F407796
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 226 | 650 | 314 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10266690|Ga0114129_102666902 |
| Length | 368 |
| Sequence | MFKPIRDHSCQQTGVVANAHSGRNIGVRCMAIAVQQAAIAICSRGNRQTGNAGTMQQKILTVAVNPAVDLSTRVERMLANRKLRCAGAHVEPGGGGINVSRVIRGFGGQSAAFVALGGPTGRTLRELMKQEGLDVLEFPIAQETRQNVTVDETRRERQYRLVLQGPHWSGKEVKAALARIERLAKDHDYVVATGSLPPGVPEGFYASIARIVRRQGGRMILDTSGPPLQAALEAGVYLVKPNHIEFRDLGGAHSTDWKTMARVGHRLQERGKAEIMIVTRGDLGALAILPDSAWRLQSPKGKVVSLVGAGDSLIGAFVLALARGKPLLEACRLGVAAASAAVEAPGSELASRKETLRIARRTKVWEVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 90 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 91 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 92 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 93 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 94 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 95 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 96 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 99 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 100 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 103 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 106 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 107 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 113 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 121 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 122 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 123 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 124 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 125 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 126 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 208 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 210 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 211 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 212 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 213 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 214 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 215 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 216 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 217 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 218 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 219 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 220 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 221 | 2922425934 | |||
| 222 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 223 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 224 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 225 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 226 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.06 |
| Metatranscriptomes | 0 |
| Isolates | 4.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.46 |
| Nodule | 1.85 |
| Rhizoplane | 5.23 |
| Rhizosphere | 84.92 |
| Stem | 0 |
| Stem Tuber | 0.31 |
| Unclassified | 7.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10266690 | 3300009147 | Bacteria | 2292 |
| 2 | JGI25153J46596_10000217 | 3300003215 | Bacteria | 49414 |
| 3 | JGI25153J46596_10002120 | 3300003215 | Bacteria | 11609 |
| 4 | rootL2_10149336 | 3300003322 | Bacteria | 1573 |
| 5 | rootL2_10153856 | 3300003322 | Bacteria | 1257 |
| 6 | Ga0055542_1006403 | 3300003762 | Bacteria | 2519 |
| 7 | Ga0065712_10005480 | 3300005290 | Unclassified | 4424 |
| 8 | Ga0065712_10070269 | 3300005290 | Bacteria | 6157 |
| 9 | Ga0070658_10223717 | 3300005327 | Bacteria | 1592 |
| 10 | Ga0070670_100134188 | 3300005331 | Unclassified | 2139 |
| 11 | Ga0070670_100253428 | 3300005331 | Bacteria | 1534 |
| 12 | Ga0068869_100261862 | 3300005334 | Bacteria | 1384 |
| 13 | Ga0068869_100312914 | 3300005334 | Bacteria | 1271 |
| 14 | Ga0070680_100078703 | 3300005336 | Bacteria | 2716 |
| 15 | Ga0070689_100263921 | 3300005340 | Bacteria | 1424 |
| 16 | Ga0070689_100422589 | 3300005340 | Bacteria | 1130 |
| 17 | Ga0070687_100027762 | 3300005343 | Bacteria | 2738 |
| 18 | Ga0070692_10000261 | 3300005345 | Bacteria | 14687 |
| 19 | Ga0070668_100308810 | 3300005347 | Bacteria | 1328 |
| 20 | Ga0070669_100069033 | 3300005353 | Bacteria | 2610 |
| 21 | Ga0070671_100010475 | 3300005355 | Bacteria | 7439 |
| 22 | Ga0070674_100076893 | 3300005356 | Bacteria | 2374 |
| 23 | Ga0070673_100027476 | 3300005364 | Bacteria | 4219 |
| 24 | Ga0070688_100114024 | 3300005365 | Unclassified | 1801 |
| 25 | Ga0070659_100007736 | 3300005366 | Bacteria | 7813 |
| 26 | Ga0070667_100194968 | 3300005367 | Bacteria | 1796 |
| 27 | Ga0070709_10025220 | 3300005434 | Bacteria | 3510 |
| 28 | Ga0070714_100021861 | 3300005435 | Bacteria | 5237 |
| 29 | Ga0070714_100022358 | 3300005435 | Bacteria | 5185 |
| 30 | Ga0070713_100150990 | 3300005436 | Unclassified | 2067 |
| 31 | Ga0070710_10007338 | 3300005437 | Bacteria | 5335 |
| 32 | Ga0070701_10000129 | 3300005438 | Bacteria | 22285 |
| 33 | Ga0070711_100161811 | 3300005439 | Unclassified | 1697 |
| 34 | Ga0070700_100024144 | 3300005441 | Bacteria | 3566 |
| 35 | Ga0070663_100328469 | 3300005455 | Bacteria | 1232 |
| 36 | Ga0070678_100402391 | 3300005456 | Bacteria | 1190 |
| 37 | Ga0070681_10057493 | 3300005458 | Bacteria | 3870 |
| 38 | Ga0070672_100408788 | 3300005543 | Bacteria | 1164 |
| 39 | Ga0070665_100026398 | 3300005548 | Bacteria | 5849 |
| 40 | Ga0070665_100036229 | 3300005548 | Bacteria | 4963 |
| 41 | Ga0070664_100246754 | 3300005564 | Bacteria | 1604 |
| 42 | Ga0070664_100458529 | 3300005564 | Unclassified | 1171 |
| 43 | Ga0068859_100413996 | 3300005617 | Bacteria | 1444 |
| 44 | Ga0068861_100151795 | 3300005719 | Bacteria | 1902 |
| 45 | Ga0068860_100207646 | 3300005843 | Bacteria | 1899 |
| 46 | Ga0068862_100315635 | 3300005844 | Bacteria | 1441 |
| 47 | Ga0081538_10018999 | 3300005981 | Bacteria | 5131 |
| 48 | Ga0070717_10123713 | 3300006028 | Unclassified | 2218 |
| 49 | Ga0075365_10118020 | 3300006038 | Bacteria | 1828 |
| 50 | Ga0075432_10000354 | 3300006058 | Bacteria | 13152 |
| 51 | Ga0070716_100012503 | 3300006173 | Bacteria | 4304 |
| 52 | Ga0070712_100020365 | 3300006175 | Bacteria | 4341 |
| 53 | Ga0075428_100394553 | 3300006844 | Bacteria | 1483 |
| 54 | Ga0068865_100175798 | 3300006881 | Bacteria | 1645 |
| 55 | Ga0097620_100414039 | 3300006931 | Bacteria | 1444 |
| 56 | Ga0111539_10412567 | 3300009094 | Bacteria | 1573 |
| 57 | Ga0105247_10008742 | 3300009101 | Bacteria | 6180 |
| 58 | Ga0114129_10059090 | 3300009147 | Bacteria | 5361 |
| 59 | Ga0105248_10014497 | 3300009177 | Bacteria | 8676 |
| 60 | Ga0105248_10655235 | 3300009177 | Bacteria | 1185 |
| 61 | Ga0105237_10052908 | 3300009545 | Bacteria | 4074 |
| 62 | Ga0105249_10136115 | 3300009553 | Bacteria | 2351 |
| 63 | Ga0105249_10212169 | 3300009553 | Bacteria | 1900 |
| 64 | Ga0105249_10245477 | 3300009553 | Unclassified | 1772 |
| 65 | Ga0105239_10112035 | 3300010375 | Unclassified | 3025 |
| 66 | Ga0157373_10000213 | 3300013100 | Bacteria | 47549 |
| 67 | Ga0157373_10001354 | 3300013100 | Bacteria | 18804 |
| 68 | Ga0157369_10003553 | 3300013105 | Bacteria | 18516 |
| 69 | Ga0157378_10000045 | 3300013297 | Bacteria | 106376 |
| 70 | Ga0157372_10004801 | 3300013307 | Bacteria | 14361 |
| 71 | Ga0157372_10685408 | 3300013307 | Bacteria | 1193 |
| 72 | Ga0157375_10083320 | 3300013308 | Unclassified | 3243 |
| 73 | Ga0157375_10256726 | 3300013308 | Bacteria | 1909 |
| 74 | Ga0163163_10004718 | 3300014325 | Bacteria | 11678 |
| 75 | Ga0163163_10416308 | 3300014325 | Bacteria | 1402 |
| 76 | Ga0157380_10013818 | 3300014326 | Bacteria | 5896 |
| 77 | Ga0157380_10368612 | 3300014326 | Bacteria | 1351 |
| 78 | Ga0157379_10159409 | 3300014968 | Bacteria | 2036 |
| 79 | Ga0213873_10007541 | 3300021358 | Bacteria | 2184 |
| 80 | Ga0213876_10000064 | 3300021384 | Bacteria | 128492 |
| 81 | Ga0209148_1006469 | 3300025254 | Bacteria | 2537 |
| 82 | Ga0207666_1004318 | 3300025271 | Bacteria | 1779 |
| 83 | Ga0209758_1000258 | 3300025297 | Bacteria | 106281 |
| 84 | Ga0209758_1011738 | 3300025297 | Bacteria | 5023 |
| 85 | Ga0209758_1011898 | 3300025297 | Bacteria | 4958 |
| 86 | Ga0207692_10010664 | 3300025898 | Bacteria | 3882 |
| 87 | Ga0207710_10121921 | 3300025900 | Bacteria | 1246 |
| 88 | Ga0207688_10081259 | 3300025901 | Bacteria | 1851 |
| 89 | Ga0207693_10058721 | 3300025915 | Bacteria | 3013 |
| 90 | Ga0207693_10362342 | 3300025915 | Unclassified | 1134 |
| 91 | Ga0207663_10012609 | 3300025916 | Bacteria | 4577 |
| 92 | Ga0207663_10284520 | 3300025916 | Unclassified | 1229 |
| 93 | Ga0207660_10030200 | 3300025917 | Bacteria | 3724 |
| 94 | Ga0207650_10039229 | 3300025925 | Bacteria | 3461 |
| 95 | Ga0207650_10148517 | 3300025925 | Unclassified | 1848 |
| 96 | Ga0207700_10060063 | 3300025928 | Bacteria | 2878 |
| 97 | Ga0207664_10014328 | 3300025929 | Bacteria | 5723 |
| 98 | Ga0207644_10003905 | 3300025931 | Bacteria | 9666 |
| 99 | Ga0207644_10055082 | 3300025931 | Bacteria | 2866 |
| 100 | Ga0207669_10355447 | 3300025937 | Bacteria | 1133 |
| 101 | Ga0207704_10136216 | 3300025938 | Bacteria | 1709 |
| 102 | Ga0207665_10005990 | 3300025939 | Bacteria | 8081 |
| 103 | Ga0207691_10079810 | 3300025940 | Bacteria | 2944 |
| 104 | Ga0207691_10221700 | 3300025940 | Bacteria | 1639 |
| 105 | Ga0207689_10067550 | 3300025942 | Bacteria | 2938 |
| 106 | Ga0207679_10151239 | 3300025945 | Unclassified | 1889 |
| 107 | Ga0207651_10010669 | 3300025960 | Bacteria | 5104 |
| 108 | Ga0207703_10379634 | 3300026035 | Bacteria | 1307 |
| 109 | Ga0207675_100044136 | 3300026118 | Bacteria | 4164 |
| 110 | Ga0207675_100134295 | 3300026118 | Bacteria | 2347 |
| 111 | Ga0268266_10006927 | 3300028379 | Bacteria | 10313 |
| 112 | Ga0268266_10084916 | 3300028379 | Bacteria | 2765 |
| 113 | Ga0268265_10127404 | 3300028380 | Bacteria | 2109 |
| 114 | Ga0268265_10319066 | 3300028380 | Bacteria | 1406 |
| 115 | Ga0268264_10271709 | 3300028381 | Bacteria | 1584 |
| 116 | Ga0307408_100015437 | 3300031548 | Bacteria | 5084 |
| 117 | Ga0307408_100137273 | 3300031548 | Bacteria | 1915 |
| 118 | Ga0307405_10004857 | 3300031731 | Bacteria | 6417 |
| 119 | Ga0307405_10008652 | 3300031731 | Bacteria | 5174 |
| 120 | Ga0307413_10032219 | 3300031824 | Bacteria | 2968 |
| 121 | Ga0307413_10035825 | 3300031824 | Bacteria | 2851 |
| 122 | Ga0307410_10015393 | 3300031852 | Bacteria | 4534 |
| 123 | Ga0307410_10106226 | 3300031852 | Bacteria | 2023 |
| 124 | Ga0307410_10147726 | 3300031852 | Bacteria | 1746 |
| 125 | Ga0307406_10118136 | 3300031901 | Bacteria | 1838 |
| 126 | Ga0307406_10343506 | 3300031901 | Bacteria | 1163 |
| 127 | Ga0307409_100392199 | 3300031995 | Unclassified | 1323 |
| 128 | Ga0307416_100011402 | 3300032002 | Bacteria | 5925 |
| 129 | Ga0307414_10183876 | 3300032004 | Bacteria | 1684 |
| 130 | Ga0307411_10081172 | 3300032005 | Bacteria | 2232 |
| 131 | Ga0307415_100010004 | 3300032126 | Bacteria | 5351 |
| 132 | Ga0307415_100072405 | 3300032126 | Bacteria | 2427 |
| 133 | Ga0307415_100158437 | 3300032126 | Bacteria | 1752 |
| 134 | Ga0307510_10020618 | 3300033180 | Bacteria | 7699 |
| 135 | Ga0373926_0044343 | 3300035083 | Bacteria | 1593 |
| 136 | Ga0373951_0003892 | 3300035091 | Bacteria | 3590 |
| 137 | Ga0373923_0050338 | 3300035111 | Bacteria | 1745 |
| 138 | Ga0373923_0114395 | 3300035111 | Bacteria | 1201 |
| 139 | Ga0373936_0084494 | 3300035113 | Bacteria | 1325 |
| 140 | Ga0373936_0101249 | 3300035113 | Bacteria | 1216 |
| 141 | Ga0373945_0008963 | 3300035116 | Bacteria | 3271 |
| 142 | Ga0373956_0136262 | 3300035119 | Bacteria | 1151 |
| 143 | Ga0373956_0142073 | 3300035119 | Bacteria | 1127 |
| 144 | Ga0373943_0006692 | 3300035170 | Bacteria | 5172 |
| 145 | Ga0373946_0013623 | 3300035171 | Bacteria | 3058 |
| 146 | Ga0373955_0004812 | 3300035172 | Bacteria | 6015 |
| 147 | Ga0373962_0004466 | 3300035242 | Bacteria | 3382 |
| 148 | Ga0373931_0003490 | 3300035691 | Bacteria | 7073 |
| 149 | Ga0373935_0008921 | 3300035692 | Bacteria | 6000 |
| 150 | Ga0373935_0025154 | 3300035692 | Bacteria | 3669 |
| 151 | Ga0373927_0000531 | 3300035695 | Bacteria | 28946 |
| 152 | Ga0373927_0012211 | 3300035695 | Bacteria | 5713 |
| 153 | Ga0373927_0022265 | 3300035695 | Bacteria | 4152 |
| 154 | Ga0373927_0023240 | 3300035695 | Bacteria | 4061 |
| 155 | Ga0373933_0053671 | 3300035724 | Bacteria | 2414 |
| 156 | Ga0373947_0010535 | 3300035725 | Bacteria | 5303 |
| 157 | Ga0373947_0054932 | 3300035725 | Bacteria | 2404 |
| 158 | Ga0373947_0067340 | 3300035725 | Bacteria | 2187 |
| 159 | Ga0373947_0128734 | 3300035725 | Bacteria | 1614 |
| 160 | Ga0373937_0000705 | 3300036401 | Bacteria | 29113 |
| 161 | Ga0373937_0303804 | 3300036401 | Bacteria | 1508 |
| 162 | Ga0373925_0059007 | 3300037068 | Bacteria | 2877 |
| 163 | Ga0395900_0013008 | 3300037418 | Bacteria | 8504 |
| 164 | Ga0395900_0212687 | 3300037418 | Bacteria | 1952 |
| 165 | Ga0395898_0000252 | 3300037466 | Bacteria | 132492 |
| 166 | Ga0395901_0076463 | 3300038443 | Bacteria | 3493 |
| 167 | Ga0395901_0632353 | 3300038443 | Bacteria | 1076 |
| 168 | Ga0436365_0050989 | 3300039437 | Bacteria | 155528 |
| 169 | Ga0436360_0074122 | 3300039438 | Bacteria | 2502 |
| 170 | Ga0436363_1097581 | 3300039450 | Bacteria | 1499 |
| 171 | Ga0436362_0259066 | 3300039453 | Bacteria | 1284 |
| 172 | Ga0439455_0002059 | 3300042012 | Bacteria | 3570 |
| 173 | Ga0439435_0031077 | 3300042436 | Bacteria | 1450 |
| 174 | Ga0439464_0075401 | 3300042439 | Bacteria | 1002 |
| 175 | Ga0451577_0109154 | 3300042876 | Bacteria | 2474 |
| 176 | Ga0466957_0049074 | 3300044842 | Bacteria | 2566 |
| 177 | Ga0466958_0001360 | 3300045836 | Bacteria | 11557 |
| 178 | Ga0495603_0001299 | 3300046455 | Bacteria | 14536 |
| 179 | Ga0495629_0180032 | 3300046459 | Bacteria | 1465 |
| 180 | Ga0495641_0030880 | 3300046461 | Bacteria | 2564 |
| 181 | Ga0495653_0107140 | 3300046463 | Bacteria | 2014 |
| 182 | Ga0495580_0022581 | 3300046472 | Bacteria | 4630 |
| 183 | Ga0495580_0207366 | 3300046472 | Bacteria | 1349 |
| 184 | Ga0495582_0058588 | 3300046473 | Bacteria | 2124 |
| 185 | Ga0495582_0114851 | 3300046473 | Bacteria | 1513 |
| 186 | Ga0495639_0022928 | 3300046475 | Bacteria | 2741 |
| 187 | Ga0495639_0047547 | 3300046475 | Bacteria | 1944 |
| 188 | Ga0495662_0008526 | 3300046476 | Bacteria | 5038 |
| 189 | Ga0495662_0018842 | 3300046476 | Bacteria | 3340 |
| 190 | Ga0495664_0007910 | 3300046477 | Bacteria | 5917 |
| 191 | Ga0495664_0013639 | 3300046477 | Bacteria | 4611 |
| 192 | Ga0495594_0067493 | 3300046499 | Bacteria | 1985 |
| 193 | Ga0495618_0108545 | 3300046514 | Bacteria | 1777 |
| 194 | Ga0495630_0023217 | 3300046517 | Bacteria | 4584 |
| 195 | Ga0495630_0028086 | 3300046517 | Bacteria | 4180 |
| 196 | Ga0495630_0362579 | 3300046517 | Bacteria | 1109 |
| 197 | Ga0495630_0413761 | 3300046517 | Bacteria | 1033 |
| 198 | Ga0495652_0055497 | 3300046529 | Bacteria | 3369 |
| 199 | Ga0495652_0158534 | 3300046529 | Bacteria | 1760 |
| 200 | Ga0495665_0002564 | 3300046531 | Bacteria | 9806 |
| 201 | Ga0495665_0065711 | 3300046531 | Bacteria | 1915 |
| 202 | Ga0495640_0006326 | 3300046533 | Bacteria | 9385 |
| 203 | Ga0495640_0055335 | 3300046533 | Bacteria | 2714 |
| 204 | Ga0495587_0000662 | 3300046536 | Bacteria | 23067 |
| 205 | Ga0495609_0121465 | 3300046538 | Bacteria | 1123 |
| 206 | Ga0495645_0000950 | 3300046543 | Bacteria | 19812 |
| 207 | Ga0495645_0048483 | 3300046543 | Bacteria | 3094 |
| 208 | Ga0495667_0019344 | 3300046559 | Bacteria | 4595 |
| 209 | Ga0495656_0037944 | 3300046615 | Bacteria | 1993 |
| 210 | Ga0495634_0016625 | 3300046642 | Bacteria | 5258 |
| 211 | Ga0495634_0077377 | 3300046642 | Bacteria | 2182 |
| 212 | Ga0495635_0045550 | 3300046663 | Bacteria | 3027 |
| 213 | Ga0495635_0191605 | 3300046663 | Bacteria | 1388 |
| 214 | Ga0495588_0002128 | 3300046674 | Bacteria | 8491 |
| 215 | Ga0495623_0046579 | 3300046679 | Bacteria | 2752 |
| 216 | Ga0495623_0086503 | 3300046679 | Bacteria | 1932 |
| 217 | Ga0495647_0019957 | 3300046681 | Bacteria | 2402 |
| 218 | Ga0495658_0072926 | 3300046683 | Bacteria | 1998 |
| 219 | Ga0495669_0189562 | 3300046684 | Bacteria | 981 |
| 220 | Ga0495613_0047255 | 3300046689 | Bacteria | 3180 |
| 221 | Ga0495613_0079478 | 3300046689 | Bacteria | 2385 |
| 222 | Ga0495613_0207477 | 3300046689 | Unclassified | 1379 |
| 223 | Ga0495624_0046941 | 3300046690 | Bacteria | 2745 |
| 224 | Ga0495589_0092096 | 3300046794 | Bacteria | 1472 |
| 225 | Ga0495604_0041851 | 3300047317 | Bacteria | 3592 |
| 226 | Ga0495604_0150604 | 3300047317 | Bacteria | 1653 |
| 227 | Ga0495604_0171894 | 3300047317 | Bacteria | 1523 |
| 228 | Ga0495636_0067061 | 3300047318 | Bacteria | 1527 |
| 229 | Ga0495674_0002143 | 3300047319 | Bacteria | 19396 |
| 230 | Ga0495674_0090348 | 3300047319 | Unclassified | 2617 |
| 231 | Ga0495674_0434634 | 3300047319 | Unclassified | 1056 |
| 232 | Ga0495680_0333696 | 3300047322 | Bacteria | 1059 |
| 233 | Ga0495677_0050238 | 3300047445 | Bacteria | 1534 |
| 234 | Ga0495684_0034450 | 3300047471 | Bacteria | 3885 |
| 235 | Ga0495684_0037154 | 3300047471 | Bacteria | 3735 |
| 236 | Ga0495684_0069708 | 3300047471 | Bacteria | 2673 |
| 237 | Ga0495684_0117947 | 3300047471 | Bacteria | 2000 |
| 238 | Ga0495593_0086306 | 3300047673 | Bacteria | 1619 |
| 239 | Ga0496100_0208868 | 3300048903 | Bacteria | 1427 |
| 240 | Ga0496100_0264715 | 3300048903 | Unclassified | 1276 |
| 241 | Ga0496102_0170302 | 3300048905 | Bacteria | 2050 |
| 242 | Ga0496106_0153261 | 3300048909 | Unclassified | 1819 |
| 243 | Ga0496109_0012529 | 3300048912 | Bacteria | 7320 |
| 244 | Ga0496109_0270844 | 3300048912 | Bacteria | 1600 |
| 245 | Ga0496109_0286070 | 3300048912 | Bacteria | 1554 |
| 246 | Ga0496109_0429494 | 3300048912 | Bacteria | 1248 |
| 247 | Ga0496110_0029138 | 3300048913 | Bacteria | 4748 |
| 248 | Ga0496110_0301237 | 3300048913 | Bacteria | 1460 |
| 249 | Ga0496110_0463210 | 3300048913 | Unclassified | 1155 |
| 250 | Ga0496111_0021257 | 3300048914 | Bacteria | 4529 |
| 251 | Ga0496111_0239399 | 3300048914 | Bacteria | 1348 |
| 252 | Ga0496112_0013996 | 3300048915 | Bacteria | 7424 |
| 253 | Ga0496112_0236590 | 3300048915 | Unclassified | 1780 |
| 254 | Ga0496113_0003135 | 3300048916 | Bacteria | 9839 |
| 255 | Ga0496115_0172121 | 3300048918 | Bacteria | 1791 |
| 256 | Ga0496121_0146576 | 3300048924 | Bacteria | 1743 |
| 257 | Ga0496125_0129483 | 3300048928 | Bacteria | 1780 |
| 258 | Ga0496126_0077330 | 3300048929 | Bacteria | 2950 |
| 259 | Ga0496126_0185492 | 3300048929 | Bacteria | 1764 |
| 260 | Ga0501032_0039227 | 3300049569 | Unclassified | 3222 |
| 261 | Ga0501032_0085609 | 3300049569 | Bacteria | 2095 |
| 262 | Ga0501033_0076171 | 3300049570 | Bacteria | 2463 |
| 263 | Ga0501033_0127488 | 3300049570 | Bacteria | 1845 |
| 264 | Ga0501034_0005078 | 3300049571 | Bacteria | 14455 |
| 265 | Ga0501036_0484679 | 3300049572 | Bacteria | 1029 |
| 266 | Ga0501037_0123258 | 3300049573 | Bacteria | 1862 |
| 267 | Ga0501038_0097377 | 3300049574 | Bacteria | 2454 |
| 268 | Ga0501038_0102679 | 3300049574 | Bacteria | 2379 |
| 269 | Ga0501039_0027004 | 3300049575 | Bacteria | 4413 |
| 270 | Ga0501039_0096961 | 3300049575 | Bacteria | 2299 |
| 271 | Ga0501040_0102826 | 3300049576 | Bacteria | 1994 |
| 272 | Ga0501043_0000156 | 3300049579 | Bacteria | 62295 |
| 273 | Ga0501043_0016082 | 3300049579 | Bacteria | 5868 |
| 274 | Ga0501046_0101167 | 3300049580 | Bacteria | 2211 |
| 275 | Ga0501047_0003290 | 3300049581 | Bacteria | 15308 |
| 276 | Ga0501047_0188747 | 3300049581 | Bacteria | 1925 |
| 277 | Ga0501048_0106234 | 3300049582 | Bacteria | 1981 |
| 278 | Ga0501067_0075998 | 3300049583 | Bacteria | 1861 |
| 279 | Ga0501070_0007944 | 3300049586 | Bacteria | 8989 |
| 280 | Ga0501072_0001298 | 3300049588 | Bacteria | 18695 |
| 281 | Ga0501072_0003682 | 3300049588 | Bacteria | 11563 |
| 282 | Ga0501075_0111146 | 3300049591 | Bacteria | 2083 |
| 283 | Ga0501075_0397785 | 3300049591 | Bacteria | 1050 |
| 284 | Ga0501076_0049570 | 3300049592 | Bacteria | 3322 |
| 285 | Ga0501076_0074524 | 3300049592 | Bacteria | 2719 |
| 286 | Ga0501077_0021975 | 3300049593 | Bacteria | 4039 |
| 287 | Ga0501077_0031390 | 3300049593 | Bacteria | 3380 |
| 288 | Ga0501080_0045847 | 3300049742 | Bacteria | 4071 |
| 289 | Ga0501081_0389705 | 3300049743 | Bacteria | 1030 |
| 290 | Ga0501083_0006317 | 3300049744 | Bacteria | 8401 |
| 291 | Ga0501035_0000002 | 3300049822 | Bacteria | 585447 |
| 292 | Ga0501035_0000670 | 3300049822 | Bacteria | 37580 |
| 293 | Ga0501035_0044474 | 3300049822 | Bacteria | 3999 |
| 294 | Ga0501035_0196484 | 3300049822 | Bacteria | 1732 |
| 295 | Ga0501044_0027005 | 3300049823 | Bacteria | 6073 |
| 296 | Ga0501045_0368090 | 3300049824 | Bacteria | 1070 |
| 297 | nmdc:mga05p37_245869_c1 | 3300050507 | Bacteria | 2148 |
| 298 | nmdc:mga05p37_91317_c1 | 3300050507 | Bacteria | 3752 |
| 299 | Ga0495601_0013861 | 3300053077 | Bacteria | 4854 |
| 300 | Ga0495601_0111349 | 3300053077 | Bacteria | 1773 |
| 301 | Ga0495612_0022479 | 3300053078 | Bacteria | 2527 |
| 302 | Ga0495619_0053723 | 3300053085 | Bacteria | 2666 |
| 303 | Ga0501084_0060987 | 3300054114 | Bacteria | 3157 |
| 304 | Ga0590071_020095 | 3300059421 | Bacteria | 1573 |
| 305 | Ga0501082_0003642 | 3300060353 | Bacteria | 13454 |
| 306 | Ga0501082_0020017 | 3300060353 | Bacteria | 5766 |
| 307 | Ga0530510_0023514 | 3300061734 | Bacteria | 4392 |
| 308 | Ga0530510_0241754 | 3300061734 | Bacteria | 1344 |
| 309 | 2513693974 | 2513237101 | Bacteria | 7952346 |
| 310 | 2723849274 | 2721755755 | Bacteria | 8322773 |
| 311 | 2793070567 | 2791355197 | Bacteria | 8420563 |
| 312 | 2842779483 | 2842775625 | Bacteria | 5587290 |
| 313 | 2855021776 | 2855020534 | Bacteria | 3204685 |
| 314 | 2874617544 | 2874612657 | Bacteria | 8252029 |
| 315 | 2874625582 | 2874620515 | Bacteria | 8290088 |
| 316 | 2881101346 | 2881101125 | Bacteria | 4590519 |
| 317 | 2881370177 | 2881364244 | Bacteria | 7710352 |
| 318 | 2885366619 | 2885366525 | Bacteria | 8326213 |
| 319 | 2904673528 | 2904666416 | Bacteria | 8226587 |
| 320 | 2922427541 | |||
| 321 | 8004028444 | 8004025490 | Bacteria | 4327753 |
| 322 | 8006930334 | 8006926726 | Bacteria | 6749210 |
| 323 | 8019555930 | 8019555841 | Bacteria | 9642137 |
| 324 | 8019569388 | 8019565922 | Bacteria | 9639779 |
| 325 | 8055226096 | 8055225921 | Bacteria | 3341787 |
| 326 | Ga0114129_10266690 | |||
| 327 | JGI25153J46596_10000217 | |||
| 328 | JGI25153J46596_10002120 | |||
| 329 | rootL2_10149336 | |||
| 330 | rootL2_10153856 | |||
| 331 | Ga0055542_1006403 | |||
| 332 | Ga0065712_10005480 | |||
| 333 | Ga0065712_10070269 | |||
| 334 | Ga0070658_10223717 | |||
| 335 | Ga0070670_100134188 | |||
| 336 | Ga0070670_100253428 | |||
| 337 | Ga0068869_100261862 | |||
| 338 | Ga0068869_100312914 | |||
| 339 | Ga0070680_100078703 | |||
| 340 | Ga0070689_100263921 | |||
| 341 | Ga0070689_100422589 | |||
| 342 | Ga0070687_100027762 | |||
| 343 | Ga0070692_10000261 | |||
| 344 | Ga0070668_100308810 | |||
| 345 | Ga0070669_100069033 | |||
| 346 | Ga0070671_100010475 | |||
| 347 | Ga0070674_100076893 | |||
| 348 | Ga0070673_100027476 | |||
| 349 | Ga0070688_100114024 | |||
| 350 | Ga0070659_100007736 | |||
| 351 | Ga0070667_100194968 | |||
| 352 | Ga0070709_10025220 | |||
| 353 | Ga0070714_100021861 | |||
| 354 | Ga0070714_100022358 | |||
| 355 | Ga0070713_100150990 | |||
| 356 | Ga0070710_10007338 | |||
| 357 | Ga0070701_10000129 | |||
| 358 | Ga0070711_100161811 | |||
| 359 | Ga0070700_100024144 | |||
| 360 | Ga0070663_100328469 | |||
| 361 | Ga0070678_100402391 | |||
| 362 | Ga0070681_10057493 | |||
| 363 | Ga0070672_100408788 | |||
| 364 | Ga0070665_100026398 | |||
| 365 | Ga0070665_100036229 | |||
| 366 | Ga0070664_100246754 | |||
| 367 | Ga0070664_100458529 | |||
| 368 | Ga0068859_100413996 | |||
| 369 | Ga0068861_100151795 | |||
| 370 | Ga0068860_100207646 | |||
| 371 | Ga0068862_100315635 | |||
| 372 | Ga0081538_10018999 | |||
| 373 | Ga0070717_10123713 | |||
| 374 | Ga0075365_10118020 | |||
| 375 | Ga0075432_10000354 | |||
| 376 | Ga0070716_100012503 | |||
| 377 | Ga0070712_100020365 | |||
| 378 | Ga0075428_100394553 | |||
| 379 | Ga0068865_100175798 | |||
| 380 | Ga0097620_100414039 | |||
| 381 | Ga0111539_10412567 | |||
| 382 | Ga0105247_10008742 | |||
| 383 | Ga0114129_10059090 | |||
| 384 | Ga0105248_10014497 | |||
| 385 | Ga0105248_10655235 | |||
| 386 | Ga0105237_10052908 | |||
| 387 | Ga0105249_10136115 | |||
| 388 | Ga0105249_10212169 | |||
| 389 | Ga0105249_10245477 | |||
| 390 | Ga0105239_10112035 | |||
| 391 | Ga0157373_10000213 | |||
| 392 | Ga0157373_10001354 | |||
| 393 | Ga0157369_10003553 | |||
| 394 | Ga0157378_10000045 | |||
| 395 | Ga0157372_10004801 | |||
| 396 | Ga0157372_10685408 | |||
| 397 | Ga0157375_10083320 | |||
| 398 | Ga0157375_10256726 | |||
| 399 | Ga0163163_10004718 | |||
| 400 | Ga0163163_10416308 | |||
| 401 | Ga0157380_10013818 | |||
| 402 | Ga0157380_10368612 | |||
| 403 | Ga0157379_10159409 | |||
| 404 | Ga0213873_10007541 | |||
| 405 | Ga0213876_10000064 | |||
| 406 | Ga0209148_1006469 | |||
| 407 | Ga0207666_1004318 | |||
| 408 | Ga0209758_1000258 | |||
| 409 | Ga0209758_1011738 | |||
| 410 | Ga0209758_1011898 | |||
| 411 | Ga0207692_10010664 | |||
| 412 | Ga0207710_10121921 | |||
| 413 | Ga0207688_10081259 | |||
| 414 | Ga0207693_10058721 | |||
| 415 | Ga0207693_10362342 | |||
| 416 | Ga0207663_10012609 | |||
| 417 | Ga0207663_10284520 | |||
| 418 | Ga0207660_10030200 | |||
| 419 | Ga0207650_10039229 | |||
| 420 | Ga0207650_10148517 | |||
| 421 | Ga0207700_10060063 | |||
| 422 | Ga0207664_10014328 | |||
| 423 | Ga0207644_10003905 | |||
| 424 | Ga0207644_10055082 | |||
| 425 | Ga0207669_10355447 | |||
| 426 | Ga0207704_10136216 | |||
| 427 | Ga0207665_10005990 | |||
| 428 | Ga0207691_10079810 | |||
| 429 | Ga0207691_10221700 | |||
| 430 | Ga0207689_10067550 | |||
| 431 | Ga0207679_10151239 | |||
| 432 | Ga0207651_10010669 | |||
| 433 | Ga0207703_10379634 | |||
| 434 | Ga0207675_100044136 | |||
| 435 | Ga0207675_100134295 | |||
| 436 | Ga0268266_10006927 | |||
| 437 | Ga0268266_10084916 | |||
| 438 | Ga0268265_10127404 | |||
| 439 | Ga0268265_10319066 | |||
| 440 | Ga0268264_10271709 | |||
| 441 | Ga0307408_100015437 | |||
| 442 | Ga0307408_100137273 | |||
| 443 | Ga0307405_10004857 | |||
| 444 | Ga0307405_10008652 | |||
| 445 | Ga0307413_10032219 | |||
| 446 | Ga0307413_10035825 | |||
| 447 | Ga0307410_10015393 | |||
| 448 | Ga0307410_10106226 | |||
| 449 | Ga0307410_10147726 | |||
| 450 | Ga0307406_10118136 | |||
| 451 | Ga0307406_10343506 | |||
| 452 | Ga0307409_100392199 | |||
| 453 | Ga0307416_100011402 | |||
| 454 | Ga0307414_10183876 | |||
| 455 | Ga0307411_10081172 | |||
| 456 | Ga0307415_100010004 | |||
| 457 | Ga0307415_100072405 | |||
| 458 | Ga0307415_100158437 | |||
| 459 | Ga0307510_10020618 | |||
| 460 | Ga0373926_0044343 | |||
| 461 | Ga0373951_0003892 | |||
| 462 | Ga0373923_0050338 | |||
| 463 | Ga0373923_0114395 | |||
| 464 | Ga0373936_0084494 | |||
| 465 | Ga0373936_0101249 | |||
| 466 | Ga0373945_0008963 | |||
| 467 | Ga0373956_0136262 | |||
| 468 | Ga0373956_0142073 | |||
| 469 | Ga0373943_0006692 | |||
| 470 | Ga0373946_0013623 | |||
| 471 | Ga0373955_0004812 | |||
| 472 | Ga0373962_0004466 | |||
| 473 | Ga0373931_0003490 | |||
| 474 | Ga0373935_0008921 | |||
| 475 | Ga0373935_0025154 | |||
| 476 | Ga0373927_0000531 | |||
| 477 | Ga0373927_0012211 | |||
| 478 | Ga0373927_0022265 | |||
| 479 | Ga0373927_0023240 | |||
| 480 | Ga0373933_0053671 | |||
| 481 | Ga0373947_0010535 | |||
| 482 | Ga0373947_0054932 | |||
| 483 | Ga0373947_0067340 | |||
| 484 | Ga0373947_0128734 | |||
| 485 | Ga0373937_0000705 | |||
| 486 | Ga0373937_0303804 | |||
| 487 | Ga0373925_0059007 | |||
| 488 | Ga0395900_0013008 | |||
| 489 | Ga0395900_0212687 | |||
| 490 | Ga0395898_0000252 | |||
| 491 | Ga0395901_0076463 | |||
| 492 | Ga0395901_0632353 | |||
| 493 | Ga0436365_0050989 | |||
| 494 | Ga0436360_0074122 | |||
| 495 | Ga0436363_1097581 | |||
| 496 | Ga0436362_0259066 | |||
| 497 | Ga0439455_0002059 | |||
| 498 | Ga0439435_0031077 | |||
| 499 | Ga0439464_0075401 | |||
| 500 | Ga0451577_0109154 | |||
| 501 | Ga0466957_0049074 | |||
| 502 | Ga0466958_0001360 | |||
| 503 | Ga0495603_0001299 | |||
| 504 | Ga0495629_0180032 | |||
| 505 | Ga0495641_0030880 | |||
| 506 | Ga0495653_0107140 | |||
| 507 | Ga0495580_0022581 | |||
| 508 | Ga0495580_0207366 | |||
| 509 | Ga0495582_0058588 | |||
| 510 | Ga0495582_0114851 | |||
| 511 | Ga0495639_0022928 | |||
| 512 | Ga0495639_0047547 | |||
| 513 | Ga0495662_0008526 | |||
| 514 | Ga0495662_0018842 | |||
| 515 | Ga0495664_0007910 | |||
| 516 | Ga0495664_0013639 | |||
| 517 | Ga0495594_0067493 | |||
| 518 | Ga0495618_0108545 | |||
| 519 | Ga0495630_0023217 | |||
| 520 | Ga0495630_0028086 | |||
| 521 | Ga0495630_0362579 | |||
| 522 | Ga0495630_0413761 | |||
| 523 | Ga0495652_0055497 | |||
| 524 | Ga0495652_0158534 | |||
| 525 | Ga0495665_0002564 | |||
| 526 | Ga0495665_0065711 | |||
| 527 | Ga0495640_0006326 | |||
| 528 | Ga0495640_0055335 | |||
| 529 | Ga0495587_0000662 | |||
| 530 | Ga0495609_0121465 | |||
| 531 | Ga0495645_0000950 | |||
| 532 | Ga0495645_0048483 | |||
| 533 | Ga0495667_0019344 | |||
| 534 | Ga0495656_0037944 | |||
| 535 | Ga0495634_0016625 | |||
| 536 | Ga0495634_0077377 | |||
| 537 | Ga0495635_0045550 | |||
| 538 | Ga0495635_0191605 | |||
| 539 | Ga0495588_0002128 | |||
| 540 | Ga0495623_0046579 | |||
| 541 | Ga0495623_0086503 | |||
| 542 | Ga0495647_0019957 | |||
| 543 | Ga0495658_0072926 | |||
| 544 | Ga0495669_0189562 | |||
| 545 | Ga0495613_0047255 | |||
| 546 | Ga0495613_0079478 | |||
| 547 | Ga0495613_0207477 | |||
| 548 | Ga0495624_0046941 | |||
| 549 | Ga0495589_0092096 | |||
| 550 | Ga0495604_0041851 | |||
| 551 | Ga0495604_0150604 | |||
| 552 | Ga0495604_0171894 | |||
| 553 | Ga0495636_0067061 | |||
| 554 | Ga0495674_0002143 | |||
| 555 | Ga0495674_0090348 | |||
| 556 | Ga0495674_0434634 | |||
| 557 | Ga0495680_0333696 | |||
| 558 | Ga0495677_0050238 | |||
| 559 | Ga0495684_0034450 | |||
| 560 | Ga0495684_0037154 | |||
| 561 | Ga0495684_0069708 | |||
| 562 | Ga0495684_0117947 | |||
| 563 | Ga0495593_0086306 | |||
| 564 | Ga0496100_0208868 | |||
| 565 | Ga0496100_0264715 | |||
| 566 | Ga0496102_0170302 | |||
| 567 | Ga0496106_0153261 | |||
| 568 | Ga0496109_0012529 | |||
| 569 | Ga0496109_0270844 | |||
| 570 | Ga0496109_0286070 | |||
| 571 | Ga0496109_0429494 | |||
| 572 | Ga0496110_0029138 | |||
| 573 | Ga0496110_0301237 | |||
| 574 | Ga0496110_0463210 | |||
| 575 | Ga0496111_0021257 | |||
| 576 | Ga0496111_0239399 | |||
| 577 | Ga0496112_0013996 | |||
| 578 | Ga0496112_0236590 | |||
| 579 | Ga0496113_0003135 | |||
| 580 | Ga0496115_0172121 | |||
| 581 | Ga0496121_0146576 | |||
| 582 | Ga0496125_0129483 | |||
| 583 | Ga0496126_0077330 | |||
| 584 | Ga0496126_0185492 | |||
| 585 | Ga0501032_0039227 | |||
| 586 | Ga0501032_0085609 | |||
| 587 | Ga0501033_0076171 | |||
| 588 | Ga0501033_0127488 | |||
| 589 | Ga0501034_0005078 | |||
| 590 | Ga0501036_0484679 | |||
| 591 | Ga0501037_0123258 | |||
| 592 | Ga0501038_0097377 | |||
| 593 | Ga0501038_0102679 | |||
| 594 | Ga0501039_0027004 | |||
| 595 | Ga0501039_0096961 | |||
| 596 | Ga0501040_0102826 | |||
| 597 | Ga0501043_0000156 | |||
| 598 | Ga0501043_0016082 | |||
| 599 | Ga0501046_0101167 | |||
| 600 | Ga0501047_0003290 | |||
| 601 | Ga0501047_0188747 | |||
| 602 | Ga0501048_0106234 | |||
| 603 | Ga0501067_0075998 | |||
| 604 | Ga0501070_0007944 | |||
| 605 | Ga0501072_0001298 | |||
| 606 | Ga0501072_0003682 | |||
| 607 | Ga0501075_0111146 | |||
| 608 | Ga0501075_0397785 | |||
| 609 | Ga0501076_0049570 | |||
| 610 | Ga0501076_0074524 | |||
| 611 | Ga0501077_0021975 | |||
| 612 | Ga0501077_0031390 | |||
| 613 | Ga0501080_0045847 | |||
| 614 | Ga0501081_0389705 | |||
| 615 | Ga0501083_0006317 | |||
| 616 | Ga0501035_0000002 | |||
| 617 | Ga0501035_0000670 | |||
| 618 | Ga0501035_0044474 | |||
| 619 | Ga0501035_0196484 | |||
| 620 | Ga0501044_0027005 | |||
| 621 | Ga0501045_0368090 | |||
| 622 | nmdc:mga05p37_245869_c1 | |||
| 623 | nmdc:mga05p37_91317_c1 | |||
| 624 | Ga0495601_0013861 | |||
| 625 | Ga0495601_0111349 | |||
| 626 | Ga0495612_0022479 | |||
| 627 | Ga0495619_0053723 | |||
| 628 | Ga0501084_0060987 | |||
| 629 | Ga0590071_020095 | |||
| 630 | Ga0501082_0003642 | |||
| 631 | Ga0501082_0020017 | |||
| 632 | Ga0530510_0023514 | |||
| 633 | Ga0530510_0241754 | |||
| 634 | 2513693974 | |||
| 635 | 2723849274 | |||
| 636 | 2793070567 | |||
| 637 | 2842779483 | |||
| 638 | 2855021776 | |||
| 639 | 2874617544 | |||
| 640 | 2874625582 | |||
| 641 | 2881101346 | |||
| 642 | 2881370177 | |||
| 643 | 2885366619 | |||
| 644 | 2904673528 | |||
| 645 | 2922427541 | |||
| 646 | 8004028444 | |||
| 647 | 8006930334 | |||
| 648 | 8019555930 | |||
| 649 | 8019569388 | |||
| 650 | 8055226096 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3uqd-assembly1.cif.gz_C | crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products | 0.9549 | 4 | 307 |
| 3n1c-assembly1.cif.gz_B | crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate | 0.9541 | 1 | 307 |
| 3cqd-assembly1.cif.gz_A-2 | structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli | 0.9511 | 1 | 307 |
| 3umo-assembly1.cif.gz_A | crystal structure of the phosphofructokinase-2 from escherichia coli in complex with potassium | 0.9509 | 1 | 307 |
| 3uqe-assembly1.cif.gz_A-2 | crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli | 0.9482 | 1 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WID3_12_317_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.976 | 4 | 309 | 3.40.1190.20 |
| af_P9WID3_12_317_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9667 | 4 | 309 | 3.40.1190.20 |
| 3umoB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9511 | 1 | 307 | 3.40.1190.20 |
| 3umoB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9392 | 1 | 307 | 3.40.1190.20 |
| 2abqB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9319 | 5 | 311 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q4BRC0-F1-model_v4 | Phosphofructokinase | 0.9968 | 1 | 313 |
GO:0003872
GO:0005524 GO:0005829 |
| AF-A0A1Q4BRC0-F1-model_v4 | Phosphofructokinase | 0.9936 | 1 | 313 |
GO:0003872
GO:0005524 GO:0005829 |
| AF-A0A1F4CTN5-F1-model_v4 | Phosphofructokinase | 0.9893 | 2 | 312 |
GO:0003872
GO:0005524 GO:0005829 |
| AF-I2DZD0-F1-model_v4 | Phosphofructokinase | 0.9812 | 1 | 307 |
GO:0003872
GO:0005524 GO:0005829 |
| AF-A0A7V1SJT9-F1-model_v4 | 1-phosphofructokinase family hexose kinase | 0.9812 | 1 | 182 |
GO:0003872
GO:0005524 GO:0005829 |