F407771

General Info

Members Datasets Scaffolds Average Seq Length
325 174 650 146

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100481835|Ga0075436_1004818352
Length 174
Sequence VSRACEADANVAPVEWPASFYAMRRGEGCPLCPDGGEDNGHGIRILAGEWADAYLQRKGVQRGYTVVVWRGRHVAEPSELTEDEAAGWWSDLVRVGRALERHFEPVKLNYELLGNAVPHLHAHVMPRYADDPRPGWPFPWPDEEADVQRDAAALRAVLQAFALSEALYARFSAW

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
105 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
106 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
109 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.62
Rhizosphere 81.85
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100481835 3300006914 Bacteria 906
2 JGI25405J52794_10060829 3300003911 Unclassified 817
3 Ga0070683_100352789 3300005329 Bacteria 1401
4 Ga0070683_100707574 3300005329 Unclassified 965
5 Ga0070683_101033723 3300005329 Bacteria 789
6 Ga0070682_100062740 3300005337 Bacteria 2355
7 Ga0070682_100823087 3300005337 Bacteria 756
8 Ga0068868_100234282 3300005338 Bacteria 1541
9 Ga0068868_101604825 3300005338 Unclassified 611
10 Ga0070660_100009701 3300005339 Bacteria 6782
11 Ga0070691_10302927 3300005341 Bacteria 874
12 Ga0070687_100565443 3300005343 Bacteria 776
13 Ga0070675_100666830 3300005354 Bacteria 946
14 Ga0070674_100678068 3300005356 Bacteria 879
15 Ga0070673_100417558 3300005364 Bacteria 1202
16 Ga0070673_100466522 3300005364 Bacteria 1138
17 Ga0070659_100035608 3300005366 Bacteria 3877
18 Ga0070714_100410979 3300005435 Unclassified 1281
19 Ga0070714_100767419 3300005435 Unclassified 933
20 Ga0070701_10213206 3300005438 Bacteria 1148
21 Ga0070701_11065938 3300005438 Bacteria 567
22 Ga0070705_100050674 3300005440 Bacteria 2416
23 Ga0070708_100035857 3300005445 Bacteria 4323
24 Ga0070708_100172063 3300005445 Bacteria 2022
25 Ga0070678_100186923 3300005456 Bacteria 1700
26 Ga0070678_100515298 3300005456 Unclassified 1057
27 Ga0070662_100448910 3300005457 Unclassified 1070
28 Ga0070681_10005137 3300005458 Bacteria 12624
29 Ga0070681_10101493 3300005458 Bacteria 2823
30 Ga0070685_10648285 3300005466 Bacteria 765
31 Ga0070706_100030267 3300005467 Bacteria 4987
32 Ga0070706_100061906 3300005467 Bacteria 3456
33 Ga0070706_101817633 3300005467 Unclassified 554
34 Ga0070707_100012679 3300005468 Bacteria 7873
35 Ga0070707_100229261 3300005468 Bacteria 1808
36 Ga0070707_101062206 3300005468 Bacteria 775
37 Ga0070707_101393899 3300005468 Unclassified 667
38 Ga0070698_100031258 3300005471 Bacteria 5520
39 Ga0070698_100050759 3300005471 Bacteria 4227
40 Ga0070698_100193222 3300005471 Bacteria 1973
41 Ga0070698_101299448 3300005471 Unclassified 677
42 Ga0070699_100000134 3300005518 Bacteria 68781
43 Ga0070699_100000139 3300005518 Bacteria 68023
44 Ga0070679_100004056 3300005530 Bacteria 13488
45 Ga0070679_100017029 3300005530 Bacteria 7026
46 Ga0070684_100130090 3300005535 Bacteria 2270
47 Ga0070697_100033062 3300005536 Bacteria 4164
48 Ga0068853_100279402 3300005539 Bacteria 1539
49 Ga0070686_100033772 3300005544 Bacteria 3146
50 Ga0070695_100634600 3300005545 Bacteria 842
51 Ga0070696_100050256 3300005546 Bacteria 2898
52 Ga0070696_100301373 3300005546 Bacteria 1228
53 Ga0070704_100797111 3300005549 Bacteria 844
54 Ga0068855_100045448 3300005563 Bacteria 5194
55 Ga0068855_100054631 3300005563 Bacteria 4693
56 Ga0068854_100183491 3300005578 Bacteria 1636
57 Ga0068856_100040802 3300005614 Bacteria 4560
58 Ga0068856_100118460 3300005614 Bacteria 2649
59 Ga0068856_100199154 3300005614 Bacteria 2017
60 Ga0068856_100849363 3300005614 Bacteria 932
61 Ga0070702_100287253 3300005615 Bacteria 1132
62 Ga0068864_100844670 3300005618 Bacteria 902
63 Ga0068863_100781166 3300005841 Bacteria 952
64 Ga0068863_101362811 3300005841 Unclassified 717
65 Ga0081455_10009577 3300005937 Bacteria 9950
66 Ga0081455_10020523 3300005937 Bacteria 6217
67 Ga0081455_10189025 3300005937 Bacteria 1553
68 Ga0081540_1014343 3300005983 Bacteria 5082
69 Ga0070717_10019064 3300006028 Bacteria 5372
70 Ga0070717_10374651 3300006028 Unclassified 1276
71 Ga0068871_100383896 3300006358 Unclassified 1248
72 Ga0075428_100734203 3300006844 Bacteria 1051
73 Ga0075431_100061331 3300006847 Bacteria 3880
74 Ga0075431_100363239 3300006847 Bacteria 1454
75 Ga0075433_10019090 3300006852 Bacteria 5703
76 Ga0075433_10291215 3300006852 Bacteria 1446
77 Ga0075434_100129868 3300006871 Bacteria 2538
78 Ga0075436_100108411 3300006914 Bacteria 1937
79 Ga0075435_100051325 3300007076 Bacteria 3322
80 Ga0075435_100126771 3300007076 Bacteria 2134
81 Ga0075435_100977849 3300007076 Bacteria 739
82 Ga0111539_10042968 3300009094 Bacteria 5423
83 Ga0105245_10039018 3300009098 Bacteria 4227
84 Ga0105245_10096961 3300009098 Bacteria 2722
85 Ga0105245_10120885 3300009098 Bacteria 2447
86 Ga0105245_11244375 3300009098 Bacteria 793
87 Ga0114129_10011007 3300009147 Bacteria 12887
88 Ga0105243_10240967 3300009148 Bacteria 1609
89 Ga0105243_10676291 3300009148 Bacteria 1003
90 Ga0105243_10806729 3300009148 Bacteria 925
91 Ga0105241_10073974 3300009174 Bacteria 2652
92 Ga0105248_10266765 3300009177 Bacteria 1927
93 Ga0105239_10044204 3300010375 Bacteria 4883
94 Ga0105239_10717523 3300010375 Bacteria 1143
95 Ga0105246_10142714 3300011119 Bacteria 1803
96 Ga0157374_10146053 3300013296 Bacteria 2297
97 Ga0157372_10064873 3300013307 Bacteria 4098
98 Ga0157372_10555553 3300013307 Bacteria 1338
99 Ga0157375_10224031 3300013308 Bacteria 2040
100 Ga0157375_10466447 3300013308 Bacteria 1428
101 Ga0163163_10359183 3300014325 Bacteria 1513
102 Ga0182008_10168374 3300014497 Bacteria 1105
103 Ga0182008_10371584 3300014497 Unclassified 762
104 Ga0157377_10086382 3300014745 Bacteria 1844
105 Ga0207684_10003233 3300025910 Bacteria 15989
106 Ga0207684_10019882 3300025910 Bacteria 5740
107 Ga0207684_10052503 3300025910 Bacteria 3459
108 Ga0207684_10104975 3300025910 Bacteria 2416
109 Ga0207684_11291394 3300025910 Unclassified 601
110 Ga0207654_10100030 3300025911 Bacteria 1785
111 Ga0207707_10051355 3300025912 Bacteria 3590
112 Ga0207707_10150826 3300025912 Bacteria 2032
113 Ga0207662_10398904 3300025918 Bacteria 932
114 Ga0207657_10009547 3300025919 Bacteria 9740
115 Ga0207652_10095689 3300025921 Bacteria 2616
116 Ga0207646_10007821 3300025922 Bacteria 10803
117 Ga0207646_10011862 3300025922 Bacteria 8406
118 Ga0207646_10052956 3300025922 Bacteria 3631
119 Ga0207687_10054992 3300025927 Bacteria 2787
120 Ga0207687_10431121 3300025927 Bacteria 1090
121 Ga0207687_11275568 3300025927 Unclassified 631
122 Ga0207644_11326155 3300025931 Bacteria 605
123 Ga0207706_10023856 3300025933 Bacteria 5487
124 Ga0207709_10240580 3300025935 Bacteria 1316
125 Ga0207709_11047667 3300025935 Unclassified 668
126 Ga0207661_10783164 3300025944 Bacteria 878
127 Ga0207679_10691524 3300025945 Bacteria 925
128 Ga0207667_10042465 3300025949 Bacteria 4833
129 Ga0207667_10049388 3300025949 Bacteria 4443
130 Ga0207651_10200846 3300025960 Bacteria 1598
131 Ga0207651_10588236 3300025960 Bacteria 972
132 Ga0207640_10129276 3300025981 Bacteria 1823
133 Ga0207677_10075502 3300026023 Bacteria 2396
134 Ga0207677_10596171 3300026023 Bacteria 969
135 Ga0207639_10119370 3300026041 Bacteria 2164
136 Ga0207678_10202626 3300026067 Bacteria 1697
137 Ga0207708_10301348 3300026075 Bacteria 1304
138 Ga0207702_10014189 3300026078 Bacteria 6618
139 Ga0207702_10297525 3300026078 Unclassified 1531
140 Ga0207683_10020257 3300026121 Bacteria 5688
141 Ga0207683_10472695 3300026121 Unclassified 1157
142 Ga0207428_10028197 3300027907 Bacteria 4666
143 Ga0307406_10812099 3300031901 Bacteria 790
144 Ga0307409_100420350 3300031995 Bacteria 1282
145 Ga0307409_101063992 3300031995 Bacteria 829
146 Ga0307416_100061862 3300032002 Bacteria 3058
147 Ga0373944_0014425 3300035089 Bacteria 2205
148 Ga0373945_0031455 3300035116 Bacteria 1875
149 Ga0373953_0184033 3300035117 Bacteria 902
150 Ga0373957_0132407 3300035120 Bacteria 1016
151 Ga0373943_0018540 3300035170 Bacteria 3198
152 Ga0373955_0063213 3300035172 Bacteria 2049
153 Ga0373955_0377844 3300035172 Bacteria 860
154 Ga0373924_0173544 3300035410 Bacteria 948
155 Ga0373933_0521834 3300035724 Bacteria 779
156 Ga0373947_0018428 3300035725 Bacteria 4017
157 Ga0373947_0628809 3300035725 Bacteria 732
158 Ga0373937_0812985 3300036401 Unclassified 883
159 Ga0373925_0105107 3300037068 Bacteria 2175
160 Ga0395899_0003866 3300037312 Bacteria 11813
161 Ga0395899_0309563 3300037312 Bacteria 1067
162 Ga0395899_0799541 3300037312 Unclassified 583
163 Ga0395900_0001164 3300037418 Bacteria 32917
164 Ga0395900_0002588 3300037418 Bacteria 19786
165 Ga0395900_0308757 3300037418 Bacteria 1565
166 Ga0395900_0398028 3300037418 Unclassified 1342
167 Ga0395900_0953396 3300037418 Unclassified 779
168 Ga0395898_0002074 3300037466 Bacteria 24942
169 Ga0395898_0031886 3300037466 Bacteria 5262
170 Ga0395898_0255007 3300037466 Bacteria 1673
171 Ga0395898_0262099 3300037466 Bacteria 1649
172 Ga0395898_0323401 3300037466 Bacteria 1471
173 Ga0395898_0353675 3300037466 Unclassified 1401
174 Ga0395898_0509992 3300037466 Bacteria 1144
175 Ga0395905_0000786 3300037471 Bacteria 41747
176 Ga0395905_0305952 3300037471 Bacteria 1478
177 Ga0395905_0632906 3300037471 Bacteria 972
178 Ga0395905_0771093 3300037471 Bacteria 864
179 Ga0395905_1278851 3300037471 Bacteria 637
180 Ga0395905_1345870 3300037471 Bacteria 618
181 Ga0395901_0009631 3300038443 Bacteria 9801
182 Ga0395901_0023328 3300038443 Bacteria 6342
183 Ga0395901_0087429 3300038443 Bacteria 3259
184 Ga0395901_0172029 3300038443 Bacteria 2272
185 Ga0395901_0186575 3300038443 Bacteria 2175
186 Ga0395901_0308015 3300038443 Bacteria 1641
187 Ga0395901_0604631 3300038443 Bacteria 1105
188 Ga0395901_0610810 3300038443 Bacteria 1098
189 Ga0395901_0697399 3300038443 Bacteria 1013
190 Ga0395901_1066372 3300038443 Unclassified 780
191 Ga0395901_1502850 3300038443 Bacteria 629
192 Ga0395901_1600947 3300038443 Unclassified 605
193 Ga0451804_1092287 3300041463 Bacteria 729
194 Ga0451835_0697653 3300041492 Unclassified 552
195 Ga0451839_1334994 3300041496 Bacteria 732
196 Ga0451853_1027904 3300041512 Bacteria 2088
197 Ga0451853_1114481 3300041512 Bacteria 760
198 Ga0451853_3063110 3300041512 Bacteria 1076
199 Ga0439448_0151291 3300042005 Unclassified 805
200 Ga0439440_0160627 3300042993 Bacteria 648
201 Ga0466964_0025908 3300044706 Bacteria 2292
202 Ga0466964_0292557 3300044706 Bacteria 818
203 Ga0466960_0082884 3300044901 Unclassified 1619
204 Ga0466960_0459695 3300044901 Bacteria 741
205 Ga0466960_0489560 3300044901 Bacteria 719
206 Ga0466967_0110599 3300045976 Bacteria 2524
207 Ga0466967_0668328 3300045976 Bacteria 1028
208 Ga0495592_0378007 3300046454 Bacteria 902
209 Ga0495603_0000121 3300046455 Bacteria 38318
210 Ga0495629_0527569 3300046459 Unclassified 794
211 Ga0495641_0000937 3300046461 Bacteria 24909
212 Ga0495641_0112276 3300046461 Bacteria 1216
213 Ga0495651_0127348 3300046462 Bacteria 1863
214 Ga0495651_0310518 3300046462 Bacteria 1055
215 Ga0495580_0033420 3300046472 Bacteria 3707
216 Ga0495582_0025971 3300046473 Bacteria 3209
217 Ga0495582_0289647 3300046473 Bacteria 941
218 Ga0495664_0159878 3300046477 Bacteria 1367
219 Ga0495594_0090278 3300046499 Bacteria 1716
220 Ga0495618_0072753 3300046514 Unclassified 2188
221 Ga0495628_0167234 3300046516 Bacteria 1669
222 Ga0495628_0220977 3300046516 Bacteria 1423
223 Ga0495630_0487340 3300046517 Bacteria 945
224 Ga0495663_0043114 3300046525 Bacteria 1377
225 Ga0495666_0084391 3300046526 Bacteria 1500
226 Ga0495652_0163058 3300046529 Bacteria 1728
227 Ga0495652_0313160 3300046529 Unclassified 1136
228 Ga0495665_0069378 3300046531 Bacteria 1858
229 Ga0495587_0038612 3300046536 Bacteria 2862
230 Ga0495622_0112379 3300046557 Bacteria 1247
231 Ga0495667_0269703 3300046559 Unclassified 1081
232 Ga0495667_0359114 3300046559 Bacteria 920
233 Ga0495667_0752575 3300046559 Unclassified 602
234 Ga0495635_0046765 3300046663 Bacteria 2985
235 Ga0495635_0294143 3300046663 Bacteria 1089
236 Ga0495588_0004277 3300046674 Bacteria 6295
237 Ga0495657_0237243 3300046675 Bacteria 1101
238 Ga0495646_0063434 3300046680 Bacteria 2194
239 Ga0495647_0147661 3300046681 Bacteria 1006
240 Ga0495613_1006263 3300046689 Bacteria 535
241 Ga0495624_0664403 3300046690 Bacteria 620
242 Ga0495600_0071182 3300046809 Bacteria 2272
243 Ga0495581_0107834 3300047315 Bacteria 1619
244 Ga0495674_0282764 3300047319 Bacteria 1359
245 Ga0495674_0419432 3300047319 Bacteria 1078
246 Ga0495676_0000372 3300047321 Bacteria 36840
247 Ga0495676_0057862 3300047321 Bacteria 3054
248 Ga0495680_0087465 3300047322 Bacteria 2344
249 Ga0495684_0032451 3300047471 Bacteria 4010
250 Ga0495593_0403807 3300047673 Unclassified 683
251 Ga0495602_0584218 3300048088 Bacteria 770
252 Ga0496100_0002976 3300048903 Bacteria 8721
253 Ga0496100_0930854 3300048903 Unclassified 683
254 Ga0496101_0032755 3300048904 Bacteria 3661
255 Ga0496101_0181393 3300048904 Unclassified 1621
256 Ga0496102_0048900 3300048905 Bacteria 3846
257 Ga0496102_0283631 3300048905 Bacteria 1561
258 Ga0496102_0360169 3300048905 Bacteria 1369
259 Ga0496102_0375870 3300048905 Bacteria 1337
260 Ga0496102_0831581 3300048905 Bacteria 846
261 Ga0496103_0207027 3300048906 Bacteria 1262
262 Ga0496104_0000444 3300048907 Bacteria 35985
263 Ga0496104_0022239 3300048907 Bacteria 5823
264 Ga0496104_0228937 3300048907 Unclassified 1771
265 Ga0496105_0000200 3300048908 Bacteria 39964
266 Ga0496105_0005540 3300048908 Bacteria 9584
267 Ga0496105_0421876 3300048908 Bacteria 1056
268 Ga0496105_0664161 3300048908 Bacteria 803
269 Ga0496105_1214081 3300048908 Unclassified 555
270 Ga0496106_0083678 3300048909 Bacteria 2454
271 Ga0496106_0304556 3300048909 Bacteria 1278
272 Ga0496107_0048534 3300048910 Bacteria 3059
273 Ga0496107_0073569 3300048910 Bacteria 2486
274 Ga0496108_0002894 3300048911 Bacteria 13785
275 Ga0496108_0006597 3300048911 Bacteria 9410
276 Ga0496108_0316006 3300048911 Bacteria 1361
277 Ga0496109_0002306 3300048912 Bacteria 15879
278 Ga0496109_0023498 3300048912 Bacteria 5474
279 Ga0496109_0070767 3300048912 Bacteria 3202
280 Ga0496109_1322772 3300048912 Unclassified 657
281 Ga0496110_0001896 3300048913 Bacteria 15452
282 Ga0496110_0010186 3300048913 Bacteria 7639
283 Ga0496110_0042059 3300048913 Bacteria 3988
284 Ga0496110_0135987 3300048913 Bacteria 2221
285 Ga0496110_0399222 3300048913 Bacteria 1253
286 Ga0496111_0000113 3300048914 Bacteria 35668
287 Ga0496111_0027046 3300048914 Bacteria 4054
288 Ga0496111_0066562 3300048914 Bacteria 2617
289 Ga0496111_0085462 3300048914 Bacteria 2307
290 Ga0496111_0123131 3300048914 Bacteria 1916
291 Ga0496111_0146195 3300048914 Bacteria 1753
292 Ga0496111_0242735 3300048914 Bacteria 1337
293 Ga0496111_0326885 3300048914 Unclassified 1135
294 Ga0496112_0000908 3300048915 Bacteria 21352
295 Ga0496112_0850009 3300048915 Unclassified 836
296 Ga0496112_1128900 3300048915 Bacteria 702
297 Ga0496113_0024060 3300048916 Bacteria 4324
298 Ga0496113_0245723 3300048916 Bacteria 1428
299 Ga0496113_0392518 3300048916 Unclassified 1114
300 Ga0496114_0002624 3300048917 Bacteria 13719
301 Ga0496114_0040049 3300048917 Bacteria 3878
302 Ga0496114_0369890 3300048917 Bacteria 1269
303 Ga0496115_0328566 3300048918 Unclassified 1250
304 Ga0496115_0490751 3300048918 Unclassified 988
305 Ga0501067_0779052 3300049583 Bacteria 538
306 Ga0501069_0014528 3300049585 Bacteria 4210
307 nmdc:mga06r32_378247_c1 3300050510 Bacteria 1399
308 nmdc:mga06r32_5482_c1 3300050510 Bacteria 11423
309 nmdc:mga0n895_1753977_c1 3300050512 Unclassified 582
310 nmdc:mga0n895_1899_c1 3300050512 Bacteria 15982
311 nmdc:mga0rr50_401936_c1 3300050513 Unclassified 1157
312 nmdc:mga08x19_1158559_c1 3300050514 Unclassified 548
313 nmdc:mga08x19_240185_c1 3300050514 Bacteria 1248
314 nmdc:mga0a205_4264_c1 3300050515 Bacteria 12837
315 nmdc:mga0a205_465999_c1 3300050515 Bacteria 1123
316 Ga0495601_0034523 3300053077 Bacteria 3156
317 Ga0495601_0169534 3300053077 Bacteria 1427
318 Ga0495612_0032370 3300053078 Bacteria 2113
319 Ga0495612_0054652 3300053078 Bacteria 1646
320 Ga0495612_0167687 3300053078 Bacteria 961
321 Ga0495595_0041765 3300053084 Bacteria 2100
322 Ga0495595_0113534 3300053084 Bacteria 1315
323 Ga0495619_0051459 3300053085 Bacteria 2722
324 Ga0495619_0440389 3300053085 Bacteria 899
325 Ga0530510_0174426 3300061734 Bacteria 1593
326 Ga0075436_100481835
327 JGI25405J52794_10060829
328 Ga0070683_100352789
329 Ga0070683_100707574
330 Ga0070683_101033723
331 Ga0070682_100062740
332 Ga0070682_100823087
333 Ga0068868_100234282
334 Ga0068868_101604825
335 Ga0070660_100009701
336 Ga0070691_10302927
337 Ga0070687_100565443
338 Ga0070675_100666830
339 Ga0070674_100678068
340 Ga0070673_100417558
341 Ga0070673_100466522
342 Ga0070659_100035608
343 Ga0070714_100410979
344 Ga0070714_100767419
345 Ga0070701_10213206
346 Ga0070701_11065938
347 Ga0070705_100050674
348 Ga0070708_100035857
349 Ga0070708_100172063
350 Ga0070678_100186923
351 Ga0070678_100515298
352 Ga0070662_100448910
353 Ga0070681_10005137
354 Ga0070681_10101493
355 Ga0070685_10648285
356 Ga0070706_100030267
357 Ga0070706_100061906
358 Ga0070706_101817633
359 Ga0070707_100012679
360 Ga0070707_100229261
361 Ga0070707_101062206
362 Ga0070707_101393899
363 Ga0070698_100031258
364 Ga0070698_100050759
365 Ga0070698_100193222
366 Ga0070698_101299448
367 Ga0070699_100000134
368 Ga0070699_100000139
369 Ga0070679_100004056
370 Ga0070679_100017029
371 Ga0070684_100130090
372 Ga0070697_100033062
373 Ga0068853_100279402
374 Ga0070686_100033772
375 Ga0070695_100634600
376 Ga0070696_100050256
377 Ga0070696_100301373
378 Ga0070704_100797111
379 Ga0068855_100045448
380 Ga0068855_100054631
381 Ga0068854_100183491
382 Ga0068856_100040802
383 Ga0068856_100118460
384 Ga0068856_100199154
385 Ga0068856_100849363
386 Ga0070702_100287253
387 Ga0068864_100844670
388 Ga0068863_100781166
389 Ga0068863_101362811
390 Ga0081455_10009577
391 Ga0081455_10020523
392 Ga0081455_10189025
393 Ga0081540_1014343
394 Ga0070717_10019064
395 Ga0070717_10374651
396 Ga0068871_100383896
397 Ga0075428_100734203
398 Ga0075431_100061331
399 Ga0075431_100363239
400 Ga0075433_10019090
401 Ga0075433_10291215
402 Ga0075434_100129868
403 Ga0075436_100108411
404 Ga0075435_100051325
405 Ga0075435_100126771
406 Ga0075435_100977849
407 Ga0111539_10042968
408 Ga0105245_10039018
409 Ga0105245_10096961
410 Ga0105245_10120885
411 Ga0105245_11244375
412 Ga0114129_10011007
413 Ga0105243_10240967
414 Ga0105243_10676291
415 Ga0105243_10806729
416 Ga0105241_10073974
417 Ga0105248_10266765
418 Ga0105239_10044204
419 Ga0105239_10717523
420 Ga0105246_10142714
421 Ga0157374_10146053
422 Ga0157372_10064873
423 Ga0157372_10555553
424 Ga0157375_10224031
425 Ga0157375_10466447
426 Ga0163163_10359183
427 Ga0182008_10168374
428 Ga0182008_10371584
429 Ga0157377_10086382
430 Ga0207684_10003233
431 Ga0207684_10019882
432 Ga0207684_10052503
433 Ga0207684_10104975
434 Ga0207684_11291394
435 Ga0207654_10100030
436 Ga0207707_10051355
437 Ga0207707_10150826
438 Ga0207662_10398904
439 Ga0207657_10009547
440 Ga0207652_10095689
441 Ga0207646_10007821
442 Ga0207646_10011862
443 Ga0207646_10052956
444 Ga0207687_10054992
445 Ga0207687_10431121
446 Ga0207687_11275568
447 Ga0207644_11326155
448 Ga0207706_10023856
449 Ga0207709_10240580
450 Ga0207709_11047667
451 Ga0207661_10783164
452 Ga0207679_10691524
453 Ga0207667_10042465
454 Ga0207667_10049388
455 Ga0207651_10200846
456 Ga0207651_10588236
457 Ga0207640_10129276
458 Ga0207677_10075502
459 Ga0207677_10596171
460 Ga0207639_10119370
461 Ga0207678_10202626
462 Ga0207708_10301348
463 Ga0207702_10014189
464 Ga0207702_10297525
465 Ga0207683_10020257
466 Ga0207683_10472695
467 Ga0207428_10028197
468 Ga0307406_10812099
469 Ga0307409_100420350
470 Ga0307409_101063992
471 Ga0307416_100061862
472 Ga0373944_0014425
473 Ga0373945_0031455
474 Ga0373953_0184033
475 Ga0373957_0132407
476 Ga0373943_0018540
477 Ga0373955_0063213
478 Ga0373955_0377844
479 Ga0373924_0173544
480 Ga0373933_0521834
481 Ga0373947_0018428
482 Ga0373947_0628809
483 Ga0373937_0812985
484 Ga0373925_0105107
485 Ga0395899_0003866
486 Ga0395899_0309563
487 Ga0395899_0799541
488 Ga0395900_0001164
489 Ga0395900_0002588
490 Ga0395900_0308757
491 Ga0395900_0398028
492 Ga0395900_0953396
493 Ga0395898_0002074
494 Ga0395898_0031886
495 Ga0395898_0255007
496 Ga0395898_0262099
497 Ga0395898_0323401
498 Ga0395898_0353675
499 Ga0395898_0509992
500 Ga0395905_0000786
501 Ga0395905_0305952
502 Ga0395905_0632906
503 Ga0395905_0771093
504 Ga0395905_1278851
505 Ga0395905_1345870
506 Ga0395901_0009631
507 Ga0395901_0023328
508 Ga0395901_0087429
509 Ga0395901_0172029
510 Ga0395901_0186575
511 Ga0395901_0308015
512 Ga0395901_0604631
513 Ga0395901_0610810
514 Ga0395901_0697399
515 Ga0395901_1066372
516 Ga0395901_1502850
517 Ga0395901_1600947
518 Ga0451804_1092287
519 Ga0451835_0697653
520 Ga0451839_1334994
521 Ga0451853_1027904
522 Ga0451853_1114481
523 Ga0451853_3063110
524 Ga0439448_0151291
525 Ga0439440_0160627
526 Ga0466964_0025908
527 Ga0466964_0292557
528 Ga0466960_0082884
529 Ga0466960_0459695
530 Ga0466960_0489560
531 Ga0466967_0110599
532 Ga0466967_0668328
533 Ga0495592_0378007
534 Ga0495603_0000121
535 Ga0495629_0527569
536 Ga0495641_0000937
537 Ga0495641_0112276
538 Ga0495651_0127348
539 Ga0495651_0310518
540 Ga0495580_0033420
541 Ga0495582_0025971
542 Ga0495582_0289647
543 Ga0495664_0159878
544 Ga0495594_0090278
545 Ga0495618_0072753
546 Ga0495628_0167234
547 Ga0495628_0220977
548 Ga0495630_0487340
549 Ga0495663_0043114
550 Ga0495666_0084391
551 Ga0495652_0163058
552 Ga0495652_0313160
553 Ga0495665_0069378
554 Ga0495587_0038612
555 Ga0495622_0112379
556 Ga0495667_0269703
557 Ga0495667_0359114
558 Ga0495667_0752575
559 Ga0495635_0046765
560 Ga0495635_0294143
561 Ga0495588_0004277
562 Ga0495657_0237243
563 Ga0495646_0063434
564 Ga0495647_0147661
565 Ga0495613_1006263
566 Ga0495624_0664403
567 Ga0495600_0071182
568 Ga0495581_0107834
569 Ga0495674_0282764
570 Ga0495674_0419432
571 Ga0495676_0000372
572 Ga0495676_0057862
573 Ga0495680_0087465
574 Ga0495684_0032451
575 Ga0495593_0403807
576 Ga0495602_0584218
577 Ga0496100_0002976
578 Ga0496100_0930854
579 Ga0496101_0032755
580 Ga0496101_0181393
581 Ga0496102_0048900
582 Ga0496102_0283631
583 Ga0496102_0360169
584 Ga0496102_0375870
585 Ga0496102_0831581
586 Ga0496103_0207027
587 Ga0496104_0000444
588 Ga0496104_0022239
589 Ga0496104_0228937
590 Ga0496105_0000200
591 Ga0496105_0005540
592 Ga0496105_0421876
593 Ga0496105_0664161
594 Ga0496105_1214081
595 Ga0496106_0083678
596 Ga0496106_0304556
597 Ga0496107_0048534
598 Ga0496107_0073569
599 Ga0496108_0002894
600 Ga0496108_0006597
601 Ga0496108_0316006
602 Ga0496109_0002306
603 Ga0496109_0023498
604 Ga0496109_0070767
605 Ga0496109_1322772
606 Ga0496110_0001896
607 Ga0496110_0010186
608 Ga0496110_0042059
609 Ga0496110_0135987
610 Ga0496110_0399222
611 Ga0496111_0000113
612 Ga0496111_0027046
613 Ga0496111_0066562
614 Ga0496111_0085462
615 Ga0496111_0123131
616 Ga0496111_0146195
617 Ga0496111_0242735
618 Ga0496111_0326885
619 Ga0496112_0000908
620 Ga0496112_0850009
621 Ga0496112_1128900
622 Ga0496113_0024060
623 Ga0496113_0245723
624 Ga0496113_0392518
625 Ga0496114_0002624
626 Ga0496114_0040049
627 Ga0496114_0369890
628 Ga0496115_0328566
629 Ga0496115_0490751
630 Ga0501067_0779052
631 Ga0501069_0014528
632 nmdc:mga06r32_378247_c1
633 nmdc:mga06r32_5482_c1
634 nmdc:mga0n895_1753977_c1
635 nmdc:mga0n895_1899_c1
636 nmdc:mga0rr50_401936_c1
637 nmdc:mga08x19_1158559_c1
638 nmdc:mga08x19_240185_c1
639 nmdc:mga0a205_4264_c1
640 nmdc:mga0a205_465999_c1
641 Ga0495601_0034523
642 Ga0495601_0169534
643 Ga0495612_0032370
644 Ga0495612_0054652
645 Ga0495612_0167687
646 Ga0495595_0041765
647 Ga0495595_0113534
648 Ga0495619_0051459
649 Ga0495619_0440389
650 Ga0530510_0174426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

44

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i4s-assembly1.cif.gz_B crystal structure of histidine triad protein blr8122 from bradyrhizobium japonicum 0.8467 11 131
3ohe-assembly1.cif.gz_B crystal structure of a histidine triad protein (maqu_1709) from marinobacter aquaeolei vt8 at 1.20 a resolution 0.8242 13 131
3i24-assembly1.cif.gz_B crystal structure of a hit family hydrolase protein from vibrio fischeri. northeast structural genomics consortium target id vfr176 0.824 2 131
3nrd-assembly1.cif.gz_A crystal structure of a histidine triad (hit) protein (smc02904) from sinorhizobium meliloti 1021 at 2.06 a resolution 0.824 13 130
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.806 15 131
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8857 15 98 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8806 15 102 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8801 15 102 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8632 13 100 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8566 35 102 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A535VSW2-F1-model_v4 HIT domain-containing protein 0.9411 2 131 GO:0003824
GO:0009117
AF-A0A7V3H685-F1-model_v4 HIT family protein 0.9295 15 101 GO:0003824
AF-A0A535R2L6-F1-model_v4 HIT family protein 0.9106 2 131 GO:0003824
AF-A0A538IJW2-F1-model_v4 HIT family protein 0.9066 1 131 GO:0003824
AF-A0A536EEU4-F1-model_v4 HIT family protein 0.9016 1 131 GO:0003824

Map