga0207657_10007538
445 Ga0207657_10024800
446 Ga0207649_10057187
447 Ga0207652_10055264
448 Ga0207652_10062126
449 Ga0207646_10028151
450 Ga0207646_10175931
451 Ga0207687_10036993
452 Ga0207687_10075624
453 Ga0207687_10104624
454 Ga0207664_10012279
455 Ga0207664_10057270
456 Ga0207690_10032297
457 Ga0207706_10171985
458 Ga0207706_10178665
459 Ga0207686_10023753
460 Ga0207686_10117481
461 Ga0207709_10006615
462 Ga0207669_10034971
463 Ga0207661_10024742
464 Ga0207661_10040860
465 Ga0207661_10047355
466 Ga0207661_10057140
467 Ga0207661_10112651
468 Ga0207661_10126149
469 Ga0207667_10093361
470 Ga0207677_10076264
471 Ga0207678_10010658
472 Ga0207708_10000515
473 Ga0207702_10111481
474 Ga0207648_10000705
475 Ga0207648_10136565
476 Ga0207674_10002109
477 Ga0207674_10284463
478 Ga0207683_10001271
479 Ga0265334_10010067
480 Ga0265338_10000938
481 Ga0265338_10010639
482 Ga0265338_10024499
483 Ga0265338_10031578
484 Ga0265324_10031517
485 Ga0265332_10003599
486 Ga0265320_10014260
487 Ga0265339_10037907
488 Ga0265339_10040105
489 Ga0265331_10002404
490 Ga0265316_10006452
491 Ga0265313_10009887
492 Ga0265342_10017864
493 Ga0307416_100006354
494 Ga0395899_0023756
495 Ga0395899_0024733
496 Ga0395899_0026211
497 Ga0395899_0031682
498 Ga0395899_0095440
499 Ga0395899_0137846
500 Ga0395900_0007182
501 Ga0395900_0008154
502 Ga0395900_0020594
503 Ga0395900_0025558
504 Ga0395900_0051643
505 Ga0395900_0058349
506 Ga0395900_0067670
507 Ga0395900_0073910
508 Ga0395900_0107410
509 Ga0395900_0111499
510 Ga0395900_0146999
511 Ga0395900_0311505
512 Ga0395898_0003473
513 Ga0395898_0003692
514 Ga0395898_0008254
515 Ga0395898_0014685
516 Ga0395898_0052941
517 Ga0395898_0097203
518 Ga0395898_0138282
519 Ga0395898_0157346
520 Ga0395898_0170077
521 Ga0395905_0012584
522 Ga0395905_0043129
523 Ga0395905_0052037
524 Ga0395905_0061384
525 Ga0395905_0064308
526 Ga0395905_0269235
527 Ga0395905_0269822
528 Ga0395901_0001042
529 Ga0395901_0003539
530 Ga0395901_0008988
531 Ga0395901_0030047
532 Ga0395901_0030847
533 Ga0395901_0037939
534 Ga0395901_0041857
535 Ga0395901_0047913
536 Ga0395901_0071096
537 Ga0395901_0073189
538 Ga0395901_0081648
539 Ga0395901_0131176
540 Ga0395901_0247181
541 Ga0395901_0248894
542 Ga0439439_0001287
543 Ga0439453_0001093
544 Ga0451853_0477976
545 Ga0439446_0002399
546 Ga0466966_0001800
547 Ga0466963_0002492
548 Ga0466963_0003311
549 Ga0466963_0086538
550 Ga0466968_0009681
551 Ga0466968_0076170
552 Ga0466970_0087174
553 Ga0466957_0023296
554 Ga0466957_0030815
555 Ga0466959_0014044
556 Ga0466958_0038576
557 Ga0466967_0000829
558 Ga0466967_0007361
559 Ga0466967_0011471
560 Ga0466967_0022129
561 Ga0466967_0048337
562 Ga0466967_0056902
563 Ga0466967_0100938
564 Ga0466967_0149505
565 Ga0495603_0057905
566 Ga0495639_0045108
567 Ga0495594_0182625
568 Ga0495630_0002755
569 Ga0495663_0011763
570 Ga0495665_0108548
571 Ga0495656_0031958
572 Ga0495611_0111111
573 Ga0495659_0014284
574 Ga0495670_0058836
575 Ga0495671_0029828
576 Ga0495649_0139499
577 Ga0495581_0000094
578 Ga0495676_0133480
579 Ga0495676_0248039
580 Ga0496100_0023656
581 Ga0496100_0107224
582 Ga0496100_0114599
583 Ga0496101_0111679
584 Ga0496101_0166149
585 Ga0496102_0034272
586 Ga0496103_0042208
587 Ga0496104_0007652
588 Ga0496104_0112152
589 Ga0496105_0150663
590 Ga0496105_0203339
591 Ga0496107_0040989
592 Ga0496107_0146383
593 Ga0496108_0078838
594 Ga0496108_0091157
595 Ga0496108_0231554
596 Ga0496109_0005055
597 Ga0496109_0006749
598 Ga0496109_0018657
599 Ga0496110_0011269
600 Ga0496110_0168910
601 Ga0496111_0000944
602 Ga0496111_0006906
603 Ga0496111_0110201
604 Ga0496112_0002855
605 Ga0496112_0024681
606 Ga0496112_0056048
607 Ga0496113_0062514
608 Ga0496113_0106754
609 Ga0496114_0100819
610 Ga0496114_0126139
611 Ga0496114_0209830
612 Ga0496115_0071754
613 Ga0501031_0005395
614 Ga0501032_0008053
615 Ga0501033_0004771
616 Ga0501036_0013360
617 Ga0501037_0003648
618 Ga0501038_0032198
619 Ga0501040_0005743
620 Ga0501043_0007710
621 Ga0501046_0009343
622 Ga0501067_0136794
623 Ga0501068_0001136
624 Ga0501069_0018219
625 Ga0501069_0031983
626 Ga0501070_0000104
627 Ga0501070_0013400
628 Ga0501070_0014127
629 Ga0501072_0025507
630 Ga0501073_0010236
631 Ga0501073_0086087
632 Ga0501074_0006260
633 Ga0501076_0065846
634 Ga0501076_0185710
635 Ga0501079_0068567
636 Ga0501081_0057615
637 Ga0501083_0003994
638 Ga0501083_0008092
639 Ga0501035_0004076
640 Ga0501045_0008660
641 nmdc:mga05p37_161947_c1
642 nmdc:mga05p37_538369_c1
643 nmdc:mga05p37_73981_c1
644 nmdc:mga0qj67_18971_c1
645 nmdc:mga06r32_16761_c1
646 nmdc:mga08y16_314930_c1
647 nmdc:mga0n895_129239_c1
648 nmdc:mga08x19_97859_c1
649 Ga0495619_0029325
650 Ga0501082_0009794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

177

402

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5giu-assembly1.cif.gz_A-2 crystal structure of xaa-pro peptidase from deinococcus radiodurans, metal-free active site 0.8766 34 403
3q6d-assembly1.cif.gz_A xaa-pro dipeptidase from bacillus anthracis. 0.8601 34 403
5cdl-assembly1.cif.gz_A proline dipeptidase from deinococcus radiodurans (selenomethionine derivative) 0.8554 34 403
5giq-assembly1.cif.gz_A-2 xaa-pro peptidase from deinococcus radiodurans, zinc bound 0.8548 34 403
2zsg-assembly1.cif.gz_B crystal structure of x-pro aminopeptidase from thermotoga maritima msb8 0.8498 35 405
ID Description Score Start End Superfamily
af_P9WHS7_144_374_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9126 159 406 3.90.230.10
5cdlA02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.904 161 403 3.90.230.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9012 161 407 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8973 161 406 3.90.230.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.8936 161 407 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A538LG34-F1-model_v4 M24 family metallopeptidase 0.9968 214 391 GO:0016787
GO:0046872
AF-A0A538JNH2-F1-model_v4 Aminopeptidase P family protein 0.986 33 408 GO:0004177
GO:0046872
AF-A0A538LG34-F1-model_v4 M24 family metallopeptidase 0.9858 214 391 GO:0016787
GO:0046872
AF-A0A538E7H3-F1-model_v4 Aminopeptidase P family protein 0.9846 279 408 GO:0004177
GO:0046872
AF-A0A538G8D1-F1-model_v4 M24 family metallopeptidase 0.9828 213 408 GO:0016787
GO:0046872

Map