F407818

General Info

Members Datasets Scaffolds Average Seq Length
325 214 325 168

Family's Representative Sequence

Representative Sequence 3300009987|Ga0105030_100129|Ga0105030_1001296
Length 180
Sequence MSRIAKQPVKLPQGVAATIAGDAVTVKGAKGSLTLRIREGVTVSQDGQALQVAVAEGKAATGERIAAAGATRANLANMVAGVSKGFERKLELVGVGYRAAVQGKSLNLTLGFSHPVNFPVPEGISIETPSQTEIVVKGTDRQKVGQVAAVIRGYRPPEPYKGKGVRYAGEKIVMKEGKKK

Samples

Sample ID Description Type Environment
1 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
138 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
139 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
142 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
143 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
144 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
145 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
146 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
208 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
211 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92
Metatranscriptomes 8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 3.38
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000064 3300002704 Bacteria 69949
2 JGI25158J39367_1015521 3300002739 Bacteria 972
3 Ga0058862_10046561 3300004803 Bacteria 3584
4 Ga0070658_10030833 3300005327 Bacteria 4307
5 Ga0070658_10513672 3300005327 Bacteria 1035
6 Ga0070690_100059136 3300005330 Bacteria 2463
7 Ga0068869_100160403 3300005334 Bacteria 1750
8 Ga0070666_10000475 3300005335 Bacteria 24222
9 Ga0070680_100006614 3300005336 Bacteria 8813
10 Ga0070680_100414764 3300005336 Bacteria 1149
11 Ga0068868_100008926 3300005338 Bacteria 7190
12 Ga0070660_100792465 3300005339 Bacteria 797
13 Ga0070689_100038453 3300005340 Bacteria 3661
14 Ga0070689_100994888 3300005340 Bacteria 746
15 Ga0070661_100592593 3300005344 Bacteria 895
16 Ga0070692_10264724 3300005345 Bacteria 1035
17 Ga0070671_100009280 3300005355 Bacteria 7900
18 Ga0070688_100520999 3300005365 Bacteria 900
19 Ga0070667_100016587 3300005367 Bacteria 6095
20 Ga0070714_100039749 3300005435 Bacteria 3961
21 Ga0070714_101266781 3300005435 Bacteria 720
22 Ga0070713_101180096 3300005436 Bacteria 741
23 Ga0070681_10007099 3300005458 Bacteria 10907
24 Ga0070679_100222855 3300005530 Bacteria 1847
25 Ga0070679_100599773 3300005530 Bacteria 1045
26 Ga0070684_100029158 3300005535 Bacteria 4674
27 Ga0070684_100063139 3300005535 Bacteria 3246
28 Ga0070684_100397238 3300005535 Bacteria 1271
29 Ga0070684_101490402 3300005535 Bacteria 637
30 Ga0068853_100031768 3300005539 Bacteria 4468
31 Ga0068853_100057137 3300005539 Bacteria 3366
32 Ga0068853_100886341 3300005539 Bacteria 857
33 Ga0070686_100071632 3300005544 Bacteria 2270
34 Ga0070665_100016297 3300005548 Bacteria 7452
35 Ga0068855_100029685 3300005563 Bacteria 6537
36 Ga0068855_100061581 3300005563 Bacteria 4384
37 Ga0068855_100288384 3300005563 Bacteria 1820
38 Ga0070664_100802748 3300005564 Bacteria 880
39 Ga0068856_100065846 3300005614 Bacteria 3580
40 Ga0068856_100443726 3300005614 Bacteria 1318
41 Ga0068856_100521074 3300005614 Bacteria 1210
42 Ga0068852_100127860 3300005616 Bacteria 2336
43 Ga0068852_100461237 3300005616 Bacteria 1260
44 Ga0068852_100507385 3300005616 Bacteria 1202
45 Ga0068859_100140656 3300005617 Bacteria 2487
46 Ga0068864_100007914 3300005618 Bacteria 8759
47 Ga0068863_100007442 3300005841 Bacteria 10714
48 Ga0068863_100847698 3300005841 Bacteria 913
49 Ga0068858_100007799 3300005842 Bacteria 10334
50 Ga0068858_100097431 3300005842 Bacteria 2742
51 Ga0068858_100973927 3300005842 Bacteria 831
52 Ga0068860_100007128 3300005843 Bacteria 11185
53 Ga0075363_100171901 3300006048 Unclassified 1230
54 Ga0070712_100847905 3300006175 Bacteria 786
55 Ga0075362_10024084 3300006177 Unclassified 2580
56 Ga0097621_100019023 3300006237 Bacteria 5263
57 Ga0097621_100030123 3300006237 Bacteria 4293
58 Ga0068871_100005162 3300006358 Bacteria 9133
59 Ga0097620_100140652 3300006931 Bacteria 2487
60 Ga0075435_100235556 3300007076 Bacteria 1556
61 Ga0105240_10112049 3300009093 Bacteria 3299
62 Ga0105240_10796377 3300009093 Bacteria 1024
63 Ga0105245_10002714 3300009098 Bacteria 15935
64 Ga0105241_10172045 3300009174 Bacteria 1790
65 Ga0105248_10006447 3300009177 Bacteria 12878
66 Ga0105248_11496199 3300009177 Bacteria 764
67 Ga0105237_11006165 3300009545 Bacteria 840
68 Ga0105238_10087095 3300009551 Bacteria 3110
69 Ga0105238_10162918 3300009551 Bacteria 2206
70 Ga0105238_10209399 3300009551 Bacteria 1926
71 Ga0105030_100129 3300009987 Bacteria 5911
72 Ga0157371_10634856 3300013102 Bacteria 796
73 Ga0157370_10281691 3300013104 Bacteria 1536
74 Ga0157369_10006334 3300013105 Bacteria 13736
75 Ga0157369_10089791 3300013105 Bacteria 3281
76 Ga0157369_10167285 3300013105 Bacteria 2318
77 Ga0157374_10009580 3300013296 Bacteria 8319
78 Ga0157374_10869198 3300013296 Bacteria 919
79 Ga0157378_10004652 3300013297 Bacteria 12033
80 Ga0157378_10730860 3300013297 Bacteria 1011
81 Ga0163162_10007547 3300013306 Bacteria 10591
82 Ga0157372_10191231 3300013307 Bacteria 2371
83 Ga0157372_10852237 3300013307 Bacteria 1058
84 Ga0157372_11251189 3300013307 Bacteria 857
85 Ga0157372_11352641 3300013307 Bacteria 821
86 Ga0157372_11678638 3300013307 Bacteria 731
87 Ga0157375_10003225 3300013308 Bacteria 14154
88 Ga0163163_10006629 3300014325 Bacteria 10141
89 Ga0157379_10004489 3300014968 Bacteria 11965
90 Ga0157376_10007741 3300014969 Bacteria 7697
91 Ga0157376_10206712 3300014969 Bacteria 1810
92 Ga0206356_10625632 3300020070 Bacteria 738
93 Ga0207699_10147489 3300025906 Bacteria 1553
94 Ga0207654_10015846 3300025911 Bacteria 3918
95 Ga0207654_10741160 3300025911 Bacteria 707
96 Ga0207707_10005674 3300025912 Bacteria 10922
97 Ga0207707_10017188 3300025912 Bacteria 6305
98 Ga0207707_10048919 3300025912 Bacteria 3684
99 Ga0207695_10031032 3300025913 Bacteria 5872
100 Ga0207671_10761314 3300025914 Bacteria 769
101 Ga0207660_10012754 3300025917 Bacteria 5502
102 Ga0207657_10109580 3300025919 Bacteria 2282
103 Ga0207657_10742970 3300025919 Bacteria 760
104 Ga0207649_10403470 3300025920 Bacteria 1023
105 Ga0207649_10634614 3300025920 Bacteria 824
106 Ga0207652_10178271 3300025921 Bacteria 1909
107 Ga0207652_10229590 3300025921 Bacteria 1673
108 Ga0207652_10871858 3300025921 Bacteria 796
109 Ga0207694_10007098 3300025924 Bacteria 8511
110 Ga0207694_10136119 3300025924 Bacteria 1973
111 Ga0207687_10021057 3300025927 Bacteria 4329
112 Ga0207664_10069623 3300025929 Bacteria 2829
113 Ga0207644_10019396 3300025931 Bacteria 4613
114 Ga0207670_10248150 3300025936 Bacteria 1374
115 Ga0207670_10424519 3300025936 Bacteria 1067
116 Ga0207711_10002222 3300025941 Bacteria 17420
117 Ga0207711_11162939 3300025941 Bacteria 713
118 Ga0207661_10414303 3300025944 Bacteria 1223
119 Ga0207661_10737516 3300025944 Bacteria 906
120 Ga0207679_10539886 3300025945 Bacteria 1045
121 Ga0207667_10175639 3300025949 Bacteria 2201
122 Ga0207667_10246512 3300025949 Bacteria 1828
123 Ga0207667_10324884 3300025949 Bacteria 1571
124 Ga0207658_10005497 3300025986 Bacteria 8688
125 Ga0207677_10298836 3300026023 Bacteria 1329
126 Ga0207703_10009259 3300026035 Bacteria 7745
127 Ga0207703_10071611 3300026035 Bacteria 2864
128 Ga0207703_10859422 3300026035 Bacteria 868
129 Ga0207639_10018858 3300026041 Bacteria 4910
130 Ga0207702_10114437 3300026078 Bacteria 2404
131 Ga0207702_10563087 3300026078 Bacteria 1116
132 Ga0207702_11399815 3300026078 Bacteria 693
133 Ga0207641_10923191 3300026088 Bacteria 867
134 Ga0207648_10052679 3300026089 Bacteria 3558
135 Ga0207676_10015839 3300026095 Bacteria 5452
136 Ga0207698_10018098 3300026142 Bacteria 4794
137 Ga0207698_10516818 3300026142 Bacteria 1164
138 Ga0210000_1009153 3300027462 Bacteria 1456
139 Ga0209970_1003354 3300027614 Bacteria 2696
140 Ga0268266_10011246 3300028379 Bacteria 7790
141 Ga0268266_10179478 3300028379 Bacteria 1927
142 Ga0265326_10007352 3300028558 Bacteria 3381
143 Ga0265319_1002761 3300028563 Bacteria 9412
144 Ga0265334_10001026 3300028573 Bacteria 13760
145 Ga0265318_10000228 3300028577 Bacteria 48687
146 Ga0265338_10016309 3300028800 Bacteria 8091
147 Ga0265330_10004229 3300031235 Bacteria 7321
148 Ga0265332_10001037 3300031238 Bacteria 16333
149 Ga0265328_10002988 3300031239 Bacteria 7548
150 Ga0265328_10003225 3300031239 Bacteria 7230
151 Ga0265320_10004080 3300031240 Bacteria 9592
152 Ga0265325_10005189 3300031241 Bacteria 8094
153 Ga0265329_10001451 3300031242 Bacteria 11427
154 Ga0265340_10013162 3300031247 Bacteria 4354
155 Ga0265339_10014355 3300031249 Bacteria 4775
156 Ga0265331_10004429 3300031250 Bacteria 8774
157 Ga0265331_10018795 3300031250 Bacteria 3575
158 Ga0265316_10013033 3300031344 Bacteria 7415
159 Ga0265316_10381094 3300031344 Bacteria 1017
160 Ga0307509_10243445 3300031507 Bacteria 1589
161 Ga0307408_100538574 3300031548 Bacteria 1028
162 Ga0265313_10001786 3300031595 Bacteria 19657
163 Ga0316575_10082321 3300031665 Bacteria 1299
164 Ga0265314_10005233 3300031711 Bacteria 11760
165 Ga0265342_10002379 3300031712 Bacteria 16291
166 Ga0316576_10000365 3300031727 Bacteria 20446
167 Ga0316576_10019969 3300031727 Bacteria 4599
168 Ga0316576_10027065 3300031727 Bacteria 4028
169 Ga0316576_11006790 3300031727 Bacteria 593
170 Ga0316578_10001214 3300031728 Bacteria 10228
171 Ga0316578_10048128 3300031728 Bacteria 2489
172 Ga0307405_11102582 3300031731 Bacteria 682
173 Ga0316577_10009675 3300031733 Bacteria 5190
174 Ga0316577_10014473 3300031733 Bacteria 4330
175 Ga0316577_10237540 3300031733 Bacteria 1030
176 Ga0316585_10010281 3300032137 Bacteria 2744
177 Ga0316580_10006433 3300032139 Bacteria 3470
178 Ga0316580_10170046 3300032139 Bacteria 670
179 Ga0316593_10002246 3300032168 Bacteria 4524
180 Ga0316593_10006051 3300032168 Bacteria 3241
181 Ga0316593_10054641 3300032168 Bacteria 1355
182 Ga0316593_10145875 3300032168 Bacteria 859
183 Ga0316593_10180076 3300032168 Bacteria 777
184 Ga0316593_10277788 3300032168 Bacteria 631
185 Ga0316593_10280211 3300032168 Bacteria 628
186 Ga0316593_10320956 3300032168 Bacteria 589
187 Ga0316592_1000599 3300033524 Bacteria 5204
188 Ga0316592_1010162 3300033524 Bacteria 1893
189 Ga0316592_1118512 3300033524 Bacteria 614
190 Ga0316586_1000062 3300033527 Bacteria 7865
191 Ga0316586_1031852 3300033527 Bacteria 906
192 Ga0316588_1000372 3300033528 Bacteria 5863
193 Ga0316588_1013215 3300033528 Bacteria 1787
194 Ga0316587_1015512 3300033529 Bacteria 1265
195 Ga0316587_1055591 3300033529 Bacteria 729
196 Ga0316596_1000073 3300033541 Bacteria 11690
197 Ga0316596_1000971 3300033541 Bacteria 5484
198 Ga0316596_1010280 3300033541 Bacteria 2261
199 Ga0316596_1042705 3300033541 Bacteria 1193
200 Ga0316596_1045516 3300033541 Bacteria 1158
201 Ga0316596_1154304 3300033541 Bacteria 631
202 Ga0373934_0267639 3300035086 Bacteria 707
203 Ga0373923_0208710 3300035111 Bacteria 905
204 Ga0373957_0109159 3300035120 Bacteria 1113
205 Ga0373955_0015644 3300035172 Bacteria 3720
206 Ga0316574_0000634 3300035398 Bacteria 14719
207 Ga0316574_0030582 3300035398 Bacteria 3262
208 Ga0316574_0046395 3300035398 Bacteria 2694
209 Ga0316574_0048915 3300035398 Bacteria 2627
210 Ga0373933_0013337 3300035724 Bacteria 4554
211 Ga0373937_0045103 3300036401 Bacteria 4027
212 Ga0316582_0023680 3300036647 Bacteria 3663
213 Ga0316584_0004833 3300036712 Bacteria 8958
214 Ga0316584_0024511 3300036712 Bacteria 4415
215 Ga0395899_0135248 3300037312 Bacteria 1757
216 Ga0395900_0034072 3300037418 Bacteria 5242
217 Ga0395905_0048048 3300037471 Bacteria 3999
218 Ga0395905_1144776 3300037471 Bacteria 681
219 Ga0395901_0033769 3300038443 Bacteria 5283
220 Ga0436365_0834902 3300039437 Bacteria 962
221 Ga0439431_0044958 3300041997 Bacteria 1133
222 Ga0450912_020489 3300042116 Bacteria 636
223 Ga0450920_031409 3300042122 Bacteria 1046
224 Ga0450923_001430 3300042125 Bacteria 3165
225 Ga0450894_008467 3300042131 Bacteria 1331
226 Ga0450902_042788 3300042137 Bacteria 772
227 Ga0450907_010009 3300042146 Bacteria 1573
228 Ga0450910_020518 3300042147 Bacteria 996
229 Ga0450908_001238 3300042184 Bacteria 4953
230 Ga0450918_010126 3300042531 Bacteria 1646
231 Ga0453683_0008756 3300044673 Bacteria 6785
232 Ga0466966_0179930 3300044684 Bacteria 1283
233 Ga0466961_0117869 3300044693 Bacteria 1668
234 Ga0466957_0004472 3300044842 Bacteria 7796
235 Ga0466959_0074108 3300045049 Bacteria 2462
236 Ga0451576_0000741 3300045051 Bacteria 65303
237 Ga0466958_0062229 3300045836 Bacteria 2275
238 Ga0466967_1991628 3300045976 Bacteria 577
239 Ga0495580_0035520 3300046472 Bacteria 3584
240 Ga0495628_0579982 3300046516 Bacteria 803
241 Ga0495668_0708156 3300046616 Bacteria 557
242 Ga0495657_0068194 3300046675 Bacteria 2332
243 Ga0495676_0191206 3300047321 Bacteria 1428
244 Ga0495675_0023639 3300047444 Bacteria 3917
245 Ga0495602_0010959 3300048088 Bacteria 9394
246 Ga0496100_0416929 3300048903 Bacteria 1025
247 Ga0496103_0231869 3300048906 Bacteria 1188
248 Ga0496104_0002304 3300048907 Bacteria 16478
249 Ga0496105_0003295 3300048908 Bacteria 11922
250 Ga0496106_0028039 3300048909 Bacteria 4193
251 Ga0496108_0110732 3300048911 Bacteria 2347
252 Ga0496110_0002136 3300048913 Bacteria 14773
253 Ga0496111_0001868 3300048914 Bacteria 12443
254 Ga0496113_0144538 3300048916 Bacteria 1873
255 Ga0496114_0022428 3300048917 Bacteria 5147
256 Ga0496115_0039076 3300048918 Bacteria 3768
257 Ga0501324_019042 3300049540 Bacteria 691
258 Ga0501033_0049659 3300049570 Bacteria 3114
259 Ga0501034_0193193 3300049571 Bacteria 1997
260 Ga0501034_0808155 3300049571 Bacteria 830
261 Ga0501036_0023621 3300049572 Bacteria 5181
262 Ga0501036_0292578 3300049572 Bacteria 1362
263 Ga0501036_0941853 3300049572 Bacteria 708
264 Ga0501037_0071416 3300049573 Bacteria 2525
265 Ga0501037_0493072 3300049573 Bacteria 832
266 Ga0501038_0015092 3300049574 Bacteria 7031
267 Ga0501039_0021546 3300049575 Bacteria 4943
268 Ga0501040_0024550 3300049576 Bacteria 4045
269 Ga0501041_0001598 3300049577 Bacteria 12636
270 Ga0501041_0074395 3300049577 Bacteria 2087
271 Ga0501042_0001373 3300049578 Bacteria 14288
272 Ga0501043_0144712 3300049579 Bacteria 1861
273 Ga0501046_0015243 3300049580 Bacteria 6464
274 Ga0501047_0122861 3300049581 Bacteria 2477
275 Ga0501047_0814949 3300049581 Bacteria 748
276 Ga0501047_0909087 3300049581 Bacteria 693
277 Ga0501048_0009558 3300049582 Bacteria 7281
278 Ga0501067_0012461 3300049583 Bacteria 4717
279 Ga0501068_0041518 3300049584 Bacteria 2764
280 Ga0501068_0052368 3300049584 Bacteria 2470
281 Ga0501070_0200263 3300049586 Bacteria 1640
282 Ga0501070_0294101 3300049586 Bacteria 1324
283 Ga0501071_0024289 3300049587 Bacteria 4238
284 Ga0501072_0063312 3300049588 Bacteria 2917
285 Ga0501072_0359800 3300049588 Bacteria 1155
286 Ga0501072_0368348 3300049588 Bacteria 1140
287 Ga0501072_0438906 3300049588 Bacteria 1034
288 Ga0501073_0004667 3300049589 Bacteria 10295
289 Ga0501073_0603447 3300049589 Bacteria 758
290 Ga0501075_0015597 3300049591 Bacteria 5453
291 Ga0501075_0324468 3300049591 Bacteria 1173
292 Ga0501076_0004639 3300049592 Bacteria 9791
293 Ga0501076_0371703 3300049592 Bacteria 1175
294 Ga0501077_0007629 3300049593 Bacteria 6677
295 Ga0501077_0025784 3300049593 Bacteria 3730
296 Ga0501077_0076822 3300049593 Bacteria 2115
297 Ga0501079_0006996 3300049741 Bacteria 8503
298 Ga0501079_0098342 3300049741 Bacteria 2268
299 Ga0501079_0224370 3300049741 Bacteria 1468
300 Ga0501079_0306683 3300049741 Bacteria 1242
301 Ga0501080_0000363 3300049742 Bacteria 35077
302 Ga0501081_0006719 3300049743 Bacteria 7480
303 Ga0501083_0032077 3300049744 Bacteria 3604
304 Ga0501035_0123252 3300049822 Bacteria 2264
305 Ga0501035_0215221 3300049822 Bacteria 1642
306 Ga0501044_0152338 3300049823 Bacteria 2294
307 Ga0501045_0008747 3300049824 Bacteria 7062
308 nmdc:mga0rr50_254190_c1 3300050513 Bacteria 1460
309 Ga0500583_0003293 3300053092 Bacteria 5049
310 Ga0500641_0033188 3300053096 Bacteria 2047
311 Ga0500556_0039996 3300053104 Bacteria 1646
312 Ga0500617_002715 3300053124 Bacteria 6145
313 Ga0500627_0047785 3300053158 Bacteria 1858
314 Ga0500633_0065779 3300053160 Bacteria 1285
315 Ga0500645_197976 3300053730 Bacteria 542
316 Ga0500656_000359 3300053732 Bacteria 3268
317 Ga0501084_0008704 3300054114 Bacteria 8394
318 Ga0501082_0004231 3300060353 Bacteria 12537
319 Ga0501082_0021322 3300060353 Bacteria 5589
320 Ga0501082_0260699 3300060353 Bacteria 1508
321 Ga0501082_0752812 3300060353 Bacteria 853
322 Ga0501082_0925391 3300060353 Bacteria 762
323 Ga0530510_0007174 3300061734 Bacteria 7756
324 Ga0530510_0201997 3300061734 Bacteria 1476
325 Ga0530510_0214206 3300061734 Bacteria 1431

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042116 Ga0450912_020489 Ga0450912_020489_30_569 145
2 3300027462 Ga0210000_1009153 Ga0210000_10091533 147
3 3300027614 Ga0209970_1003354 Ga0209970_10033543 147
4 3300039437 Ga0436365_0834902 Ga0436365_0834902_42_551 147
5 3300049592 Ga0501076_0371703 Ga0501076_0371703_567_1106 147
6 3300031239 Ga0265328_10003225 Ga0265328_100032259 148
7 3300031344 Ga0265316_10381094 Ga0265316_103810942 148
8 3300031731 Ga0307405_11102582 Ga0307405_111025822 148
9 3300042137 Ga0450902_042788 Ga0450902_042788_271_762 149
10 3300049593 Ga0501077_0076822 Ga0501077_0076822_1391_1930 149
11 3300060353 Ga0501082_0752812 Ga0501082_0752812_286_825 149
12 3300041997 Ga0439431_0044958 Ga0439431_0044958_446_985 151
13 3300028558 Ga0265326_10007352 Ga0265326_100073526 152
14 3300028563 Ga0265319_1002761 Ga0265319_10027616 152
15 3300028573 Ga0265334_10001026 Ga0265334_1000102618 152
16 3300028577 Ga0265318_10000228 Ga0265318_1000022826 152
17 3300028800 Ga0265338_10016309 Ga0265338_1001630916 152
18 3300031235 Ga0265330_10004229 Ga0265330_1000422912 152
19 3300031238 Ga0265332_10001037 Ga0265332_1000103714 152
20 3300031239 Ga0265328_10002988 Ga0265328_100029887 152
21 3300031240 Ga0265320_10004080 Ga0265320_1000408010 152
22 3300031241 Ga0265325_10005189 Ga0265325_100051899 152
23 3300031242 Ga0265329_10001451 Ga0265329_1000145110 152
24 3300031247 Ga0265340_10013162 Ga0265340_100131625 152
25 3300031249 Ga0265339_10014355 Ga0265339_100143554 152
26 3300031250 Ga0265331_10004429 Ga0265331_100044297 152
27 3300031344 Ga0265316_10013033 Ga0265316_1001303316 152
28 3300031595 Ga0265313_10001786 Ga0265313_1000178616 152
29 3300031711 Ga0265314_10005233 Ga0265314_100052338 152
30 3300031712 Ga0265342_10002379 Ga0265342_1000237913 152
31 3300037471 Ga0395905_1144776 Ga0395905_1144776_207_665 152
32 3300042131 Ga0450894_008467 Ga0450894_008467_767_1306 152
33 3300045051 Ga0451576_0000741 Ga0451576_0000741_36743_37276 152
34 3300049581 Ga0501047_0814949 Ga0501047_0814949_216_728 152
35 3300049586 Ga0501070_0294101 Ga0501070_0294101_675_1214 153
36 3300026035 Ga0207703_10071611 Ga0207703_100716112 154
37 3300031665 Ga0316575_10082321 Ga0316575_100823213 154
38 3300035398 Ga0316574_0000634 Ga0316574_0000634_10763_11296 154
39 3300035398 Ga0316574_0046395 Ga0316574_0046395_1443_1976 154
40 3300047321 Ga0495676_0191206 Ga0495676_0191206_17_481 154
41 3300049570 Ga0501033_0049659 Ga0501033_0049659_1832_2365 156
42 3300049571 Ga0501034_0808155 Ga0501034_0808155_254_787 156
43 3300049572 Ga0501036_0023621 Ga0501036_0023621_1834_2367 156
44 3300049573 Ga0501037_0071416 Ga0501037_0071416_764_1297 156
45 3300049574 Ga0501038_0015092 Ga0501038_0015092_3420_3953 156
46 3300049575 Ga0501039_0021546 Ga0501039_0021546_3258_3791 156
47 3300049576 Ga0501040_0024550 Ga0501040_0024550_3156_3689 156
48 3300049577 Ga0501041_0001598 Ga0501041_0001598_3059_3592 156
49 3300049578 Ga0501042_0001373 Ga0501042_0001373_5816_6349 156
50 3300049579 Ga0501043_0144712 Ga0501043_0144712_1068_1601 156
51 3300049580 Ga0501046_0015243 Ga0501046_0015243_3739_4272 156
52 3300049582 Ga0501048_0009558 Ga0501048_0009558_1944_2477 156
53 3300049584 Ga0501068_0041518 Ga0501068_0041518_1275_1808 156
54 3300049587 Ga0501071_0024289 Ga0501071_0024289_271_804 156
55 3300049588 Ga0501072_0063312 Ga0501072_0063312_1273_1806 156
56 3300049591 Ga0501075_0015597 Ga0501075_0015597_3677_4210 156
57 3300049592 Ga0501076_0004639 Ga0501076_0004639_4912_5445 156
58 3300049593 Ga0501077_0007629 Ga0501077_0007629_3460_3993 156
59 3300049741 Ga0501079_0006996 Ga0501079_0006996_1483_2016 156
60 3300049743 Ga0501081_0006719 Ga0501081_0006719_3800_4333 156
61 3300049744 Ga0501083_0032077 Ga0501083_0032077_1942_2475 156
62 3300049822 Ga0501035_0215221 Ga0501035_0215221_45_578 156
63 3300049824 Ga0501045_0008747 Ga0501045_0008747_3147_3680 156
64 3300054114 Ga0501084_0008704 Ga0501084_0008704_378_911 156
65 3300060353 Ga0501082_0004231 Ga0501082_0004231_9235_9768 156
66 3300061734 Ga0530510_0007174 Ga0530510_0007174_3444_3977 156
67 3300004803 Ga0058862_10046561 Ga0058862_100465616 157
68 3300005330 Ga0070690_100059136 Ga0070690_1000591362 157
69 3300005334 Ga0068869_100160403 Ga0068869_1001604034 157
70 3300005335 Ga0070666_10000475 Ga0070666_1000047513 157
71 3300005336 Ga0070680_100006614 Ga0070680_1000066143 157
72 3300005338 Ga0068868_100008926 Ga0068868_10000892610 157
73 3300005340 Ga0070689_100038453 Ga0070689_1000384536 157
74 3300005355 Ga0070671_100009280 Ga0070671_1000092805 157
75 3300005367 Ga0070667_100016587 Ga0070667_1000165879 157
76 3300005535 Ga0070684_100063139 Ga0070684_1000631399 157
77 3300005539 Ga0068853_100886341 Ga0068853_1008863412 157
78 3300005544 Ga0070686_100071632 Ga0070686_1000716325 157
79 3300005548 Ga0070665_100016297 Ga0070665_1000162979 157
80 3300005564 Ga0070664_100802748 Ga0070664_1008027482 157
81 3300005614 Ga0068856_100443726 Ga0068856_1004437262 157
82 3300005617 Ga0068859_100140656 Ga0068859_1001406562 157
83 3300005618 Ga0068864_100007914 Ga0068864_10000791418 157
84 3300005841 Ga0068863_100007442 Ga0068863_1000074426 157
85 3300005842 Ga0068858_100007799 Ga0068858_10000779913 157
86 3300005843 Ga0068860_100007128 Ga0068860_10000712813 157
87 3300006237 Ga0097621_100019023 Ga0097621_1000190236 157
88 3300006358 Ga0068871_100005162 Ga0068871_10000516213 157
89 3300006931 Ga0097620_100140652 Ga0097620_1001406525 157
90 3300009093 Ga0105240_10796377 Ga0105240_107963771 157
91 3300009098 Ga0105245_10002714 Ga0105245_1000271418 157
92 3300009177 Ga0105248_10006447 Ga0105248_1000644718 157
93 3300013105 Ga0157369_10089791 Ga0157369_100897916 157
94 3300013296 Ga0157374_10009580 Ga0157374_100095801 157
95 3300013297 Ga0157378_10004652 Ga0157378_100046529 157
96 3300013306 Ga0163162_10007547 Ga0163162_1000754718 157
97 3300013307 Ga0157372_11251189 Ga0157372_112511892 157
98 3300013308 Ga0157375_10003225 Ga0157375_1000322518 157
99 3300014325 Ga0163163_10006629 Ga0163163_1000662917 157
100 3300014968 Ga0157379_10004489 Ga0157379_1000448913 157
101 3300014969 Ga0157376_10007741 Ga0157376_1000774110 157
102 3300025906 Ga0207699_10147489 Ga0207699_101474892 157
103 3300025912 Ga0207707_10048919 Ga0207707_100489196 157
104 3300025917 Ga0207660_10012754 Ga0207660_100127549 157
105 3300025927 Ga0207687_10021057 Ga0207687_100210574 157
106 3300025931 Ga0207644_10019396 Ga0207644_100193966 157
107 3300025936 Ga0207670_10248150 Ga0207670_102481502 157
108 3300025941 Ga0207711_10002222 Ga0207711_1000222218 157
109 3300025986 Ga0207658_10005497 Ga0207658_1000549712 157
110 3300026023 Ga0207677_10298836 Ga0207677_102988363 157
111 3300026035 Ga0207703_10009259 Ga0207703_100092596 157
112 3300026089 Ga0207648_10052679 Ga0207648_100526794 157
113 3300026095 Ga0207676_10015839 Ga0207676_100158397 157
114 3300028379 Ga0268266_10011246 Ga0268266_100112462 157
115 3300031548 Ga0307408_100538574 Ga0307408_1005385742 157
116 3300048903 Ga0496100_0416929 Ga0496100_0416929_343_873 157
117 3300048906 Ga0496103_0231869 Ga0496103_0231869_217_747 157
118 3300048907 Ga0496104_0002304 Ga0496104_0002304_8207_8737 157
119 3300048908 Ga0496105_0003295 Ga0496105_0003295_8207_8737 157
120 3300048909 Ga0496106_0028039 Ga0496106_0028039_3075_3605 157
121 3300048911 Ga0496108_0110732 Ga0496108_0110732_1127_1657 157
122 3300048913 Ga0496110_0002136 Ga0496110_0002136_13681_14211 157
123 3300048914 Ga0496111_0001868 Ga0496111_0001868_10787_11317 157
124 3300048916 Ga0496113_0144538 Ga0496113_0144538_1021_1551 157
125 3300048917 Ga0496114_0022428 Ga0496114_0022428_1607_2137 157
126 3300005344 Ga0070661_100592593 Ga0070661_1005925931 158
127 3300025920 Ga0207649_10403470 Ga0207649_104034702 158
128 3300005340 Ga0070689_100994888 Ga0070689_1009948881 159
129 3300005365 Ga0070688_100520999 Ga0070688_1005209992 159
130 3300005841 Ga0068863_100847698 Ga0068863_1008476982 159
131 3300005842 Ga0068858_100097431 Ga0068858_1000974316 159
132 3300025936 Ga0207670_10424519 Ga0207670_104245192 159
133 3300026088 Ga0207641_10923191 Ga0207641_109231912 159
134 3300049540 Ga0501324_019042 Ga0501324_019042_63_578 159
135 3300053730 Ga0500645_197976 Ga0500645_197976_20_499 159
136 3300045976 Ga0466967_1991628 Ga0466967_1991628_75_563 162
137 3300005614 Ga0068856_100521074 Ga0068856_1005210743 163
138 3300009551 Ga0105238_10209399 Ga0105238_102093992 163
139 3300025912 Ga0207707_10017188 Ga0207707_100171883 163
140 3300025921 Ga0207652_10229590 Ga0207652_102295903 163
141 3300049581 Ga0501047_0909087 Ga0501047_0909087_176_667 163
142 3300006237 Ga0097621_100030123 Ga0097621_10003012310 167
143 3300049572 Ga0501036_0941853 Ga0501036_0941853_183_686 167
144 3300060353 Ga0501082_0260699 Ga0501082_0260699_261_794 167
145 3300006177 Ga0075362_10024084 Ga0075362_100240842 169
146 3300032168 Ga0316593_10002246 Ga0316593_100022466 169
147 3300049588 Ga0501072_0359800 Ga0501072_0359800_550_1089 169
148 3300042122 Ga0450920_031409 Ga0450920_031409_12_533 171
149 3300031507 Ga0307509_10243445 Ga0307509_102434453 175
150 3300032168 Ga0316593_10180076 Ga0316593_101800762 175
151 3300033541 Ga0316596_1042705 Ga0316596_10427053 175
152 3300046616 Ga0495668_0708156 Ga0495668_0708156_16_543 175
153 3300049823 Ga0501044_0152338 Ga0501044_0152338_586_1113 175
154 3300053092 Ga0500583_0003293 Ga0500583_0003293_1880_2407 175
155 3300053096 Ga0500641_0033188 Ga0500641_0033188_707_1234 175
156 3300053104 Ga0500556_0039996 Ga0500556_0039996_415_942 175
157 3300053124 Ga0500617_002715 Ga0500617_002715_633_1160 175
158 3300053158 Ga0500627_0047785 Ga0500627_0047785_977_1504 175
159 3300053160 Ga0500633_0065779 Ga0500633_0065779_351_878 175
160 3300053732 Ga0500656_000359 Ga0500656_000359_1180_1707 175
161 3300031250 Ga0265331_10018795 Ga0265331_100187955 176
162 3300032168 Ga0316593_10145875 Ga0316593_101458752 176
163 3300033529 Ga0316587_1015512 Ga0316587_10155122 176
164 3300035086 Ga0373934_0267639 Ga0373934_0267639_26_556 176
165 3300035111 Ga0373923_0208710 Ga0373923_0208710_362_892 176
166 3300035120 Ga0373957_0109159 Ga0373957_0109159_33_563 176
167 3300035172 Ga0373955_0015644 Ga0373955_0015644_1899_2429 176
168 3300035398 Ga0316574_0048915 Ga0316574_0048915_614_1144 176
169 3300035724 Ga0373933_0013337 Ga0373933_0013337_3920_4450 176
170 3300036401 Ga0373937_0045103 Ga0373937_0045103_2119_2649 176
171 3300046472 Ga0495580_0035520 Ga0495580_0035520_2205_2735 176
172 3300046516 Ga0495628_0579982 Ga0495628_0579982_22_552 176
173 3300046675 Ga0495657_0068194 Ga0495657_0068194_707_1237 176
174 3300047444 Ga0495675_0023639 Ga0495675_0023639_1104_1634 176
175 3300048088 Ga0495602_0010959 Ga0495602_0010959_6707_7237 176
176 3300048918 Ga0496115_0039076 Ga0496115_0039076_1270_1803 176
177 3300049589 Ga0501073_0603447 Ga0501073_0603447_127_657 176
178 3300002704 JGI25155J39150_1000064 JGI25155J39150_100006458 177
179 3300002739 JGI25158J39367_1015521 JGI25158J39367_10155212 177
180 3300005327 Ga0070658_10030833 Ga0070658_100308338 177
181 3300005327 Ga0070658_10513672 Ga0070658_105136722 177
182 3300005336 Ga0070680_100414764 Ga0070680_1004147641 177
183 3300005339 Ga0070660_100792465 Ga0070660_1007924652 177
184 3300005345 Ga0070692_10264724 Ga0070692_102647242 177
185 3300005435 Ga0070714_100039749 Ga0070714_1000397495 177
186 3300005435 Ga0070714_101266781 Ga0070714_1012667811 177
187 3300005436 Ga0070713_101180096 Ga0070713_1011800961 177
188 3300005458 Ga0070681_10007099 Ga0070681_1000709911 177
189 3300005530 Ga0070679_100222855 Ga0070679_1002228554 177
190 3300005530 Ga0070679_100599773 Ga0070679_1005997732 177
191 3300005535 Ga0070684_100029158 Ga0070684_1000291589 177
192 3300005535 Ga0070684_100397238 Ga0070684_1003972381 177
193 3300005535 Ga0070684_101490402 Ga0070684_1014904021 177
194 3300005539 Ga0068853_100031768 Ga0068853_1000317685 177
195 3300005539 Ga0068853_100057137 Ga0068853_1000571376 177
196 3300005563 Ga0068855_100029685 Ga0068855_10002968510 177
197 3300005563 Ga0068855_100061581 Ga0068855_1000615818 177
198 3300005563 Ga0068855_100288384 Ga0068855_1002883843 177
199 3300005614 Ga0068856_100065846 Ga0068856_1000658464 177
200 3300005616 Ga0068852_100127860 Ga0068852_1001278603 177
201 3300005616 Ga0068852_100461237 Ga0068852_1004612373 177
202 3300005616 Ga0068852_100507385 Ga0068852_1005073852 177
203 3300005842 Ga0068858_100973927 Ga0068858_1009739272 177
204 3300006048 Ga0075363_100171901 Ga0075363_1001719013 177
205 3300006175 Ga0070712_100847905 Ga0070712_1008479052 177
206 3300007076 Ga0075435_100235556 Ga0075435_1002355562 177
207 3300009093 Ga0105240_10112049 Ga0105240_101120491 177
208 3300009174 Ga0105241_10172045 Ga0105241_101720454 177
209 3300009177 Ga0105248_11496199 Ga0105248_114961992 177
210 3300009545 Ga0105237_11006165 Ga0105237_110061652 177
211 3300009551 Ga0105238_10087095 Ga0105238_100870956 177
212 3300009551 Ga0105238_10162918 Ga0105238_101629183 177
213 3300009987 Ga0105030_100129 Ga0105030_1001296 177
214 3300013102 Ga0157371_10634856 Ga0157371_106348561 177
215 3300013104 Ga0157370_10281691 Ga0157370_102816913 177
216 3300013105 Ga0157369_10006334 Ga0157369_1000633417 177
217 3300013105 Ga0157369_10167285 Ga0157369_101672853 177
218 3300013296 Ga0157374_10869198 Ga0157374_108691982 177
219 3300013297 Ga0157378_10730860 Ga0157378_107308602 177
220 3300013307 Ga0157372_10191231 Ga0157372_101912314 177
221 3300013307 Ga0157372_10852237 Ga0157372_108522372 177
222 3300013307 Ga0157372_11352641 Ga0157372_113526412 177
223 3300013307 Ga0157372_11678638 Ga0157372_116786382 177
224 3300014969 Ga0157376_10206712 Ga0157376_102067122 177
225 3300020070 Ga0206356_10625632 Ga0206356_106256322 177
226 3300025911 Ga0207654_10015846 Ga0207654_100158465 177
227 3300025911 Ga0207654_10741160 Ga0207654_107411601 177
228 3300025912 Ga0207707_10005674 Ga0207707_1000567418 177
229 3300025913 Ga0207695_10031032 Ga0207695_100310322 177
230 3300025914 Ga0207671_10761314 Ga0207671_107613141 177
231 3300025919 Ga0207657_10109580 Ga0207657_101095801 177
232 3300025919 Ga0207657_10742970 Ga0207657_107429702 177
233 3300025920 Ga0207649_10634614 Ga0207649_106346142 177
234 3300025921 Ga0207652_10178271 Ga0207652_101782713 177
235 3300025921 Ga0207652_10871858 Ga0207652_108718581 177
236 3300025924 Ga0207694_10007098 Ga0207694_1000709816 177
237 3300025924 Ga0207694_10136119 Ga0207694_101361193 177
238 3300025929 Ga0207664_10069623 Ga0207664_100696235 177
239 3300025941 Ga0207711_11162939 Ga0207711_111629392 177
240 3300025944 Ga0207661_10414303 Ga0207661_104143032 177
241 3300025944 Ga0207661_10737516 Ga0207661_107375162 177
242 3300025945 Ga0207679_10539886 Ga0207679_105398862 177
243 3300025949 Ga0207667_10175639 Ga0207667_101756392 177
244 3300025949 Ga0207667_10246512 Ga0207667_102465123 177
245 3300025949 Ga0207667_10324884 Ga0207667_103248842 177
246 3300026035 Ga0207703_10859422 Ga0207703_108594222 177
247 3300026041 Ga0207639_10018858 Ga0207639_1001885810 177
248 3300026078 Ga0207702_10114437 Ga0207702_101144376 177
249 3300026078 Ga0207702_10563087 Ga0207702_105630873 177
250 3300026078 Ga0207702_11399815 Ga0207702_113998152 177
251 3300026142 Ga0207698_10018098 Ga0207698_100180982 177
252 3300026142 Ga0207698_10516818 Ga0207698_105168182 177
253 3300028379 Ga0268266_10179478 Ga0268266_101794783 177
254 3300031727 Ga0316576_10000365 Ga0316576_1000036514 177
255 3300031727 Ga0316576_10019969 Ga0316576_100199694 177
256 3300031727 Ga0316576_10027065 Ga0316576_100270652 177
257 3300031727 Ga0316576_11006790 Ga0316576_110067901 177
258 3300031728 Ga0316578_10001214 Ga0316578_100012146 177
259 3300031728 Ga0316578_10048128 Ga0316578_100481283 177
260 3300031733 Ga0316577_10009675 Ga0316577_1000967510 177
261 3300031733 Ga0316577_10014473 Ga0316577_100144731 177
262 3300031733 Ga0316577_10237540 Ga0316577_102375402 177
263 3300032137 Ga0316585_10010281 Ga0316585_100102815 177
264 3300032139 Ga0316580_10006433 Ga0316580_100064332 177
265 3300032139 Ga0316580_10170046 Ga0316580_101700461 177
266 3300032168 Ga0316593_10006051 Ga0316593_100060512 177
267 3300032168 Ga0316593_10054641 Ga0316593_100546411 177
268 3300032168 Ga0316593_10277788 Ga0316593_102777881 177
269 3300032168 Ga0316593_10280211 Ga0316593_102802111 177
270 3300032168 Ga0316593_10320956 Ga0316593_103209561 177
271 3300033524 Ga0316592_1000599 Ga0316592_10005996 177
272 3300033524 Ga0316592_1010162 Ga0316592_10101624 177
273 3300033524 Ga0316592_1118512 Ga0316592_11185121 177
274 3300033527 Ga0316586_1000062 Ga0316586_10000624 177
275 3300033527 Ga0316586_1031852 Ga0316586_10318522 177
276 3300033528 Ga0316588_1000372 Ga0316588_10003729 177
277 3300033528 Ga0316588_1013215 Ga0316588_10132152 177
278 3300033529 Ga0316587_1055591 Ga0316587_10555911 177
279 3300033541 Ga0316596_1000073 Ga0316596_100007312 177
280 3300033541 Ga0316596_1000971 Ga0316596_100097113 177
281 3300033541 Ga0316596_1010280 Ga0316596_10102803 177
282 3300033541 Ga0316596_1045516 Ga0316596_10455162 177
283 3300033541 Ga0316596_1154304 Ga0316596_11543041 177
284 3300035398 Ga0316574_0030582 Ga0316574_0030582_412_945 177
285 3300036647 Ga0316582_0023680 Ga0316582_0023680_936_1469 177
286 3300036712 Ga0316584_0004833 Ga0316584_0004833_4928_5461 177
287 3300036712 Ga0316584_0024511 Ga0316584_0024511_1352_1885 177
288 3300037312 Ga0395899_0135248 Ga0395899_0135248_894_1427 177
289 3300037418 Ga0395900_0034072 Ga0395900_0034072_2069_2602 177
290 3300037471 Ga0395905_0048048 Ga0395905_0048048_2022_2555 177
291 3300038443 Ga0395901_0033769 Ga0395901_0033769_2090_2623 177
292 3300042125 Ga0450923_001430 Ga0450923_001430_1812_2351 177
293 3300042146 Ga0450907_010009 Ga0450907_010009_526_1065 177
294 3300042147 Ga0450910_020518 Ga0450910_020518_260_799 177
295 3300042184 Ga0450908_001238 Ga0450908_001238_2853_3392 177
296 3300042531 Ga0450918_010126 Ga0450918_010126_1016_1555 177
297 3300044673 Ga0453683_0008756 Ga0453683_0008756_3760_4293 177
298 3300044684 Ga0466966_0179930 Ga0466966_0179930_231_764 177
299 3300044693 Ga0466961_0117869 Ga0466961_0117869_724_1257 177
300 3300044842 Ga0466957_0004472 Ga0466957_0004472_538_1071 177
301 3300045049 Ga0466959_0074108 Ga0466959_0074108_126_659 177
302 3300045836 Ga0466958_0062229 Ga0466958_0062229_693_1226 177
303 3300049571 Ga0501034_0193193 Ga0501034_0193193_433_966 177
304 3300049572 Ga0501036_0292578 Ga0501036_0292578_545_1084 177
305 3300049573 Ga0501037_0493072 Ga0501037_0493072_230_769 177
306 3300049577 Ga0501041_0074395 Ga0501041_0074395_1345_1884 177
307 3300049581 Ga0501047_0122861 Ga0501047_0122861_140_673 177
308 3300049583 Ga0501067_0012461 Ga0501067_0012461_2873_3415 177
309 3300049584 Ga0501068_0052368 Ga0501068_0052368_797_1339 177
310 3300049586 Ga0501070_0200263 Ga0501070_0200263_972_1505 177
311 3300049588 Ga0501072_0368348 Ga0501072_0368348_80_619 177
312 3300049588 Ga0501072_0438906 Ga0501072_0438906_431_970 177
313 3300049589 Ga0501073_0004667 Ga0501073_0004667_229_771 177
314 3300049591 Ga0501075_0324468 Ga0501075_0324468_499_1038 177
315 3300049593 Ga0501077_0025784 Ga0501077_0025784_1679_2221 177
316 3300049741 Ga0501079_0098342 Ga0501079_0098342_100_639 177
317 3300049741 Ga0501079_0224370 Ga0501079_0224370_499_1038 177
318 3300049741 Ga0501079_0306683 Ga0501079_0306683_548_1090 177
319 3300049742 Ga0501080_0000363 Ga0501080_0000363_912_1454 177
320 3300049822 Ga0501035_0123252 Ga0501035_0123252_17_550 177
321 3300050513 nmdc:mga0rr50_254190_c1 nmdc:mga0rr50_254190_c1_606_1139 177
322 3300060353 Ga0501082_0021322 Ga0501082_0021322_1011_1553 177
323 3300060353 Ga0501082_0925391 Ga0501082_0925391_13_552 177
324 3300061734 Ga0530510_0201997 Ga0530510_0201997_234_773 177
325 3300061734 Ga0530510_0214206 Ga0530510_0214206_279_818 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

93

168

0.99

PF00347

Ribosomal_L6

Ribosomal protein L6

11

85

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9335 9 164
6yef-assembly1.cif.gz_H 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9259 9 165
4v9b-assembly1.cif.gz_BH crystal structure of the 70s ribosome with tigecycline. 0.9245 2 166
3j3w-assembly1.cif.gz_G atomic model of the immature 50s subunit from bacillus subtilis (state ii-a) 0.9172 10 166
6ppk-assembly1.cif.gz_G rbga+45srbga complex 0.9107 59 165
ID Description Score Start End Superfamily
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9539 3 82 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.943 1 82 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9321 1 82 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9316 3 82 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9286 2 79 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A352Q4J4-F1-model_v4 50S ribosomal protein L6 0.9848 1 149 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A4P9I807-F1-model_v4 50S ribosomal protein L6 0.9833 9 149 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2G4DSX9-F1-model_v4 50S ribosomal protein L6 0.9806 1 148 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A7R9FV03-F1-model_v4 Large ribosomal subunit protein uL6 (60S ribosomal protein L9) 0.9796 1 139 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A353YAL1-F1-model_v4 50S ribosomal protein L6 0.9782 1 98 GO:0002181
GO:0003735
GO:0019843
GO:0022625

Feature Viewer

pLDDT pTM Quality
86.11 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map