F407796

General Info

Members Datasets Scaffolds Average Seq Length
325 226 650 314

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10266690|Ga0114129_102666902
Length 368
Sequence MFKPIRDHSCQQTGVVANAHSGRNIGVRCMAIAVQQAAIAICSRGNRQTGNAGTMQQKILTVAVNPAVDLSTRVERMLANRKLRCAGAHVEPGGGGINVSRVIRGFGGQSAAFVALGGPTGRTLRELMKQEGLDVLEFPIAQETRQNVTVDETRRERQYRLVLQGPHWSGKEVKAALARIERLAKDHDYVVATGSLPPGVPEGFYASIARIVRRQGGRMILDTSGPPLQAALEAGVYLVKPNHIEFRDLGGAHSTDWKTMARVGHRLQERGKAEIMIVTRGDLGALAILPDSAWRLQSPKGKVVSLVGAGDSLIGAFVLALARGKPLLEACRLGVAAASAAVEAPGSELASRKETLRIARRTKVWEVG

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
211 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
212 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
213 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
214 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
215 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
216 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
217 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
218 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
219 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
220 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
221 2922425934
222 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
223 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
224 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
225 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
226 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 1.85
Rhizoplane 5.23
Rhizosphere 84.92
Stem 0
Stem Tuber 0.31
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10266690 3300009147 Bacteria 2292
2 JGI25153J46596_10000217 3300003215 Bacteria 49414
3 JGI25153J46596_10002120 3300003215 Bacteria 11609
4 rootL2_10149336 3300003322 Bacteria 1573
5 rootL2_10153856 3300003322 Bacteria 1257
6 Ga0055542_1006403 3300003762 Bacteria 2519
7 Ga0065712_10005480 3300005290 Unclassified 4424
8 Ga0065712_10070269 3300005290 Bacteria 6157
9 Ga0070658_10223717 3300005327 Bacteria 1592
10 Ga0070670_100134188 3300005331 Unclassified 2139
11 Ga0070670_100253428 3300005331 Bacteria 1534
12 Ga0068869_100261862 3300005334 Bacteria 1384
13 Ga0068869_100312914 3300005334 Bacteria 1271
14 Ga0070680_100078703 3300005336 Bacteria 2716
15 Ga0070689_100263921 3300005340 Bacteria 1424
16 Ga0070689_100422589 3300005340 Bacteria 1130
17 Ga0070687_100027762 3300005343 Bacteria 2738
18 Ga0070692_10000261 3300005345 Bacteria 14687
19 Ga0070668_100308810 3300005347 Bacteria 1328
20 Ga0070669_100069033 3300005353 Bacteria 2610
21 Ga0070671_100010475 3300005355 Bacteria 7439
22 Ga0070674_100076893 3300005356 Bacteria 2374
23 Ga0070673_100027476 3300005364 Bacteria 4219
24 Ga0070688_100114024 3300005365 Unclassified 1801
25 Ga0070659_100007736 3300005366 Bacteria 7813
26 Ga0070667_100194968 3300005367 Bacteria 1796
27 Ga0070709_10025220 3300005434 Bacteria 3510
28 Ga0070714_100021861 3300005435 Bacteria 5237
29 Ga0070714_100022358 3300005435 Bacteria 5185
30 Ga0070713_100150990 3300005436 Unclassified 2067
31 Ga0070710_10007338 3300005437 Bacteria 5335
32 Ga0070701_10000129 3300005438 Bacteria 22285
33 Ga0070711_100161811 3300005439 Unclassified 1697
34 Ga0070700_100024144 3300005441 Bacteria 3566
35 Ga0070663_100328469 3300005455 Bacteria 1232
36 Ga0070678_100402391 3300005456 Bacteria 1190
37 Ga0070681_10057493 3300005458 Bacteria 3870
38 Ga0070672_100408788 3300005543 Bacteria 1164
39 Ga0070665_100026398 3300005548 Bacteria 5849
40 Ga0070665_100036229 3300005548 Bacteria 4963
41 Ga0070664_100246754 3300005564 Bacteria 1604
42 Ga0070664_100458529 3300005564 Unclassified 1171
43 Ga0068859_100413996 3300005617 Bacteria 1444
44 Ga0068861_100151795 3300005719 Bacteria 1902
45 Ga0068860_100207646 3300005843 Bacteria 1899
46 Ga0068862_100315635 3300005844 Bacteria 1441
47 Ga0081538_10018999 3300005981 Bacteria 5131
48 Ga0070717_10123713 3300006028 Unclassified 2218
49 Ga0075365_10118020 3300006038 Bacteria 1828
50 Ga0075432_10000354 3300006058 Bacteria 13152
51 Ga0070716_100012503 3300006173 Bacteria 4304
52 Ga0070712_100020365 3300006175 Bacteria 4341
53 Ga0075428_100394553 3300006844 Bacteria 1483
54 Ga0068865_100175798 3300006881 Bacteria 1645
55 Ga0097620_100414039 3300006931 Bacteria 1444
56 Ga0111539_10412567 3300009094 Bacteria 1573
57 Ga0105247_10008742 3300009101 Bacteria 6180
58 Ga0114129_10059090 3300009147 Bacteria 5361
59 Ga0105248_10014497 3300009177 Bacteria 8676
60 Ga0105248_10655235 3300009177 Bacteria 1185
61 Ga0105237_10052908 3300009545 Bacteria 4074
62 Ga0105249_10136115 3300009553 Bacteria 2351
63 Ga0105249_10212169 3300009553 Bacteria 1900
64 Ga0105249_10245477 3300009553 Unclassified 1772
65 Ga0105239_10112035 3300010375 Unclassified 3025
66 Ga0157373_10000213 3300013100 Bacteria 47549
67 Ga0157373_10001354 3300013100 Bacteria 18804
68 Ga0157369_10003553 3300013105 Bacteria 18516
69 Ga0157378_10000045 3300013297 Bacteria 106376
70 Ga0157372_10004801 3300013307 Bacteria 14361
71 Ga0157372_10685408 3300013307 Bacteria 1193
72 Ga0157375_10083320 3300013308 Unclassified 3243
73 Ga0157375_10256726 3300013308 Bacteria 1909
74 Ga0163163_10004718 3300014325 Bacteria 11678
75 Ga0163163_10416308 3300014325 Bacteria 1402
76 Ga0157380_10013818 3300014326 Bacteria 5896
77 Ga0157380_10368612 3300014326 Bacteria 1351
78 Ga0157379_10159409 3300014968 Bacteria 2036
79 Ga0213873_10007541 3300021358 Bacteria 2184
80 Ga0213876_10000064 3300021384 Bacteria 128492
81 Ga0209148_1006469 3300025254 Bacteria 2537
82 Ga0207666_1004318 3300025271 Bacteria 1779
83 Ga0209758_1000258 3300025297 Bacteria 106281
84 Ga0209758_1011738 3300025297 Bacteria 5023
85 Ga0209758_1011898 3300025297 Bacteria 4958
86 Ga0207692_10010664 3300025898 Bacteria 3882
87 Ga0207710_10121921 3300025900 Bacteria 1246
88 Ga0207688_10081259 3300025901 Bacteria 1851
89 Ga0207693_10058721 3300025915 Bacteria 3013
90 Ga0207693_10362342 3300025915 Unclassified 1134
91 Ga0207663_10012609 3300025916 Bacteria 4577
92 Ga0207663_10284520 3300025916 Unclassified 1229
93 Ga0207660_10030200 3300025917 Bacteria 3724
94 Ga0207650_10039229 3300025925 Bacteria 3461
95 Ga0207650_10148517 3300025925 Unclassified 1848
96 Ga0207700_10060063 3300025928 Bacteria 2878
97 Ga0207664_10014328 3300025929 Bacteria 5723
98 Ga0207644_10003905 3300025931 Bacteria 9666
99 Ga0207644_10055082 3300025931 Bacteria 2866
100 Ga0207669_10355447 3300025937 Bacteria 1133
101 Ga0207704_10136216 3300025938 Bacteria 1709
102 Ga0207665_10005990 3300025939 Bacteria 8081
103 Ga0207691_10079810 3300025940 Bacteria 2944
104 Ga0207691_10221700 3300025940 Bacteria 1639
105 Ga0207689_10067550 3300025942 Bacteria 2938
106 Ga0207679_10151239 3300025945 Unclassified 1889
107 Ga0207651_10010669 3300025960 Bacteria 5104
108 Ga0207703_10379634 3300026035 Bacteria 1307
109 Ga0207675_100044136 3300026118 Bacteria 4164
110 Ga0207675_100134295 3300026118 Bacteria 2347
111 Ga0268266_10006927 3300028379 Bacteria 10313
112 Ga0268266_10084916 3300028379 Bacteria 2765
113 Ga0268265_10127404 3300028380 Bacteria 2109
114 Ga0268265_10319066 3300028380 Bacteria 1406
115 Ga0268264_10271709 3300028381 Bacteria 1584
116 Ga0307408_100015437 3300031548 Bacteria 5084
117 Ga0307408_100137273 3300031548 Bacteria 1915
118 Ga0307405_10004857 3300031731 Bacteria 6417
119 Ga0307405_10008652 3300031731 Bacteria 5174
120 Ga0307413_10032219 3300031824 Bacteria 2968
121 Ga0307413_10035825 3300031824 Bacteria 2851
122 Ga0307410_10015393 3300031852 Bacteria 4534
123 Ga0307410_10106226 3300031852 Bacteria 2023
124 Ga0307410_10147726 3300031852 Bacteria 1746
125 Ga0307406_10118136 3300031901 Bacteria 1838
126 Ga0307406_10343506 3300031901 Bacteria 1163
127 Ga0307409_100392199 3300031995 Unclassified 1323
128 Ga0307416_100011402 3300032002 Bacteria 5925
129 Ga0307414_10183876 3300032004 Bacteria 1684
130 Ga0307411_10081172 3300032005 Bacteria 2232
131 Ga0307415_100010004 3300032126 Bacteria 5351
132 Ga0307415_100072405 3300032126 Bacteria 2427
133 Ga0307415_100158437 3300032126 Bacteria 1752
134 Ga0307510_10020618 3300033180 Bacteria 7699
135 Ga0373926_0044343 3300035083 Bacteria 1593
136 Ga0373951_0003892 3300035091 Bacteria 3590
137 Ga0373923_0050338 3300035111 Bacteria 1745
138 Ga0373923_0114395 3300035111 Bacteria 1201
139 Ga0373936_0084494 3300035113 Bacteria 1325
140 Ga0373936_0101249 3300035113 Bacteria 1216
141 Ga0373945_0008963 3300035116 Bacteria 3271
142 Ga0373956_0136262 3300035119 Bacteria 1151
143 Ga0373956_0142073 3300035119 Bacteria 1127
144 Ga0373943_0006692 3300035170 Bacteria 5172
145 Ga0373946_0013623 3300035171 Bacteria 3058
146 Ga0373955_0004812 3300035172 Bacteria 6015
147 Ga0373962_0004466 3300035242 Bacteria 3382
148 Ga0373931_0003490 3300035691 Bacteria 7073
149 Ga0373935_0008921 3300035692 Bacteria 6000
150 Ga0373935_0025154 3300035692 Bacteria 3669
151 Ga0373927_0000531 3300035695 Bacteria 28946
152 Ga0373927_0012211 3300035695 Bacteria 5713
153 Ga0373927_0022265 3300035695 Bacteria 4152
154 Ga0373927_0023240 3300035695 Bacteria 4061
155 Ga0373933_0053671 3300035724 Bacteria 2414
156 Ga0373947_0010535 3300035725 Bacteria 5303
157 Ga0373947_0054932 3300035725 Bacteria 2404
158 Ga0373947_0067340 3300035725 Bacteria 2187
159 Ga0373947_0128734 3300035725 Bacteria 1614
160 Ga0373937_0000705 3300036401 Bacteria 29113
161 Ga0373937_0303804 3300036401 Bacteria 1508
162 Ga0373925_0059007 3300037068 Bacteria 2877
163 Ga0395900_0013008 3300037418 Bacteria 8504
164 Ga0395900_0212687 3300037418 Bacteria 1952
165 Ga0395898_0000252 3300037466 Bacteria 132492
166 Ga0395901_0076463 3300038443 Bacteria 3493
167 Ga0395901_0632353 3300038443 Bacteria 1076
168 Ga0436365_0050989 3300039437 Bacteria 155528
169 Ga0436360_0074122 3300039438 Bacteria 2502
170 Ga0436363_1097581 3300039450 Bacteria 1499
171 Ga0436362_0259066 3300039453 Bacteria 1284
172 Ga0439455_0002059 3300042012 Bacteria 3570
173 Ga0439435_0031077 3300042436 Bacteria 1450
174 Ga0439464_0075401 3300042439 Bacteria 1002
175 Ga0451577_0109154 3300042876 Bacteria 2474
176 Ga0466957_0049074 3300044842 Bacteria 2566
177 Ga0466958_0001360 3300045836 Bacteria 11557
178 Ga0495603_0001299 3300046455 Bacteria 14536
179 Ga0495629_0180032 3300046459 Bacteria 1465
180 Ga0495641_0030880 3300046461 Bacteria 2564
181 Ga0495653_0107140 3300046463 Bacteria 2014
182 Ga0495580_0022581 3300046472 Bacteria 4630
183 Ga0495580_0207366 3300046472 Bacteria 1349
184 Ga0495582_0058588 3300046473 Bacteria 2124
185 Ga0495582_0114851 3300046473 Bacteria 1513
186 Ga0495639_0022928 3300046475 Bacteria 2741
187 Ga0495639_0047547 3300046475 Bacteria 1944
188 Ga0495662_0008526 3300046476 Bacteria 5038
189 Ga0495662_0018842 3300046476 Bacteria 3340
190 Ga0495664_0007910 3300046477 Bacteria 5917
191 Ga0495664_0013639 3300046477 Bacteria 4611
192 Ga0495594_0067493 3300046499 Bacteria 1985
193 Ga0495618_0108545 3300046514 Bacteria 1777
194 Ga0495630_0023217 3300046517 Bacteria 4584
195 Ga0495630_0028086 3300046517 Bacteria 4180
196 Ga0495630_0362579 3300046517 Bacteria 1109
197 Ga0495630_0413761 3300046517 Bacteria 1033
198 Ga0495652_0055497 3300046529 Bacteria 3369
199 Ga0495652_0158534 3300046529 Bacteria 1760
200 Ga0495665_0002564 3300046531 Bacteria 9806
201 Ga0495665_0065711 3300046531 Bacteria 1915
202 Ga0495640_0006326 3300046533 Bacteria 9385
203 Ga0495640_0055335 3300046533 Bacteria 2714
204 Ga0495587_0000662 3300046536 Bacteria 23067
205 Ga0495609_0121465 3300046538 Bacteria 1123
206 Ga0495645_0000950 3300046543 Bacteria 19812
207 Ga0495645_0048483 3300046543 Bacteria 3094
208 Ga0495667_0019344 3300046559 Bacteria 4595
209 Ga0495656_0037944 3300046615 Bacteria 1993
210 Ga0495634_0016625 3300046642 Bacteria 5258
211 Ga0495634_0077377 3300046642 Bacteria 2182
212 Ga0495635_0045550 3300046663 Bacteria 3027
213 Ga0495635_0191605 3300046663 Bacteria 1388
214 Ga0495588_0002128 3300046674 Bacteria 8491
215 Ga0495623_0046579 3300046679 Bacteria 2752
216 Ga0495623_0086503 3300046679 Bacteria 1932
217 Ga0495647_0019957 3300046681 Bacteria 2402
218 Ga0495658_0072926 3300046683 Bacteria 1998
219 Ga0495669_0189562 3300046684 Bacteria 981
220 Ga0495613_0047255 3300046689 Bacteria 3180
221 Ga0495613_0079478 3300046689 Bacteria 2385
222 Ga0495613_0207477 3300046689 Unclassified 1379
223 Ga0495624_0046941 3300046690 Bacteria 2745
224 Ga0495589_0092096 3300046794 Bacteria 1472
225 Ga0495604_0041851 3300047317 Bacteria 3592
226 Ga0495604_0150604 3300047317 Bacteria 1653
227 Ga0495604_0171894 3300047317 Bacteria 1523
228 Ga0495636_0067061 3300047318 Bacteria 1527
229 Ga0495674_0002143 3300047319 Bacteria 19396
230 Ga0495674_0090348 3300047319 Unclassified 2617
231 Ga0495674_0434634 3300047319 Unclassified 1056
232 Ga0495680_0333696 3300047322 Bacteria 1059
233 Ga0495677_0050238 3300047445 Bacteria 1534
234 Ga0495684_0034450 3300047471 Bacteria 3885
235 Ga0495684_0037154 3300047471 Bacteria 3735
236 Ga0495684_0069708 3300047471 Bacteria 2673
237 Ga0495684_0117947 3300047471 Bacteria 2000
238 Ga0495593_0086306 3300047673 Bacteria 1619
239 Ga0496100_0208868 3300048903 Bacteria 1427
240 Ga0496100_0264715 3300048903 Unclassified 1276
241 Ga0496102_0170302 3300048905 Bacteria 2050
242 Ga0496106_0153261 3300048909 Unclassified 1819
243 Ga0496109_0012529 3300048912 Bacteria 7320
244 Ga0496109_0270844 3300048912 Bacteria 1600
245 Ga0496109_0286070 3300048912 Bacteria 1554
246 Ga0496109_0429494 3300048912 Bacteria 1248
247 Ga0496110_0029138 3300048913 Bacteria 4748
248 Ga0496110_0301237 3300048913 Bacteria 1460
249 Ga0496110_0463210 3300048913 Unclassified 1155
250 Ga0496111_0021257 3300048914 Bacteria 4529
251 Ga0496111_0239399 3300048914 Bacteria 1348
252 Ga0496112_0013996 3300048915 Bacteria 7424
253 Ga0496112_0236590 3300048915 Unclassified 1780
254 Ga0496113_0003135 3300048916 Bacteria 9839
255 Ga0496115_0172121 3300048918 Bacteria 1791
256 Ga0496121_0146576 3300048924 Bacteria 1743
257 Ga0496125_0129483 3300048928 Bacteria 1780
258 Ga0496126_0077330 3300048929 Bacteria 2950
259 Ga0496126_0185492 3300048929 Bacteria 1764
260 Ga0501032_0039227 3300049569 Unclassified 3222
261 Ga0501032_0085609 3300049569 Bacteria 2095
262 Ga0501033_0076171 3300049570 Bacteria 2463
263 Ga0501033_0127488 3300049570 Bacteria 1845
264 Ga0501034_0005078 3300049571 Bacteria 14455
265 Ga0501036_0484679 3300049572 Bacteria 1029
266 Ga0501037_0123258 3300049573 Bacteria 1862
267 Ga0501038_0097377 3300049574 Bacteria 2454
268 Ga0501038_0102679 3300049574 Bacteria 2379
269 Ga0501039_0027004 3300049575 Bacteria 4413
270 Ga0501039_0096961 3300049575 Bacteria 2299
271 Ga0501040_0102826 3300049576 Bacteria 1994
272 Ga0501043_0000156 3300049579 Bacteria 62295
273 Ga0501043_0016082 3300049579 Bacteria 5868
274 Ga0501046_0101167 3300049580 Bacteria 2211
275 Ga0501047_0003290 3300049581 Bacteria 15308
276 Ga0501047_0188747 3300049581 Bacteria 1925
277 Ga0501048_0106234 3300049582 Bacteria 1981
278 Ga0501067_0075998 3300049583 Bacteria 1861
279 Ga0501070_0007944 3300049586 Bacteria 8989
280 Ga0501072_0001298 3300049588 Bacteria 18695
281 Ga0501072_0003682 3300049588 Bacteria 11563
282 Ga0501075_0111146 3300049591 Bacteria 2083
283 Ga0501075_0397785 3300049591 Bacteria 1050
284 Ga0501076_0049570 3300049592 Bacteria 3322
285 Ga0501076_0074524 3300049592 Bacteria 2719
286 Ga0501077_0021975 3300049593 Bacteria 4039
287 Ga0501077_0031390 3300049593 Bacteria 3380
288 Ga0501080_0045847 3300049742 Bacteria 4071
289 Ga0501081_0389705 3300049743 Bacteria 1030
290 Ga0501083_0006317 3300049744 Bacteria 8401
291 Ga0501035_0000002 3300049822 Bacteria 585447
292 Ga0501035_0000670 3300049822 Bacteria 37580
293 Ga0501035_0044474 3300049822 Bacteria 3999
294 Ga0501035_0196484 3300049822 Bacteria 1732
295 Ga0501044_0027005 3300049823 Bacteria 6073
296 Ga0501045_0368090 3300049824 Bacteria 1070
297 nmdc:mga05p37_245869_c1 3300050507 Bacteria 2148
298 nmdc:mga05p37_91317_c1 3300050507 Bacteria 3752
299 Ga0495601_0013861 3300053077 Bacteria 4854
300 Ga0495601_0111349 3300053077 Bacteria 1773
301 Ga0495612_0022479 3300053078 Bacteria 2527
302 Ga0495619_0053723 3300053085 Bacteria 2666
303 Ga0501084_0060987 3300054114 Bacteria 3157
304 Ga0590071_020095 3300059421 Bacteria 1573
305 Ga0501082_0003642 3300060353 Bacteria 13454
306 Ga0501082_0020017 3300060353 Bacteria 5766
307 Ga0530510_0023514 3300061734 Bacteria 4392
308 Ga0530510_0241754 3300061734 Bacteria 1344
309 2513693974 2513237101 Bacteria 7952346
310 2723849274 2721755755 Bacteria 8322773
311 2793070567 2791355197 Bacteria 8420563
312 2842779483 2842775625 Bacteria 5587290
313 2855021776 2855020534 Bacteria 3204685
314 2874617544 2874612657 Bacteria 8252029
315 2874625582 2874620515 Bacteria 8290088
316 2881101346 2881101125 Bacteria 4590519
317 2881370177 2881364244 Bacteria 7710352
318 2885366619 2885366525 Bacteria 8326213
319 2904673528 2904666416 Bacteria 8226587
320 2922427541
321 8004028444 8004025490 Bacteria 4327753
322 8006930334 8006926726 Bacteria 6749210
323 8019555930 8019555841 Bacteria 9642137
324 8019569388 8019565922 Bacteria 9639779
325 8055226096 8055225921 Bacteria 3341787
326 Ga0114129_10266690
327 JGI25153J46596_10000217
328 JGI25153J46596_10002120
329 rootL2_10149336
330 rootL2_10153856
331 Ga0055542_1006403
332 Ga0065712_10005480
333 Ga0065712_10070269
334 Ga0070658_10223717
335 Ga0070670_100134188
336 Ga0070670_100253428
337 Ga0068869_100261862
338 Ga0068869_100312914
339 Ga0070680_100078703
340 Ga0070689_100263921
341 Ga0070689_100422589
342 Ga0070687_100027762
343 Ga0070692_10000261
344 Ga0070668_100308810
345 Ga0070669_100069033
346 Ga0070671_100010475
347 Ga0070674_100076893
348 Ga0070673_100027476
349 Ga0070688_100114024
350 Ga0070659_100007736
351 Ga0070667_100194968
352 Ga0070709_10025220
353 Ga0070714_100021861
354 Ga0070714_100022358
355 Ga0070713_100150990
356 Ga0070710_10007338
357 Ga0070701_10000129
358 Ga0070711_100161811
359 Ga0070700_100024144
360 Ga0070663_100328469
361 Ga0070678_100402391
362 Ga0070681_10057493
363 Ga0070672_100408788
364 Ga0070665_100026398
365 Ga0070665_100036229
366 Ga0070664_100246754
367 Ga0070664_100458529
368 Ga0068859_100413996
369 Ga0068861_100151795
370 Ga0068860_100207646
371 Ga0068862_100315635
372 Ga0081538_10018999
373 Ga0070717_10123713
374 Ga0075365_10118020
375 Ga0075432_10000354
376 Ga0070716_100012503
377 Ga0070712_100020365
378 Ga0075428_100394553
379 Ga0068865_100175798
380 Ga0097620_100414039
381 Ga0111539_10412567
382 Ga0105247_10008742
383 Ga0114129_10059090
384 Ga0105248_10014497
385 Ga0105248_10655235
386 Ga0105237_10052908
387 Ga0105249_10136115
388 Ga0105249_10212169
389 Ga0105249_10245477
390 Ga0105239_10112035
391 Ga0157373_10000213
392 Ga0157373_10001354
393 Ga0157369_10003553
394 Ga0157378_10000045
395 Ga0157372_10004801
396 Ga0157372_10685408
397 Ga0157375_10083320
398 Ga0157375_10256726
399 Ga0163163_10004718
400 Ga0163163_10416308
401 Ga0157380_10013818
402 Ga0157380_10368612
403 Ga0157379_10159409
404 Ga0213873_10007541
405 Ga0213876_10000064
406 Ga0209148_1006469
407 Ga0207666_1004318
408 Ga0209758_1000258
409 Ga0209758_1011738
410 Ga0209758_1011898
411 Ga0207692_10010664
412 Ga0207710_10121921
413 Ga0207688_10081259
414 Ga0207693_10058721
415 Ga0207693_10362342
416 Ga0207663_10012609
417 Ga0207663_10284520
418 Ga0207660_10030200
419 Ga0207650_10039229
420 Ga0207650_10148517
421 Ga0207700_10060063
422 Ga0207664_10014328
423 Ga0207644_10003905
424 Ga0207644_10055082
425 Ga0207669_10355447
426 Ga0207704_10136216
427 Ga0207665_10005990
428 Ga0207691_10079810
429 Ga0207691_10221700
430 Ga0207689_10067550
431 Ga0207679_10151239
432 Ga0207651_10010669
433 Ga0207703_10379634
434 Ga0207675_100044136
435 Ga0207675_100134295
436 Ga0268266_10006927
437 Ga0268266_10084916
438 Ga0268265_10127404
439 Ga0268265_10319066
440 Ga0268264_10271709
441 Ga0307408_100015437
442 Ga0307408_100137273
443 Ga0307405_10004857
444 Ga0307405_10008652
445 Ga0307413_10032219
446 Ga0307413_10035825
447 Ga0307410_10015393
448 Ga0307410_10106226
449 Ga0307410_10147726
450 Ga0307406_10118136
451 Ga0307406_10343506
452 Ga0307409_100392199
453 Ga0307416_100011402
454 Ga0307414_10183876
455 Ga0307411_10081172
456 Ga0307415_100010004
457 Ga0307415_100072405
458 Ga0307415_100158437
459 Ga0307510_10020618
460 Ga0373926_0044343
461 Ga0373951_0003892
462 Ga0373923_0050338
463 Ga0373923_0114395
464 Ga0373936_0084494
465 Ga0373936_0101249
466 Ga0373945_0008963
467 Ga0373956_0136262
468 Ga0373956_0142073
469 Ga0373943_0006692
470 Ga0373946_0013623
471 Ga0373955_0004812
472 Ga0373962_0004466
473 Ga0373931_0003490
474 Ga0373935_0008921
475 Ga0373935_0025154
476 Ga0373927_0000531
477 Ga0373927_0012211
478 Ga0373927_0022265
479 Ga0373927_0023240
480 Ga0373933_0053671
481 Ga0373947_0010535
482 Ga0373947_0054932
483 Ga0373947_0067340
484 Ga0373947_0128734
485 Ga0373937_0000705
486 Ga0373937_0303804
487 Ga0373925_0059007
488 Ga0395900_0013008
489 Ga0395900_0212687
490 Ga0395898_0000252
491 Ga0395901_0076463
492 Ga0395901_0632353
493 Ga0436365_0050989
494 Ga0436360_0074122
495 Ga0436363_1097581
496 Ga0436362_0259066
497 Ga0439455_0002059
498 Ga0439435_0031077
499 Ga0439464_0075401
500 Ga0451577_0109154
501 Ga0466957_0049074
502 Ga0466958_0001360
503 Ga0495603_0001299
504 Ga0495629_0180032
505 Ga0495641_0030880
506 Ga0495653_0107140
507 Ga0495580_0022581
508 Ga0495580_0207366
509 Ga0495582_0058588
510 Ga0495582_0114851
511 Ga0495639_0022928
512 Ga0495639_0047547
513 Ga0495662_0008526
514 Ga0495662_0018842
515 Ga0495664_0007910
516 Ga0495664_0013639
517 Ga0495594_0067493
518 Ga0495618_0108545
519 Ga0495630_0023217
520 Ga0495630_0028086
521 Ga0495630_0362579
522 Ga0495630_0413761
523 Ga0495652_0055497
524 Ga0495652_0158534
525 Ga0495665_0002564
526 Ga0495665_0065711
527 Ga0495640_0006326
528 Ga0495640_0055335
529 Ga0495587_0000662
530 Ga0495609_0121465
531 Ga0495645_0000950
532 Ga0495645_0048483
533 Ga0495667_0019344
534 Ga0495656_0037944
535 Ga0495634_0016625
536 Ga0495634_0077377
537 Ga0495635_0045550
538 Ga0495635_0191605
539 Ga0495588_0002128
540 Ga0495623_0046579
541 Ga0495623_0086503
542 Ga0495647_0019957
543 Ga0495658_0072926
544 Ga0495669_0189562
545 Ga0495613_0047255
546 Ga0495613_0079478
547 Ga0495613_0207477
548 Ga0495624_0046941
549 Ga0495589_0092096
550 Ga0495604_0041851
551 Ga0495604_0150604
552 Ga0495604_0171894
553 Ga0495636_0067061
554 Ga0495674_0002143
555 Ga0495674_0090348
556 Ga0495674_0434634
557 Ga0495680_0333696
558 Ga0495677_0050238
559 Ga0495684_0034450
560 Ga0495684_0037154
561 Ga0495684_0069708
562 Ga0495684_0117947
563 Ga0495593_0086306
564 Ga0496100_0208868
565 Ga0496100_0264715
566 Ga0496102_0170302
567 Ga0496106_0153261
568 Ga0496109_0012529
569 Ga0496109_0270844
570 Ga0496109_0286070
571 Ga0496109_0429494
572 Ga0496110_0029138
573 Ga0496110_0301237
574 Ga0496110_0463210
575 Ga0496111_0021257
576 Ga0496111_0239399
577 Ga0496112_0013996
578 Ga0496112_0236590
579 Ga0496113_0003135
580 Ga0496115_0172121
581 Ga0496121_0146576
582 Ga0496125_0129483
583 Ga0496126_0077330
584 Ga0496126_0185492
585 Ga0501032_0039227
586 Ga0501032_0085609
587 Ga0501033_0076171
588 Ga0501033_0127488
589 Ga0501034_0005078
590 Ga0501036_0484679
591 Ga0501037_0123258
592 Ga0501038_0097377
593 Ga0501038_0102679
594 Ga0501039_0027004
595 Ga0501039_0096961
596 Ga0501040_0102826
597 Ga0501043_0000156
598 Ga0501043_0016082
599 Ga0501046_0101167
600 Ga0501047_0003290
601 Ga0501047_0188747
602 Ga0501048_0106234
603 Ga0501067_0075998
604 Ga0501070_0007944
605 Ga0501072_0001298
606 Ga0501072_0003682
607 Ga0501075_0111146
608 Ga0501075_0397785
609 Ga0501076_0049570
610 Ga0501076_0074524
611 Ga0501077_0021975
612 Ga0501077_0031390
613 Ga0501080_0045847
614 Ga0501081_0389705
615 Ga0501083_0006317
616 Ga0501035_0000002
617 Ga0501035_0000670
618 Ga0501035_0044474
619 Ga0501035_0196484
620 Ga0501044_0027005
621 Ga0501045_0368090
622 nmdc:mga05p37_245869_c1
623 nmdc:mga05p37_91317_c1
624 Ga0495601_0013861
625 Ga0495601_0111349
626 Ga0495612_0022479
627 Ga0495619_0053723
628 Ga0501084_0060987
629 Ga0590071_020095
630 Ga0501082_0003642
631 Ga0501082_0020017
632 Ga0530510_0023514
633 Ga0530510_0241754
634 2513693974
635 2723849274
636 2793070567
637 2842779483
638 2855021776
639 2874617544
640 2874625582
641 2881101346
642 2881370177
643 2885366619
644 2904673528
645 2922427541
646 8004028444
647 8006930334
648 8019555930
649 8019569388
650 8055226096

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

59

354

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uqd-assembly1.cif.gz_C crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products 0.9549 4 307
3n1c-assembly1.cif.gz_B crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate 0.9541 1 307
3cqd-assembly1.cif.gz_A-2 structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli 0.9511 1 307
3umo-assembly1.cif.gz_A crystal structure of the phosphofructokinase-2 from escherichia coli in complex with potassium 0.9509 1 307
3uqe-assembly1.cif.gz_A-2 crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli 0.9482 1 307
ID Description Score Start End Superfamily
af_P9WID3_12_317_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.976 4 309 3.40.1190.20
af_P9WID3_12_317_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9667 4 309 3.40.1190.20
3umoB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9511 1 307 3.40.1190.20
3umoB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9392 1 307 3.40.1190.20
2abqB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9319 5 311 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A1Q4BRC0-F1-model_v4 Phosphofructokinase 0.9968 1 313 GO:0003872
GO:0005524
GO:0005829
AF-A0A1Q4BRC0-F1-model_v4 Phosphofructokinase 0.9936 1 313 GO:0003872
GO:0005524
GO:0005829
AF-A0A1F4CTN5-F1-model_v4 Phosphofructokinase 0.9893 2 312 GO:0003872
GO:0005524
GO:0005829
AF-I2DZD0-F1-model_v4 Phosphofructokinase 0.9812 1 307 GO:0003872
GO:0005524
GO:0005829
AF-A0A7V1SJT9-F1-model_v4 1-phosphofructokinase family hexose kinase 0.9812 1 182 GO:0003872
GO:0005524
GO:0005829

Map