F407818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 214 | 325 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300009987|Ga0105030_100129|Ga0105030_1001296 |
| Length | 180 |
| Sequence | MSRIAKQPVKLPQGVAATIAGDAVTVKGAKGSLTLRIREGVTVSQDGQALQVAVAEGKAATGERIAAAGATRANLANMVAGVSKGFERKLELVGVGYRAAVQGKSLNLTLGFSHPVNFPVPEGISIETPSQTEIVVKGTDRQKVGQVAAVIRGYRPPEPYKGKGVRYAGEKIVMKEGKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 91 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 93 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 99 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 100 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 101 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 109 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 115 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 116 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 117 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 126 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 131 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 138 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 139 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 140 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 141 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 142 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 143 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 144 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 145 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 146 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 147 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 205 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 207 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 208 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 210 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92 |
| Metatranscriptomes | 8 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.38 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 92.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000064 | 3300002704 | Bacteria | 69949 |
| 2 | JGI25158J39367_1015521 | 3300002739 | Bacteria | 972 |
| 3 | Ga0058862_10046561 | 3300004803 | Bacteria | 3584 |
| 4 | Ga0070658_10030833 | 3300005327 | Bacteria | 4307 |
| 5 | Ga0070658_10513672 | 3300005327 | Bacteria | 1035 |
| 6 | Ga0070690_100059136 | 3300005330 | Bacteria | 2463 |
| 7 | Ga0068869_100160403 | 3300005334 | Bacteria | 1750 |
| 8 | Ga0070666_10000475 | 3300005335 | Bacteria | 24222 |
| 9 | Ga0070680_100006614 | 3300005336 | Bacteria | 8813 |
| 10 | Ga0070680_100414764 | 3300005336 | Bacteria | 1149 |
| 11 | Ga0068868_100008926 | 3300005338 | Bacteria | 7190 |
| 12 | Ga0070660_100792465 | 3300005339 | Bacteria | 797 |
| 13 | Ga0070689_100038453 | 3300005340 | Bacteria | 3661 |
| 14 | Ga0070689_100994888 | 3300005340 | Bacteria | 746 |
| 15 | Ga0070661_100592593 | 3300005344 | Bacteria | 895 |
| 16 | Ga0070692_10264724 | 3300005345 | Bacteria | 1035 |
| 17 | Ga0070671_100009280 | 3300005355 | Bacteria | 7900 |
| 18 | Ga0070688_100520999 | 3300005365 | Bacteria | 900 |
| 19 | Ga0070667_100016587 | 3300005367 | Bacteria | 6095 |
| 20 | Ga0070714_100039749 | 3300005435 | Bacteria | 3961 |
| 21 | Ga0070714_101266781 | 3300005435 | Bacteria | 720 |
| 22 | Ga0070713_101180096 | 3300005436 | Bacteria | 741 |
| 23 | Ga0070681_10007099 | 3300005458 | Bacteria | 10907 |
| 24 | Ga0070679_100222855 | 3300005530 | Bacteria | 1847 |
| 25 | Ga0070679_100599773 | 3300005530 | Bacteria | 1045 |
| 26 | Ga0070684_100029158 | 3300005535 | Bacteria | 4674 |
| 27 | Ga0070684_100063139 | 3300005535 | Bacteria | 3246 |
| 28 | Ga0070684_100397238 | 3300005535 | Bacteria | 1271 |
| 29 | Ga0070684_101490402 | 3300005535 | Bacteria | 637 |
| 30 | Ga0068853_100031768 | 3300005539 | Bacteria | 4468 |
| 31 | Ga0068853_100057137 | 3300005539 | Bacteria | 3366 |
| 32 | Ga0068853_100886341 | 3300005539 | Bacteria | 857 |
| 33 | Ga0070686_100071632 | 3300005544 | Bacteria | 2270 |
| 34 | Ga0070665_100016297 | 3300005548 | Bacteria | 7452 |
| 35 | Ga0068855_100029685 | 3300005563 | Bacteria | 6537 |
| 36 | Ga0068855_100061581 | 3300005563 | Bacteria | 4384 |
| 37 | Ga0068855_100288384 | 3300005563 | Bacteria | 1820 |
| 38 | Ga0070664_100802748 | 3300005564 | Bacteria | 880 |
| 39 | Ga0068856_100065846 | 3300005614 | Bacteria | 3580 |
| 40 | Ga0068856_100443726 | 3300005614 | Bacteria | 1318 |
| 41 | Ga0068856_100521074 | 3300005614 | Bacteria | 1210 |
| 42 | Ga0068852_100127860 | 3300005616 | Bacteria | 2336 |
| 43 | Ga0068852_100461237 | 3300005616 | Bacteria | 1260 |
| 44 | Ga0068852_100507385 | 3300005616 | Bacteria | 1202 |
| 45 | Ga0068859_100140656 | 3300005617 | Bacteria | 2487 |
| 46 | Ga0068864_100007914 | 3300005618 | Bacteria | 8759 |
| 47 | Ga0068863_100007442 | 3300005841 | Bacteria | 10714 |
| 48 | Ga0068863_100847698 | 3300005841 | Bacteria | 913 |
| 49 | Ga0068858_100007799 | 3300005842 | Bacteria | 10334 |
| 50 | Ga0068858_100097431 | 3300005842 | Bacteria | 2742 |
| 51 | Ga0068858_100973927 | 3300005842 | Bacteria | 831 |
| 52 | Ga0068860_100007128 | 3300005843 | Bacteria | 11185 |
| 53 | Ga0075363_100171901 | 3300006048 | Unclassified | 1230 |
| 54 | Ga0070712_100847905 | 3300006175 | Bacteria | 786 |
| 55 | Ga0075362_10024084 | 3300006177 | Unclassified | 2580 |
| 56 | Ga0097621_100019023 | 3300006237 | Bacteria | 5263 |
| 57 | Ga0097621_100030123 | 3300006237 | Bacteria | 4293 |
| 58 | Ga0068871_100005162 | 3300006358 | Bacteria | 9133 |
| 59 | Ga0097620_100140652 | 3300006931 | Bacteria | 2487 |
| 60 | Ga0075435_100235556 | 3300007076 | Bacteria | 1556 |
| 61 | Ga0105240_10112049 | 3300009093 | Bacteria | 3299 |
| 62 | Ga0105240_10796377 | 3300009093 | Bacteria | 1024 |
| 63 | Ga0105245_10002714 | 3300009098 | Bacteria | 15935 |
| 64 | Ga0105241_10172045 | 3300009174 | Bacteria | 1790 |
| 65 | Ga0105248_10006447 | 3300009177 | Bacteria | 12878 |
| 66 | Ga0105248_11496199 | 3300009177 | Bacteria | 764 |
| 67 | Ga0105237_11006165 | 3300009545 | Bacteria | 840 |
| 68 | Ga0105238_10087095 | 3300009551 | Bacteria | 3110 |
| 69 | Ga0105238_10162918 | 3300009551 | Bacteria | 2206 |
| 70 | Ga0105238_10209399 | 3300009551 | Bacteria | 1926 |
| 71 | Ga0105030_100129 | 3300009987 | Bacteria | 5911 |
| 72 | Ga0157371_10634856 | 3300013102 | Bacteria | 796 |
| 73 | Ga0157370_10281691 | 3300013104 | Bacteria | 1536 |
| 74 | Ga0157369_10006334 | 3300013105 | Bacteria | 13736 |
| 75 | Ga0157369_10089791 | 3300013105 | Bacteria | 3281 |
| 76 | Ga0157369_10167285 | 3300013105 | Bacteria | 2318 |
| 77 | Ga0157374_10009580 | 3300013296 | Bacteria | 8319 |
| 78 | Ga0157374_10869198 | 3300013296 | Bacteria | 919 |
| 79 | Ga0157378_10004652 | 3300013297 | Bacteria | 12033 |
| 80 | Ga0157378_10730860 | 3300013297 | Bacteria | 1011 |
| 81 | Ga0163162_10007547 | 3300013306 | Bacteria | 10591 |
| 82 | Ga0157372_10191231 | 3300013307 | Bacteria | 2371 |
| 83 | Ga0157372_10852237 | 3300013307 | Bacteria | 1058 |
| 84 | Ga0157372_11251189 | 3300013307 | Bacteria | 857 |
| 85 | Ga0157372_11352641 | 3300013307 | Bacteria | 821 |
| 86 | Ga0157372_11678638 | 3300013307 | Bacteria | 731 |
| 87 | Ga0157375_10003225 | 3300013308 | Bacteria | 14154 |
| 88 | Ga0163163_10006629 | 3300014325 | Bacteria | 10141 |
| 89 | Ga0157379_10004489 | 3300014968 | Bacteria | 11965 |
| 90 | Ga0157376_10007741 | 3300014969 | Bacteria | 7697 |
| 91 | Ga0157376_10206712 | 3300014969 | Bacteria | 1810 |
| 92 | Ga0206356_10625632 | 3300020070 | Bacteria | 738 |
| 93 | Ga0207699_10147489 | 3300025906 | Bacteria | 1553 |
| 94 | Ga0207654_10015846 | 3300025911 | Bacteria | 3918 |
| 95 | Ga0207654_10741160 | 3300025911 | Bacteria | 707 |
| 96 | Ga0207707_10005674 | 3300025912 | Bacteria | 10922 |
| 97 | Ga0207707_10017188 | 3300025912 | Bacteria | 6305 |
| 98 | Ga0207707_10048919 | 3300025912 | Bacteria | 3684 |
| 99 | Ga0207695_10031032 | 3300025913 | Bacteria | 5872 |
| 100 | Ga0207671_10761314 | 3300025914 | Bacteria | 769 |
| 101 | Ga0207660_10012754 | 3300025917 | Bacteria | 5502 |
| 102 | Ga0207657_10109580 | 3300025919 | Bacteria | 2282 |
| 103 | Ga0207657_10742970 | 3300025919 | Bacteria | 760 |
| 104 | Ga0207649_10403470 | 3300025920 | Bacteria | 1023 |
| 105 | Ga0207649_10634614 | 3300025920 | Bacteria | 824 |
| 106 | Ga0207652_10178271 | 3300025921 | Bacteria | 1909 |
| 107 | Ga0207652_10229590 | 3300025921 | Bacteria | 1673 |
| 108 | Ga0207652_10871858 | 3300025921 | Bacteria | 796 |
| 109 | Ga0207694_10007098 | 3300025924 | Bacteria | 8511 |
| 110 | Ga0207694_10136119 | 3300025924 | Bacteria | 1973 |
| 111 | Ga0207687_10021057 | 3300025927 | Bacteria | 4329 |
| 112 | Ga0207664_10069623 | 3300025929 | Bacteria | 2829 |
| 113 | Ga0207644_10019396 | 3300025931 | Bacteria | 4613 |
| 114 | Ga0207670_10248150 | 3300025936 | Bacteria | 1374 |
| 115 | Ga0207670_10424519 | 3300025936 | Bacteria | 1067 |
| 116 | Ga0207711_10002222 | 3300025941 | Bacteria | 17420 |
| 117 | Ga0207711_11162939 | 3300025941 | Bacteria | 713 |
| 118 | Ga0207661_10414303 | 3300025944 | Bacteria | 1223 |
| 119 | Ga0207661_10737516 | 3300025944 | Bacteria | 906 |
| 120 | Ga0207679_10539886 | 3300025945 | Bacteria | 1045 |
| 121 | Ga0207667_10175639 | 3300025949 | Bacteria | 2201 |
| 122 | Ga0207667_10246512 | 3300025949 | Bacteria | 1828 |
| 123 | Ga0207667_10324884 | 3300025949 | Bacteria | 1571 |
| 124 | Ga0207658_10005497 | 3300025986 | Bacteria | 8688 |
| 125 | Ga0207677_10298836 | 3300026023 | Bacteria | 1329 |
| 126 | Ga0207703_10009259 | 3300026035 | Bacteria | 7745 |
| 127 | Ga0207703_10071611 | 3300026035 | Bacteria | 2864 |
| 128 | Ga0207703_10859422 | 3300026035 | Bacteria | 868 |
| 129 | Ga0207639_10018858 | 3300026041 | Bacteria | 4910 |
| 130 | Ga0207702_10114437 | 3300026078 | Bacteria | 2404 |
| 131 | Ga0207702_10563087 | 3300026078 | Bacteria | 1116 |
| 132 | Ga0207702_11399815 | 3300026078 | Bacteria | 693 |
| 133 | Ga0207641_10923191 | 3300026088 | Bacteria | 867 |
| 134 | Ga0207648_10052679 | 3300026089 | Bacteria | 3558 |
| 135 | Ga0207676_10015839 | 3300026095 | Bacteria | 5452 |
| 136 | Ga0207698_10018098 | 3300026142 | Bacteria | 4794 |
| 137 | Ga0207698_10516818 | 3300026142 | Bacteria | 1164 |
| 138 | Ga0210000_1009153 | 3300027462 | Bacteria | 1456 |
| 139 | Ga0209970_1003354 | 3300027614 | Bacteria | 2696 |
| 140 | Ga0268266_10011246 | 3300028379 | Bacteria | 7790 |
| 141 | Ga0268266_10179478 | 3300028379 | Bacteria | 1927 |
| 142 | Ga0265326_10007352 | 3300028558 | Bacteria | 3381 |
| 143 | Ga0265319_1002761 | 3300028563 | Bacteria | 9412 |
| 144 | Ga0265334_10001026 | 3300028573 | Bacteria | 13760 |
| 145 | Ga0265318_10000228 | 3300028577 | Bacteria | 48687 |
| 146 | Ga0265338_10016309 | 3300028800 | Bacteria | 8091 |
| 147 | Ga0265330_10004229 | 3300031235 | Bacteria | 7321 |
| 148 | Ga0265332_10001037 | 3300031238 | Bacteria | 16333 |
| 149 | Ga0265328_10002988 | 3300031239 | Bacteria | 7548 |
| 150 | Ga0265328_10003225 | 3300031239 | Bacteria | 7230 |
| 151 | Ga0265320_10004080 | 3300031240 | Bacteria | 9592 |
| 152 | Ga0265325_10005189 | 3300031241 | Bacteria | 8094 |
| 153 | Ga0265329_10001451 | 3300031242 | Bacteria | 11427 |
| 154 | Ga0265340_10013162 | 3300031247 | Bacteria | 4354 |
| 155 | Ga0265339_10014355 | 3300031249 | Bacteria | 4775 |
| 156 | Ga0265331_10004429 | 3300031250 | Bacteria | 8774 |
| 157 | Ga0265331_10018795 | 3300031250 | Bacteria | 3575 |
| 158 | Ga0265316_10013033 | 3300031344 | Bacteria | 7415 |
| 159 | Ga0265316_10381094 | 3300031344 | Bacteria | 1017 |
| 160 | Ga0307509_10243445 | 3300031507 | Bacteria | 1589 |
| 161 | Ga0307408_100538574 | 3300031548 | Bacteria | 1028 |
| 162 | Ga0265313_10001786 | 3300031595 | Bacteria | 19657 |
| 163 | Ga0316575_10082321 | 3300031665 | Bacteria | 1299 |
| 164 | Ga0265314_10005233 | 3300031711 | Bacteria | 11760 |
| 165 | Ga0265342_10002379 | 3300031712 | Bacteria | 16291 |
| 166 | Ga0316576_10000365 | 3300031727 | Bacteria | 20446 |
| 167 | Ga0316576_10019969 | 3300031727 | Bacteria | 4599 |
| 168 | Ga0316576_10027065 | 3300031727 | Bacteria | 4028 |
| 169 | Ga0316576_11006790 | 3300031727 | Bacteria | 593 |
| 170 | Ga0316578_10001214 | 3300031728 | Bacteria | 10228 |
| 171 | Ga0316578_10048128 | 3300031728 | Bacteria | 2489 |
| 172 | Ga0307405_11102582 | 3300031731 | Bacteria | 682 |
| 173 | Ga0316577_10009675 | 3300031733 | Bacteria | 5190 |
| 174 | Ga0316577_10014473 | 3300031733 | Bacteria | 4330 |
| 175 | Ga0316577_10237540 | 3300031733 | Bacteria | 1030 |
| 176 | Ga0316585_10010281 | 3300032137 | Bacteria | 2744 |
| 177 | Ga0316580_10006433 | 3300032139 | Bacteria | 3470 |
| 178 | Ga0316580_10170046 | 3300032139 | Bacteria | 670 |
| 179 | Ga0316593_10002246 | 3300032168 | Bacteria | 4524 |
| 180 | Ga0316593_10006051 | 3300032168 | Bacteria | 3241 |
| 181 | Ga0316593_10054641 | 3300032168 | Bacteria | 1355 |
| 182 | Ga0316593_10145875 | 3300032168 | Bacteria | 859 |
| 183 | Ga0316593_10180076 | 3300032168 | Bacteria | 777 |
| 184 | Ga0316593_10277788 | 3300032168 | Bacteria | 631 |
| 185 | Ga0316593_10280211 | 3300032168 | Bacteria | 628 |
| 186 | Ga0316593_10320956 | 3300032168 | Bacteria | 589 |
| 187 | Ga0316592_1000599 | 3300033524 | Bacteria | 5204 |
| 188 | Ga0316592_1010162 | 3300033524 | Bacteria | 1893 |
| 189 | Ga0316592_1118512 | 3300033524 | Bacteria | 614 |
| 190 | Ga0316586_1000062 | 3300033527 | Bacteria | 7865 |
| 191 | Ga0316586_1031852 | 3300033527 | Bacteria | 906 |
| 192 | Ga0316588_1000372 | 3300033528 | Bacteria | 5863 |
| 193 | Ga0316588_1013215 | 3300033528 | Bacteria | 1787 |
| 194 | Ga0316587_1015512 | 3300033529 | Bacteria | 1265 |
| 195 | Ga0316587_1055591 | 3300033529 | Bacteria | 729 |
| 196 | Ga0316596_1000073 | 3300033541 | Bacteria | 11690 |
| 197 | Ga0316596_1000971 | 3300033541 | Bacteria | 5484 |
| 198 | Ga0316596_1010280 | 3300033541 | Bacteria | 2261 |
| 199 | Ga0316596_1042705 | 3300033541 | Bacteria | 1193 |
| 200 | Ga0316596_1045516 | 3300033541 | Bacteria | 1158 |
| 201 | Ga0316596_1154304 | 3300033541 | Bacteria | 631 |
| 202 | Ga0373934_0267639 | 3300035086 | Bacteria | 707 |
| 203 | Ga0373923_0208710 | 3300035111 | Bacteria | 905 |
| 204 | Ga0373957_0109159 | 3300035120 | Bacteria | 1113 |
| 205 | Ga0373955_0015644 | 3300035172 | Bacteria | 3720 |
| 206 | Ga0316574_0000634 | 3300035398 | Bacteria | 14719 |
| 207 | Ga0316574_0030582 | 3300035398 | Bacteria | 3262 |
| 208 | Ga0316574_0046395 | 3300035398 | Bacteria | 2694 |
| 209 | Ga0316574_0048915 | 3300035398 | Bacteria | 2627 |
| 210 | Ga0373933_0013337 | 3300035724 | Bacteria | 4554 |
| 211 | Ga0373937_0045103 | 3300036401 | Bacteria | 4027 |
| 212 | Ga0316582_0023680 | 3300036647 | Bacteria | 3663 |
| 213 | Ga0316584_0004833 | 3300036712 | Bacteria | 8958 |
| 214 | Ga0316584_0024511 | 3300036712 | Bacteria | 4415 |
| 215 | Ga0395899_0135248 | 3300037312 | Bacteria | 1757 |
| 216 | Ga0395900_0034072 | 3300037418 | Bacteria | 5242 |
| 217 | Ga0395905_0048048 | 3300037471 | Bacteria | 3999 |
| 218 | Ga0395905_1144776 | 3300037471 | Bacteria | 681 |
| 219 | Ga0395901_0033769 | 3300038443 | Bacteria | 5283 |
| 220 | Ga0436365_0834902 | 3300039437 | Bacteria | 962 |
| 221 | Ga0439431_0044958 | 3300041997 | Bacteria | 1133 |
| 222 | Ga0450912_020489 | 3300042116 | Bacteria | 636 |
| 223 | Ga0450920_031409 | 3300042122 | Bacteria | 1046 |
| 224 | Ga0450923_001430 | 3300042125 | Bacteria | 3165 |
| 225 | Ga0450894_008467 | 3300042131 | Bacteria | 1331 |
| 226 | Ga0450902_042788 | 3300042137 | Bacteria | 772 |
| 227 | Ga0450907_010009 | 3300042146 | Bacteria | 1573 |
| 228 | Ga0450910_020518 | 3300042147 | Bacteria | 996 |
| 229 | Ga0450908_001238 | 3300042184 | Bacteria | 4953 |
| 230 | Ga0450918_010126 | 3300042531 | Bacteria | 1646 |
| 231 | Ga0453683_0008756 | 3300044673 | Bacteria | 6785 |
| 232 | Ga0466966_0179930 | 3300044684 | Bacteria | 1283 |
| 233 | Ga0466961_0117869 | 3300044693 | Bacteria | 1668 |
| 234 | Ga0466957_0004472 | 3300044842 | Bacteria | 7796 |
| 235 | Ga0466959_0074108 | 3300045049 | Bacteria | 2462 |
| 236 | Ga0451576_0000741 | 3300045051 | Bacteria | 65303 |
| 237 | Ga0466958_0062229 | 3300045836 | Bacteria | 2275 |
| 238 | Ga0466967_1991628 | 3300045976 | Bacteria | 577 |
| 239 | Ga0495580_0035520 | 3300046472 | Bacteria | 3584 |
| 240 | Ga0495628_0579982 | 3300046516 | Bacteria | 803 |
| 241 | Ga0495668_0708156 | 3300046616 | Bacteria | 557 |
| 242 | Ga0495657_0068194 | 3300046675 | Bacteria | 2332 |
| 243 | Ga0495676_0191206 | 3300047321 | Bacteria | 1428 |
| 244 | Ga0495675_0023639 | 3300047444 | Bacteria | 3917 |
| 245 | Ga0495602_0010959 | 3300048088 | Bacteria | 9394 |
| 246 | Ga0496100_0416929 | 3300048903 | Bacteria | 1025 |
| 247 | Ga0496103_0231869 | 3300048906 | Bacteria | 1188 |
| 248 | Ga0496104_0002304 | 3300048907 | Bacteria | 16478 |
| 249 | Ga0496105_0003295 | 3300048908 | Bacteria | 11922 |
| 250 | Ga0496106_0028039 | 3300048909 | Bacteria | 4193 |
| 251 | Ga0496108_0110732 | 3300048911 | Bacteria | 2347 |
| 252 | Ga0496110_0002136 | 3300048913 | Bacteria | 14773 |
| 253 | Ga0496111_0001868 | 3300048914 | Bacteria | 12443 |
| 254 | Ga0496113_0144538 | 3300048916 | Bacteria | 1873 |
| 255 | Ga0496114_0022428 | 3300048917 | Bacteria | 5147 |
| 256 | Ga0496115_0039076 | 3300048918 | Bacteria | 3768 |
| 257 | Ga0501324_019042 | 3300049540 | Bacteria | 691 |
| 258 | Ga0501033_0049659 | 3300049570 | Bacteria | 3114 |
| 259 | Ga0501034_0193193 | 3300049571 | Bacteria | 1997 |
| 260 | Ga0501034_0808155 | 3300049571 | Bacteria | 830 |
| 261 | Ga0501036_0023621 | 3300049572 | Bacteria | 5181 |
| 262 | Ga0501036_0292578 | 3300049572 | Bacteria | 1362 |
| 263 | Ga0501036_0941853 | 3300049572 | Bacteria | 708 |
| 264 | Ga0501037_0071416 | 3300049573 | Bacteria | 2525 |
| 265 | Ga0501037_0493072 | 3300049573 | Bacteria | 832 |
| 266 | Ga0501038_0015092 | 3300049574 | Bacteria | 7031 |
| 267 | Ga0501039_0021546 | 3300049575 | Bacteria | 4943 |
| 268 | Ga0501040_0024550 | 3300049576 | Bacteria | 4045 |
| 269 | Ga0501041_0001598 | 3300049577 | Bacteria | 12636 |
| 270 | Ga0501041_0074395 | 3300049577 | Bacteria | 2087 |
| 271 | Ga0501042_0001373 | 3300049578 | Bacteria | 14288 |
| 272 | Ga0501043_0144712 | 3300049579 | Bacteria | 1861 |
| 273 | Ga0501046_0015243 | 3300049580 | Bacteria | 6464 |
| 274 | Ga0501047_0122861 | 3300049581 | Bacteria | 2477 |
| 275 | Ga0501047_0814949 | 3300049581 | Bacteria | 748 |
| 276 | Ga0501047_0909087 | 3300049581 | Bacteria | 693 |
| 277 | Ga0501048_0009558 | 3300049582 | Bacteria | 7281 |
| 278 | Ga0501067_0012461 | 3300049583 | Bacteria | 4717 |
| 279 | Ga0501068_0041518 | 3300049584 | Bacteria | 2764 |
| 280 | Ga0501068_0052368 | 3300049584 | Bacteria | 2470 |
| 281 | Ga0501070_0200263 | 3300049586 | Bacteria | 1640 |
| 282 | Ga0501070_0294101 | 3300049586 | Bacteria | 1324 |
| 283 | Ga0501071_0024289 | 3300049587 | Bacteria | 4238 |
| 284 | Ga0501072_0063312 | 3300049588 | Bacteria | 2917 |
| 285 | Ga0501072_0359800 | 3300049588 | Bacteria | 1155 |
| 286 | Ga0501072_0368348 | 3300049588 | Bacteria | 1140 |
| 287 | Ga0501072_0438906 | 3300049588 | Bacteria | 1034 |
| 288 | Ga0501073_0004667 | 3300049589 | Bacteria | 10295 |
| 289 | Ga0501073_0603447 | 3300049589 | Bacteria | 758 |
| 290 | Ga0501075_0015597 | 3300049591 | Bacteria | 5453 |
| 291 | Ga0501075_0324468 | 3300049591 | Bacteria | 1173 |
| 292 | Ga0501076_0004639 | 3300049592 | Bacteria | 9791 |
| 293 | Ga0501076_0371703 | 3300049592 | Bacteria | 1175 |
| 294 | Ga0501077_0007629 | 3300049593 | Bacteria | 6677 |
| 295 | Ga0501077_0025784 | 3300049593 | Bacteria | 3730 |
| 296 | Ga0501077_0076822 | 3300049593 | Bacteria | 2115 |
| 297 | Ga0501079_0006996 | 3300049741 | Bacteria | 8503 |
| 298 | Ga0501079_0098342 | 3300049741 | Bacteria | 2268 |
| 299 | Ga0501079_0224370 | 3300049741 | Bacteria | 1468 |
| 300 | Ga0501079_0306683 | 3300049741 | Bacteria | 1242 |
| 301 | Ga0501080_0000363 | 3300049742 | Bacteria | 35077 |
| 302 | Ga0501081_0006719 | 3300049743 | Bacteria | 7480 |
| 303 | Ga0501083_0032077 | 3300049744 | Bacteria | 3604 |
| 304 | Ga0501035_0123252 | 3300049822 | Bacteria | 2264 |
| 305 | Ga0501035_0215221 | 3300049822 | Bacteria | 1642 |
| 306 | Ga0501044_0152338 | 3300049823 | Bacteria | 2294 |
| 307 | Ga0501045_0008747 | 3300049824 | Bacteria | 7062 |
| 308 | nmdc:mga0rr50_254190_c1 | 3300050513 | Bacteria | 1460 |
| 309 | Ga0500583_0003293 | 3300053092 | Bacteria | 5049 |
| 310 | Ga0500641_0033188 | 3300053096 | Bacteria | 2047 |
| 311 | Ga0500556_0039996 | 3300053104 | Bacteria | 1646 |
| 312 | Ga0500617_002715 | 3300053124 | Bacteria | 6145 |
| 313 | Ga0500627_0047785 | 3300053158 | Bacteria | 1858 |
| 314 | Ga0500633_0065779 | 3300053160 | Bacteria | 1285 |
| 315 | Ga0500645_197976 | 3300053730 | Bacteria | 542 |
| 316 | Ga0500656_000359 | 3300053732 | Bacteria | 3268 |
| 317 | Ga0501084_0008704 | 3300054114 | Bacteria | 8394 |
| 318 | Ga0501082_0004231 | 3300060353 | Bacteria | 12537 |
| 319 | Ga0501082_0021322 | 3300060353 | Bacteria | 5589 |
| 320 | Ga0501082_0260699 | 3300060353 | Bacteria | 1508 |
| 321 | Ga0501082_0752812 | 3300060353 | Bacteria | 853 |
| 322 | Ga0501082_0925391 | 3300060353 | Bacteria | 762 |
| 323 | Ga0530510_0007174 | 3300061734 | Bacteria | 7756 |
| 324 | Ga0530510_0201997 | 3300061734 | Bacteria | 1476 |
| 325 | Ga0530510_0214206 | 3300061734 | Bacteria | 1431 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042116 | Ga0450912_020489 | Ga0450912_020489_30_569 | 145 |
| 2 | 3300027462 | Ga0210000_1009153 | Ga0210000_10091533 | 147 |
| 3 | 3300027614 | Ga0209970_1003354 | Ga0209970_10033543 | 147 |
| 4 | 3300039437 | Ga0436365_0834902 | Ga0436365_0834902_42_551 | 147 |
| 5 | 3300049592 | Ga0501076_0371703 | Ga0501076_0371703_567_1106 | 147 |
| 6 | 3300031239 | Ga0265328_10003225 | Ga0265328_100032259 | 148 |
| 7 | 3300031344 | Ga0265316_10381094 | Ga0265316_103810942 | 148 |
| 8 | 3300031731 | Ga0307405_11102582 | Ga0307405_111025822 | 148 |
| 9 | 3300042137 | Ga0450902_042788 | Ga0450902_042788_271_762 | 149 |
| 10 | 3300049593 | Ga0501077_0076822 | Ga0501077_0076822_1391_1930 | 149 |
| 11 | 3300060353 | Ga0501082_0752812 | Ga0501082_0752812_286_825 | 149 |
| 12 | 3300041997 | Ga0439431_0044958 | Ga0439431_0044958_446_985 | 151 |
| 13 | 3300028558 | Ga0265326_10007352 | Ga0265326_100073526 | 152 |
| 14 | 3300028563 | Ga0265319_1002761 | Ga0265319_10027616 | 152 |
| 15 | 3300028573 | Ga0265334_10001026 | Ga0265334_1000102618 | 152 |
| 16 | 3300028577 | Ga0265318_10000228 | Ga0265318_1000022826 | 152 |
| 17 | 3300028800 | Ga0265338_10016309 | Ga0265338_1001630916 | 152 |
| 18 | 3300031235 | Ga0265330_10004229 | Ga0265330_1000422912 | 152 |
| 19 | 3300031238 | Ga0265332_10001037 | Ga0265332_1000103714 | 152 |
| 20 | 3300031239 | Ga0265328_10002988 | Ga0265328_100029887 | 152 |
| 21 | 3300031240 | Ga0265320_10004080 | Ga0265320_1000408010 | 152 |
| 22 | 3300031241 | Ga0265325_10005189 | Ga0265325_100051899 | 152 |
| 23 | 3300031242 | Ga0265329_10001451 | Ga0265329_1000145110 | 152 |
| 24 | 3300031247 | Ga0265340_10013162 | Ga0265340_100131625 | 152 |
| 25 | 3300031249 | Ga0265339_10014355 | Ga0265339_100143554 | 152 |
| 26 | 3300031250 | Ga0265331_10004429 | Ga0265331_100044297 | 152 |
| 27 | 3300031344 | Ga0265316_10013033 | Ga0265316_1001303316 | 152 |
| 28 | 3300031595 | Ga0265313_10001786 | Ga0265313_1000178616 | 152 |
| 29 | 3300031711 | Ga0265314_10005233 | Ga0265314_100052338 | 152 |
| 30 | 3300031712 | Ga0265342_10002379 | Ga0265342_1000237913 | 152 |
| 31 | 3300037471 | Ga0395905_1144776 | Ga0395905_1144776_207_665 | 152 |
| 32 | 3300042131 | Ga0450894_008467 | Ga0450894_008467_767_1306 | 152 |
| 33 | 3300045051 | Ga0451576_0000741 | Ga0451576_0000741_36743_37276 | 152 |
| 34 | 3300049581 | Ga0501047_0814949 | Ga0501047_0814949_216_728 | 152 |
| 35 | 3300049586 | Ga0501070_0294101 | Ga0501070_0294101_675_1214 | 153 |
| 36 | 3300026035 | Ga0207703_10071611 | Ga0207703_100716112 | 154 |
| 37 | 3300031665 | Ga0316575_10082321 | Ga0316575_100823213 | 154 |
| 38 | 3300035398 | Ga0316574_0000634 | Ga0316574_0000634_10763_11296 | 154 |
| 39 | 3300035398 | Ga0316574_0046395 | Ga0316574_0046395_1443_1976 | 154 |
| 40 | 3300047321 | Ga0495676_0191206 | Ga0495676_0191206_17_481 | 154 |
| 41 | 3300049570 | Ga0501033_0049659 | Ga0501033_0049659_1832_2365 | 156 |
| 42 | 3300049571 | Ga0501034_0808155 | Ga0501034_0808155_254_787 | 156 |
| 43 | 3300049572 | Ga0501036_0023621 | Ga0501036_0023621_1834_2367 | 156 |
| 44 | 3300049573 | Ga0501037_0071416 | Ga0501037_0071416_764_1297 | 156 |
| 45 | 3300049574 | Ga0501038_0015092 | Ga0501038_0015092_3420_3953 | 156 |
| 46 | 3300049575 | Ga0501039_0021546 | Ga0501039_0021546_3258_3791 | 156 |
| 47 | 3300049576 | Ga0501040_0024550 | Ga0501040_0024550_3156_3689 | 156 |
| 48 | 3300049577 | Ga0501041_0001598 | Ga0501041_0001598_3059_3592 | 156 |
| 49 | 3300049578 | Ga0501042_0001373 | Ga0501042_0001373_5816_6349 | 156 |
| 50 | 3300049579 | Ga0501043_0144712 | Ga0501043_0144712_1068_1601 | 156 |
| 51 | 3300049580 | Ga0501046_0015243 | Ga0501046_0015243_3739_4272 | 156 |
| 52 | 3300049582 | Ga0501048_0009558 | Ga0501048_0009558_1944_2477 | 156 |
| 53 | 3300049584 | Ga0501068_0041518 | Ga0501068_0041518_1275_1808 | 156 |
| 54 | 3300049587 | Ga0501071_0024289 | Ga0501071_0024289_271_804 | 156 |
| 55 | 3300049588 | Ga0501072_0063312 | Ga0501072_0063312_1273_1806 | 156 |
| 56 | 3300049591 | Ga0501075_0015597 | Ga0501075_0015597_3677_4210 | 156 |
| 57 | 3300049592 | Ga0501076_0004639 | Ga0501076_0004639_4912_5445 | 156 |
| 58 | 3300049593 | Ga0501077_0007629 | Ga0501077_0007629_3460_3993 | 156 |
| 59 | 3300049741 | Ga0501079_0006996 | Ga0501079_0006996_1483_2016 | 156 |
| 60 | 3300049743 | Ga0501081_0006719 | Ga0501081_0006719_3800_4333 | 156 |
| 61 | 3300049744 | Ga0501083_0032077 | Ga0501083_0032077_1942_2475 | 156 |
| 62 | 3300049822 | Ga0501035_0215221 | Ga0501035_0215221_45_578 | 156 |
| 63 | 3300049824 | Ga0501045_0008747 | Ga0501045_0008747_3147_3680 | 156 |
| 64 | 3300054114 | Ga0501084_0008704 | Ga0501084_0008704_378_911 | 156 |
| 65 | 3300060353 | Ga0501082_0004231 | Ga0501082_0004231_9235_9768 | 156 |
| 66 | 3300061734 | Ga0530510_0007174 | Ga0530510_0007174_3444_3977 | 156 |
| 67 | 3300004803 | Ga0058862_10046561 | Ga0058862_100465616 | 157 |
| 68 | 3300005330 | Ga0070690_100059136 | Ga0070690_1000591362 | 157 |
| 69 | 3300005334 | Ga0068869_100160403 | Ga0068869_1001604034 | 157 |
| 70 | 3300005335 | Ga0070666_10000475 | Ga0070666_1000047513 | 157 |
| 71 | 3300005336 | Ga0070680_100006614 | Ga0070680_1000066143 | 157 |
| 72 | 3300005338 | Ga0068868_100008926 | Ga0068868_10000892610 | 157 |
| 73 | 3300005340 | Ga0070689_100038453 | Ga0070689_1000384536 | 157 |
| 74 | 3300005355 | Ga0070671_100009280 | Ga0070671_1000092805 | 157 |
| 75 | 3300005367 | Ga0070667_100016587 | Ga0070667_1000165879 | 157 |
| 76 | 3300005535 | Ga0070684_100063139 | Ga0070684_1000631399 | 157 |
| 77 | 3300005539 | Ga0068853_100886341 | Ga0068853_1008863412 | 157 |
| 78 | 3300005544 | Ga0070686_100071632 | Ga0070686_1000716325 | 157 |
| 79 | 3300005548 | Ga0070665_100016297 | Ga0070665_1000162979 | 157 |
| 80 | 3300005564 | Ga0070664_100802748 | Ga0070664_1008027482 | 157 |
| 81 | 3300005614 | Ga0068856_100443726 | Ga0068856_1004437262 | 157 |
| 82 | 3300005617 | Ga0068859_100140656 | Ga0068859_1001406562 | 157 |
| 83 | 3300005618 | Ga0068864_100007914 | Ga0068864_10000791418 | 157 |
| 84 | 3300005841 | Ga0068863_100007442 | Ga0068863_1000074426 | 157 |
| 85 | 3300005842 | Ga0068858_100007799 | Ga0068858_10000779913 | 157 |
| 86 | 3300005843 | Ga0068860_100007128 | Ga0068860_10000712813 | 157 |
| 87 | 3300006237 | Ga0097621_100019023 | Ga0097621_1000190236 | 157 |
| 88 | 3300006358 | Ga0068871_100005162 | Ga0068871_10000516213 | 157 |
| 89 | 3300006931 | Ga0097620_100140652 | Ga0097620_1001406525 | 157 |
| 90 | 3300009093 | Ga0105240_10796377 | Ga0105240_107963771 | 157 |
| 91 | 3300009098 | Ga0105245_10002714 | Ga0105245_1000271418 | 157 |
| 92 | 3300009177 | Ga0105248_10006447 | Ga0105248_1000644718 | 157 |
| 93 | 3300013105 | Ga0157369_10089791 | Ga0157369_100897916 | 157 |
| 94 | 3300013296 | Ga0157374_10009580 | Ga0157374_100095801 | 157 |
| 95 | 3300013297 | Ga0157378_10004652 | Ga0157378_100046529 | 157 |
| 96 | 3300013306 | Ga0163162_10007547 | Ga0163162_1000754718 | 157 |
| 97 | 3300013307 | Ga0157372_11251189 | Ga0157372_112511892 | 157 |
| 98 | 3300013308 | Ga0157375_10003225 | Ga0157375_1000322518 | 157 |
| 99 | 3300014325 | Ga0163163_10006629 | Ga0163163_1000662917 | 157 |
| 100 | 3300014968 | Ga0157379_10004489 | Ga0157379_1000448913 | 157 |
| 101 | 3300014969 | Ga0157376_10007741 | Ga0157376_1000774110 | 157 |
| 102 | 3300025906 | Ga0207699_10147489 | Ga0207699_101474892 | 157 |
| 103 | 3300025912 | Ga0207707_10048919 | Ga0207707_100489196 | 157 |
| 104 | 3300025917 | Ga0207660_10012754 | Ga0207660_100127549 | 157 |
| 105 | 3300025927 | Ga0207687_10021057 | Ga0207687_100210574 | 157 |
| 106 | 3300025931 | Ga0207644_10019396 | Ga0207644_100193966 | 157 |
| 107 | 3300025936 | Ga0207670_10248150 | Ga0207670_102481502 | 157 |
| 108 | 3300025941 | Ga0207711_10002222 | Ga0207711_1000222218 | 157 |
| 109 | 3300025986 | Ga0207658_10005497 | Ga0207658_1000549712 | 157 |
| 110 | 3300026023 | Ga0207677_10298836 | Ga0207677_102988363 | 157 |
| 111 | 3300026035 | Ga0207703_10009259 | Ga0207703_100092596 | 157 |
| 112 | 3300026089 | Ga0207648_10052679 | Ga0207648_100526794 | 157 |
| 113 | 3300026095 | Ga0207676_10015839 | Ga0207676_100158397 | 157 |
| 114 | 3300028379 | Ga0268266_10011246 | Ga0268266_100112462 | 157 |
| 115 | 3300031548 | Ga0307408_100538574 | Ga0307408_1005385742 | 157 |
| 116 | 3300048903 | Ga0496100_0416929 | Ga0496100_0416929_343_873 | 157 |
| 117 | 3300048906 | Ga0496103_0231869 | Ga0496103_0231869_217_747 | 157 |
| 118 | 3300048907 | Ga0496104_0002304 | Ga0496104_0002304_8207_8737 | 157 |
| 119 | 3300048908 | Ga0496105_0003295 | Ga0496105_0003295_8207_8737 | 157 |
| 120 | 3300048909 | Ga0496106_0028039 | Ga0496106_0028039_3075_3605 | 157 |
| 121 | 3300048911 | Ga0496108_0110732 | Ga0496108_0110732_1127_1657 | 157 |
| 122 | 3300048913 | Ga0496110_0002136 | Ga0496110_0002136_13681_14211 | 157 |
| 123 | 3300048914 | Ga0496111_0001868 | Ga0496111_0001868_10787_11317 | 157 |
| 124 | 3300048916 | Ga0496113_0144538 | Ga0496113_0144538_1021_1551 | 157 |
| 125 | 3300048917 | Ga0496114_0022428 | Ga0496114_0022428_1607_2137 | 157 |
| 126 | 3300005344 | Ga0070661_100592593 | Ga0070661_1005925931 | 158 |
| 127 | 3300025920 | Ga0207649_10403470 | Ga0207649_104034702 | 158 |
| 128 | 3300005340 | Ga0070689_100994888 | Ga0070689_1009948881 | 159 |
| 129 | 3300005365 | Ga0070688_100520999 | Ga0070688_1005209992 | 159 |
| 130 | 3300005841 | Ga0068863_100847698 | Ga0068863_1008476982 | 159 |
| 131 | 3300005842 | Ga0068858_100097431 | Ga0068858_1000974316 | 159 |
| 132 | 3300025936 | Ga0207670_10424519 | Ga0207670_104245192 | 159 |
| 133 | 3300026088 | Ga0207641_10923191 | Ga0207641_109231912 | 159 |
| 134 | 3300049540 | Ga0501324_019042 | Ga0501324_019042_63_578 | 159 |
| 135 | 3300053730 | Ga0500645_197976 | Ga0500645_197976_20_499 | 159 |
| 136 | 3300045976 | Ga0466967_1991628 | Ga0466967_1991628_75_563 | 162 |
| 137 | 3300005614 | Ga0068856_100521074 | Ga0068856_1005210743 | 163 |
| 138 | 3300009551 | Ga0105238_10209399 | Ga0105238_102093992 | 163 |
| 139 | 3300025912 | Ga0207707_10017188 | Ga0207707_100171883 | 163 |
| 140 | 3300025921 | Ga0207652_10229590 | Ga0207652_102295903 | 163 |
| 141 | 3300049581 | Ga0501047_0909087 | Ga0501047_0909087_176_667 | 163 |
| 142 | 3300006237 | Ga0097621_100030123 | Ga0097621_10003012310 | 167 |
| 143 | 3300049572 | Ga0501036_0941853 | Ga0501036_0941853_183_686 | 167 |
| 144 | 3300060353 | Ga0501082_0260699 | Ga0501082_0260699_261_794 | 167 |
| 145 | 3300006177 | Ga0075362_10024084 | Ga0075362_100240842 | 169 |
| 146 | 3300032168 | Ga0316593_10002246 | Ga0316593_100022466 | 169 |
| 147 | 3300049588 | Ga0501072_0359800 | Ga0501072_0359800_550_1089 | 169 |
| 148 | 3300042122 | Ga0450920_031409 | Ga0450920_031409_12_533 | 171 |
| 149 | 3300031507 | Ga0307509_10243445 | Ga0307509_102434453 | 175 |
| 150 | 3300032168 | Ga0316593_10180076 | Ga0316593_101800762 | 175 |
| 151 | 3300033541 | Ga0316596_1042705 | Ga0316596_10427053 | 175 |
| 152 | 3300046616 | Ga0495668_0708156 | Ga0495668_0708156_16_543 | 175 |
| 153 | 3300049823 | Ga0501044_0152338 | Ga0501044_0152338_586_1113 | 175 |
| 154 | 3300053092 | Ga0500583_0003293 | Ga0500583_0003293_1880_2407 | 175 |
| 155 | 3300053096 | Ga0500641_0033188 | Ga0500641_0033188_707_1234 | 175 |
| 156 | 3300053104 | Ga0500556_0039996 | Ga0500556_0039996_415_942 | 175 |
| 157 | 3300053124 | Ga0500617_002715 | Ga0500617_002715_633_1160 | 175 |
| 158 | 3300053158 | Ga0500627_0047785 | Ga0500627_0047785_977_1504 | 175 |
| 159 | 3300053160 | Ga0500633_0065779 | Ga0500633_0065779_351_878 | 175 |
| 160 | 3300053732 | Ga0500656_000359 | Ga0500656_000359_1180_1707 | 175 |
| 161 | 3300031250 | Ga0265331_10018795 | Ga0265331_100187955 | 176 |
| 162 | 3300032168 | Ga0316593_10145875 | Ga0316593_101458752 | 176 |
| 163 | 3300033529 | Ga0316587_1015512 | Ga0316587_10155122 | 176 |
| 164 | 3300035086 | Ga0373934_0267639 | Ga0373934_0267639_26_556 | 176 |
| 165 | 3300035111 | Ga0373923_0208710 | Ga0373923_0208710_362_892 | 176 |
| 166 | 3300035120 | Ga0373957_0109159 | Ga0373957_0109159_33_563 | 176 |
| 167 | 3300035172 | Ga0373955_0015644 | Ga0373955_0015644_1899_2429 | 176 |
| 168 | 3300035398 | Ga0316574_0048915 | Ga0316574_0048915_614_1144 | 176 |
| 169 | 3300035724 | Ga0373933_0013337 | Ga0373933_0013337_3920_4450 | 176 |
| 170 | 3300036401 | Ga0373937_0045103 | Ga0373937_0045103_2119_2649 | 176 |
| 171 | 3300046472 | Ga0495580_0035520 | Ga0495580_0035520_2205_2735 | 176 |
| 172 | 3300046516 | Ga0495628_0579982 | Ga0495628_0579982_22_552 | 176 |
| 173 | 3300046675 | Ga0495657_0068194 | Ga0495657_0068194_707_1237 | 176 |
| 174 | 3300047444 | Ga0495675_0023639 | Ga0495675_0023639_1104_1634 | 176 |
| 175 | 3300048088 | Ga0495602_0010959 | Ga0495602_0010959_6707_7237 | 176 |
| 176 | 3300048918 | Ga0496115_0039076 | Ga0496115_0039076_1270_1803 | 176 |
| 177 | 3300049589 | Ga0501073_0603447 | Ga0501073_0603447_127_657 | 176 |
| 178 | 3300002704 | JGI25155J39150_1000064 | JGI25155J39150_100006458 | 177 |
| 179 | 3300002739 | JGI25158J39367_1015521 | JGI25158J39367_10155212 | 177 |
| 180 | 3300005327 | Ga0070658_10030833 | Ga0070658_100308338 | 177 |
| 181 | 3300005327 | Ga0070658_10513672 | Ga0070658_105136722 | 177 |
| 182 | 3300005336 | Ga0070680_100414764 | Ga0070680_1004147641 | 177 |
| 183 | 3300005339 | Ga0070660_100792465 | Ga0070660_1007924652 | 177 |
| 184 | 3300005345 | Ga0070692_10264724 | Ga0070692_102647242 | 177 |
| 185 | 3300005435 | Ga0070714_100039749 | Ga0070714_1000397495 | 177 |
| 186 | 3300005435 | Ga0070714_101266781 | Ga0070714_1012667811 | 177 |
| 187 | 3300005436 | Ga0070713_101180096 | Ga0070713_1011800961 | 177 |
| 188 | 3300005458 | Ga0070681_10007099 | Ga0070681_1000709911 | 177 |
| 189 | 3300005530 | Ga0070679_100222855 | Ga0070679_1002228554 | 177 |
| 190 | 3300005530 | Ga0070679_100599773 | Ga0070679_1005997732 | 177 |
| 191 | 3300005535 | Ga0070684_100029158 | Ga0070684_1000291589 | 177 |
| 192 | 3300005535 | Ga0070684_100397238 | Ga0070684_1003972381 | 177 |
| 193 | 3300005535 | Ga0070684_101490402 | Ga0070684_1014904021 | 177 |
| 194 | 3300005539 | Ga0068853_100031768 | Ga0068853_1000317685 | 177 |
| 195 | 3300005539 | Ga0068853_100057137 | Ga0068853_1000571376 | 177 |
| 196 | 3300005563 | Ga0068855_100029685 | Ga0068855_10002968510 | 177 |
| 197 | 3300005563 | Ga0068855_100061581 | Ga0068855_1000615818 | 177 |
| 198 | 3300005563 | Ga0068855_100288384 | Ga0068855_1002883843 | 177 |
| 199 | 3300005614 | Ga0068856_100065846 | Ga0068856_1000658464 | 177 |
| 200 | 3300005616 | Ga0068852_100127860 | Ga0068852_1001278603 | 177 |
| 201 | 3300005616 | Ga0068852_100461237 | Ga0068852_1004612373 | 177 |
| 202 | 3300005616 | Ga0068852_100507385 | Ga0068852_1005073852 | 177 |
| 203 | 3300005842 | Ga0068858_100973927 | Ga0068858_1009739272 | 177 |
| 204 | 3300006048 | Ga0075363_100171901 | Ga0075363_1001719013 | 177 |
| 205 | 3300006175 | Ga0070712_100847905 | Ga0070712_1008479052 | 177 |
| 206 | 3300007076 | Ga0075435_100235556 | Ga0075435_1002355562 | 177 |
| 207 | 3300009093 | Ga0105240_10112049 | Ga0105240_101120491 | 177 |
| 208 | 3300009174 | Ga0105241_10172045 | Ga0105241_101720454 | 177 |
| 209 | 3300009177 | Ga0105248_11496199 | Ga0105248_114961992 | 177 |
| 210 | 3300009545 | Ga0105237_11006165 | Ga0105237_110061652 | 177 |
| 211 | 3300009551 | Ga0105238_10087095 | Ga0105238_100870956 | 177 |
| 212 | 3300009551 | Ga0105238_10162918 | Ga0105238_101629183 | 177 |
| 213 | 3300009987 | Ga0105030_100129 | Ga0105030_1001296 | 177 |
| 214 | 3300013102 | Ga0157371_10634856 | Ga0157371_106348561 | 177 |
| 215 | 3300013104 | Ga0157370_10281691 | Ga0157370_102816913 | 177 |
| 216 | 3300013105 | Ga0157369_10006334 | Ga0157369_1000633417 | 177 |
| 217 | 3300013105 | Ga0157369_10167285 | Ga0157369_101672853 | 177 |
| 218 | 3300013296 | Ga0157374_10869198 | Ga0157374_108691982 | 177 |
| 219 | 3300013297 | Ga0157378_10730860 | Ga0157378_107308602 | 177 |
| 220 | 3300013307 | Ga0157372_10191231 | Ga0157372_101912314 | 177 |
| 221 | 3300013307 | Ga0157372_10852237 | Ga0157372_108522372 | 177 |
| 222 | 3300013307 | Ga0157372_11352641 | Ga0157372_113526412 | 177 |
| 223 | 3300013307 | Ga0157372_11678638 | Ga0157372_116786382 | 177 |
| 224 | 3300014969 | Ga0157376_10206712 | Ga0157376_102067122 | 177 |
| 225 | 3300020070 | Ga0206356_10625632 | Ga0206356_106256322 | 177 |
| 226 | 3300025911 | Ga0207654_10015846 | Ga0207654_100158465 | 177 |
| 227 | 3300025911 | Ga0207654_10741160 | Ga0207654_107411601 | 177 |
| 228 | 3300025912 | Ga0207707_10005674 | Ga0207707_1000567418 | 177 |
| 229 | 3300025913 | Ga0207695_10031032 | Ga0207695_100310322 | 177 |
| 230 | 3300025914 | Ga0207671_10761314 | Ga0207671_107613141 | 177 |
| 231 | 3300025919 | Ga0207657_10109580 | Ga0207657_101095801 | 177 |
| 232 | 3300025919 | Ga0207657_10742970 | Ga0207657_107429702 | 177 |
| 233 | 3300025920 | Ga0207649_10634614 | Ga0207649_106346142 | 177 |
| 234 | 3300025921 | Ga0207652_10178271 | Ga0207652_101782713 | 177 |
| 235 | 3300025921 | Ga0207652_10871858 | Ga0207652_108718581 | 177 |
| 236 | 3300025924 | Ga0207694_10007098 | Ga0207694_1000709816 | 177 |
| 237 | 3300025924 | Ga0207694_10136119 | Ga0207694_101361193 | 177 |
| 238 | 3300025929 | Ga0207664_10069623 | Ga0207664_100696235 | 177 |
| 239 | 3300025941 | Ga0207711_11162939 | Ga0207711_111629392 | 177 |
| 240 | 3300025944 | Ga0207661_10414303 | Ga0207661_104143032 | 177 |
| 241 | 3300025944 | Ga0207661_10737516 | Ga0207661_107375162 | 177 |
| 242 | 3300025945 | Ga0207679_10539886 | Ga0207679_105398862 | 177 |
| 243 | 3300025949 | Ga0207667_10175639 | Ga0207667_101756392 | 177 |
| 244 | 3300025949 | Ga0207667_10246512 | Ga0207667_102465123 | 177 |
| 245 | 3300025949 | Ga0207667_10324884 | Ga0207667_103248842 | 177 |
| 246 | 3300026035 | Ga0207703_10859422 | Ga0207703_108594222 | 177 |
| 247 | 3300026041 | Ga0207639_10018858 | Ga0207639_1001885810 | 177 |
| 248 | 3300026078 | Ga0207702_10114437 | Ga0207702_101144376 | 177 |
| 249 | 3300026078 | Ga0207702_10563087 | Ga0207702_105630873 | 177 |
| 250 | 3300026078 | Ga0207702_11399815 | Ga0207702_113998152 | 177 |
| 251 | 3300026142 | Ga0207698_10018098 | Ga0207698_100180982 | 177 |
| 252 | 3300026142 | Ga0207698_10516818 | Ga0207698_105168182 | 177 |
| 253 | 3300028379 | Ga0268266_10179478 | Ga0268266_101794783 | 177 |
| 254 | 3300031727 | Ga0316576_10000365 | Ga0316576_1000036514 | 177 |
| 255 | 3300031727 | Ga0316576_10019969 | Ga0316576_100199694 | 177 |
| 256 | 3300031727 | Ga0316576_10027065 | Ga0316576_100270652 | 177 |
| 257 | 3300031727 | Ga0316576_11006790 | Ga0316576_110067901 | 177 |
| 258 | 3300031728 | Ga0316578_10001214 | Ga0316578_100012146 | 177 |
| 259 | 3300031728 | Ga0316578_10048128 | Ga0316578_100481283 | 177 |
| 260 | 3300031733 | Ga0316577_10009675 | Ga0316577_1000967510 | 177 |
| 261 | 3300031733 | Ga0316577_10014473 | Ga0316577_100144731 | 177 |
| 262 | 3300031733 | Ga0316577_10237540 | Ga0316577_102375402 | 177 |
| 263 | 3300032137 | Ga0316585_10010281 | Ga0316585_100102815 | 177 |
| 264 | 3300032139 | Ga0316580_10006433 | Ga0316580_100064332 | 177 |
| 265 | 3300032139 | Ga0316580_10170046 | Ga0316580_101700461 | 177 |
| 266 | 3300032168 | Ga0316593_10006051 | Ga0316593_100060512 | 177 |
| 267 | 3300032168 | Ga0316593_10054641 | Ga0316593_100546411 | 177 |
| 268 | 3300032168 | Ga0316593_10277788 | Ga0316593_102777881 | 177 |
| 269 | 3300032168 | Ga0316593_10280211 | Ga0316593_102802111 | 177 |
| 270 | 3300032168 | Ga0316593_10320956 | Ga0316593_103209561 | 177 |
| 271 | 3300033524 | Ga0316592_1000599 | Ga0316592_10005996 | 177 |
| 272 | 3300033524 | Ga0316592_1010162 | Ga0316592_10101624 | 177 |
| 273 | 3300033524 | Ga0316592_1118512 | Ga0316592_11185121 | 177 |
| 274 | 3300033527 | Ga0316586_1000062 | Ga0316586_10000624 | 177 |
| 275 | 3300033527 | Ga0316586_1031852 | Ga0316586_10318522 | 177 |
| 276 | 3300033528 | Ga0316588_1000372 | Ga0316588_10003729 | 177 |
| 277 | 3300033528 | Ga0316588_1013215 | Ga0316588_10132152 | 177 |
| 278 | 3300033529 | Ga0316587_1055591 | Ga0316587_10555911 | 177 |
| 279 | 3300033541 | Ga0316596_1000073 | Ga0316596_100007312 | 177 |
| 280 | 3300033541 | Ga0316596_1000971 | Ga0316596_100097113 | 177 |
| 281 | 3300033541 | Ga0316596_1010280 | Ga0316596_10102803 | 177 |
| 282 | 3300033541 | Ga0316596_1045516 | Ga0316596_10455162 | 177 |
| 283 | 3300033541 | Ga0316596_1154304 | Ga0316596_11543041 | 177 |
| 284 | 3300035398 | Ga0316574_0030582 | Ga0316574_0030582_412_945 | 177 |
| 285 | 3300036647 | Ga0316582_0023680 | Ga0316582_0023680_936_1469 | 177 |
| 286 | 3300036712 | Ga0316584_0004833 | Ga0316584_0004833_4928_5461 | 177 |
| 287 | 3300036712 | Ga0316584_0024511 | Ga0316584_0024511_1352_1885 | 177 |
| 288 | 3300037312 | Ga0395899_0135248 | Ga0395899_0135248_894_1427 | 177 |
| 289 | 3300037418 | Ga0395900_0034072 | Ga0395900_0034072_2069_2602 | 177 |
| 290 | 3300037471 | Ga0395905_0048048 | Ga0395905_0048048_2022_2555 | 177 |
| 291 | 3300038443 | Ga0395901_0033769 | Ga0395901_0033769_2090_2623 | 177 |
| 292 | 3300042125 | Ga0450923_001430 | Ga0450923_001430_1812_2351 | 177 |
| 293 | 3300042146 | Ga0450907_010009 | Ga0450907_010009_526_1065 | 177 |
| 294 | 3300042147 | Ga0450910_020518 | Ga0450910_020518_260_799 | 177 |
| 295 | 3300042184 | Ga0450908_001238 | Ga0450908_001238_2853_3392 | 177 |
| 296 | 3300042531 | Ga0450918_010126 | Ga0450918_010126_1016_1555 | 177 |
| 297 | 3300044673 | Ga0453683_0008756 | Ga0453683_0008756_3760_4293 | 177 |
| 298 | 3300044684 | Ga0466966_0179930 | Ga0466966_0179930_231_764 | 177 |
| 299 | 3300044693 | Ga0466961_0117869 | Ga0466961_0117869_724_1257 | 177 |
| 300 | 3300044842 | Ga0466957_0004472 | Ga0466957_0004472_538_1071 | 177 |
| 301 | 3300045049 | Ga0466959_0074108 | Ga0466959_0074108_126_659 | 177 |
| 302 | 3300045836 | Ga0466958_0062229 | Ga0466958_0062229_693_1226 | 177 |
| 303 | 3300049571 | Ga0501034_0193193 | Ga0501034_0193193_433_966 | 177 |
| 304 | 3300049572 | Ga0501036_0292578 | Ga0501036_0292578_545_1084 | 177 |
| 305 | 3300049573 | Ga0501037_0493072 | Ga0501037_0493072_230_769 | 177 |
| 306 | 3300049577 | Ga0501041_0074395 | Ga0501041_0074395_1345_1884 | 177 |
| 307 | 3300049581 | Ga0501047_0122861 | Ga0501047_0122861_140_673 | 177 |
| 308 | 3300049583 | Ga0501067_0012461 | Ga0501067_0012461_2873_3415 | 177 |
| 309 | 3300049584 | Ga0501068_0052368 | Ga0501068_0052368_797_1339 | 177 |
| 310 | 3300049586 | Ga0501070_0200263 | Ga0501070_0200263_972_1505 | 177 |
| 311 | 3300049588 | Ga0501072_0368348 | Ga0501072_0368348_80_619 | 177 |
| 312 | 3300049588 | Ga0501072_0438906 | Ga0501072_0438906_431_970 | 177 |
| 313 | 3300049589 | Ga0501073_0004667 | Ga0501073_0004667_229_771 | 177 |
| 314 | 3300049591 | Ga0501075_0324468 | Ga0501075_0324468_499_1038 | 177 |
| 315 | 3300049593 | Ga0501077_0025784 | Ga0501077_0025784_1679_2221 | 177 |
| 316 | 3300049741 | Ga0501079_0098342 | Ga0501079_0098342_100_639 | 177 |
| 317 | 3300049741 | Ga0501079_0224370 | Ga0501079_0224370_499_1038 | 177 |
| 318 | 3300049741 | Ga0501079_0306683 | Ga0501079_0306683_548_1090 | 177 |
| 319 | 3300049742 | Ga0501080_0000363 | Ga0501080_0000363_912_1454 | 177 |
| 320 | 3300049822 | Ga0501035_0123252 | Ga0501035_0123252_17_550 | 177 |
| 321 | 3300050513 | nmdc:mga0rr50_254190_c1 | nmdc:mga0rr50_254190_c1_606_1139 | 177 |
| 322 | 3300060353 | Ga0501082_0021322 | Ga0501082_0021322_1011_1553 | 177 |
| 323 | 3300060353 | Ga0501082_0925391 | Ga0501082_0925391_13_552 | 177 |
| 324 | 3300061734 | Ga0530510_0201997 | Ga0530510_0201997_234_773 | 177 |
| 325 | 3300061734 | Ga0530510_0214206 | Ga0530510_0214206_279_818 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5li0-assembly1.cif.gz_H | 70s ribosome from staphylococcus aureus | 0.9335 | 9 | 164 |
| 6yef-assembly1.cif.gz_H | 70s initiation complex with assigned rrna modifications from staphylococcus aureus | 0.9259 | 9 | 165 |
| 4v9b-assembly1.cif.gz_BH | crystal structure of the 70s ribosome with tigecycline. | 0.9245 | 2 | 166 |
| 3j3w-assembly1.cif.gz_G | atomic model of the immature 50s subunit from bacillus subtilis (state ii-a) | 0.9172 | 10 | 166 |
| 6ppk-assembly1.cif.gz_G | rbga+45srbga complex | 0.9107 | 59 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9539 | 3 | 82 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.943 | 1 | 82 | 3.90.930.12 |
| af_Q2FW21_1_82_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9321 | 1 | 82 | 3.90.930.12 |
| 5x8tG01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9316 | 3 | 82 | 3.90.930.12 |
| 4qcxH01 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.9286 | 2 | 79 | 3.90.930.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352Q4J4-F1-model_v4 | 50S ribosomal protein L6 | 0.9848 | 1 | 149 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A4P9I807-F1-model_v4 | 50S ribosomal protein L6 | 0.9833 | 9 | 149 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A2G4DSX9-F1-model_v4 | 50S ribosomal protein L6 | 0.9806 | 1 | 148 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A7R9FV03-F1-model_v4 | Large ribosomal subunit protein uL6 (60S ribosomal protein L9) | 0.9796 | 1 | 139 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
| AF-A0A353YAL1-F1-model_v4 | 50S ribosomal protein L6 | 0.9782 | 1 | 98 |
GO:0002181
GO:0003735 GO:0019843 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar