F407761
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 215 | 312 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100010731|Ga0075428_1000107317 |
| Length | 192 |
| Sequence | MKKAKSGATLSKAQRDELLGVLKARFEKNKNRHKGIEWAGVQAKLEANAEKLSSLQEMERTGGEPDVIGFDKKTGEYVFCDCSAESPKGRRSICYDRDGQEAREKEGIHPEGNAIDMAATMGIELLNEEQYRELQKLGNFDTKTSSWVVTPPEIRKLGGALFCDRRYDHVFVYHNGAQSFYSARAFRGLLRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 2 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 3 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 4 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 5 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 6 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 7 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 8 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 9 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 10 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 11 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 12 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 13 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 178 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 179 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 183 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 197 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 198 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 199 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 202 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 208 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 209 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 211 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 212 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 213 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 214 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 215 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96 |
| Metatranscriptomes | 0 |
| Isolates | 4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.77 |
| Nodule | 0 |
| Rhizoplane | 0.31 |
| Rhizosphere | 85.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10012469 | 3300001989 | Bacteria | 3121 |
| 2 | JGI24751J29686_10001015 | 3300002459 | Bacteria | 6155 |
| 3 | JGI25152J39213_1002536 | 3300002773 | Bacteria | 6881 |
| 4 | JGI25150J39212_1000057 | 3300002774 | Bacteria | 66456 |
| 5 | JGI25151J46595_10000229 | 3300003187 | Bacteria | 66456 |
| 6 | JGI25153J46596_10000164 | 3300003215 | Bacteria | 66576 |
| 7 | JGI25153J46596_10011436 | 3300003215 | Bacteria | 3922 |
| 8 | JGI25153J46596_10020949 | 3300003215 | Bacteria | 2453 |
| 9 | rootH2_10087534 | 3300003320 | Bacteria | 2667 |
| 10 | rootH2_10311480 | 3300003320 | Bacteria | 1122 |
| 11 | rootL2_10080850 | 3300003322 | Bacteria | 8439 |
| 12 | rootH1_10077475 | 3300003323 | Bacteria | 6918 |
| 13 | rootH1_10157402 | 3300003323 | Bacteria | 6105 |
| 14 | JGI25160J50197_1000453 | 3300003354 | Bacteria | 25592 |
| 15 | Ga0055526_1015529 | 3300003771 | Bacteria | 3052 |
| 16 | Ga0055530_10000619 | 3300003791 | Bacteria | 30885 |
| 17 | Ga0065165_1000182 | 3300005262 | Bacteria | 110108 |
| 18 | Ga0065704_10130290 | 3300005289 | Bacteria | 1638 |
| 19 | Ga0065712_10247132 | 3300005290 | Bacteria | 969 |
| 20 | Ga0065712_10247744 | 3300005290 | Bacteria | 966 |
| 21 | Ga0065715_10115169 | 3300005293 | Bacteria | 2401 |
| 22 | Ga0065715_10175080 | 3300005293 | Bacteria | 1517 |
| 23 | Ga0065715_10299863 | 3300005293 | Bacteria | 1043 |
| 24 | Ga0070676_10052158 | 3300005328 | Bacteria | 2404 |
| 25 | Ga0070670_100054490 | 3300005331 | Bacteria | 3433 |
| 26 | Ga0070670_100067326 | 3300005331 | Bacteria | 3073 |
| 27 | Ga0068869_100094532 | 3300005334 | Bacteria | 2254 |
| 28 | Ga0068869_100125088 | 3300005334 | Bacteria | 1971 |
| 29 | Ga0068869_100916007 | 3300005334 | Bacteria | 759 |
| 30 | Ga0070666_10087116 | 3300005335 | Bacteria | 2140 |
| 31 | Ga0070682_100479927 | 3300005337 | Bacteria | 959 |
| 32 | Ga0068868_100008724 | 3300005338 | Bacteria | 7258 |
| 33 | Ga0070660_101276186 | 3300005339 | Bacteria | 623 |
| 34 | Ga0070689_100294611 | 3300005340 | Bacteria | 1349 |
| 35 | Ga0070661_100229110 | 3300005344 | Bacteria | 1427 |
| 36 | Ga0070668_100255825 | 3300005347 | Bacteria | 1455 |
| 37 | Ga0070668_100313719 | 3300005347 | Bacteria | 1318 |
| 38 | Ga0070669_100064279 | 3300005353 | Bacteria | 2702 |
| 39 | Ga0070675_100351793 | 3300005354 | Bacteria | 1306 |
| 40 | Ga0070671_100001514 | 3300005355 | Bacteria | 17420 |
| 41 | Ga0070673_100037100 | 3300005364 | Bacteria | 3710 |
| 42 | Ga0070673_100159506 | 3300005364 | Bacteria | 1917 |
| 43 | Ga0070688_100520162 | 3300005365 | Unclassified | 900 |
| 44 | Ga0070659_100294336 | 3300005366 | Bacteria | 1352 |
| 45 | Ga0070667_100285428 | 3300005367 | Bacteria | 1483 |
| 46 | Ga0070667_100694275 | 3300005367 | Bacteria | 941 |
| 47 | Ga0070713_100415721 | 3300005436 | Bacteria | 1258 |
| 48 | Ga0070700_100398553 | 3300005441 | Archaea | 1034 |
| 49 | Ga0070708_100399291 | 3300005445 | Bacteria | 1296 |
| 50 | Ga0070678_100145871 | 3300005456 | Bacteria | 1900 |
| 51 | Ga0070662_100086235 | 3300005457 | Bacteria | 2348 |
| 52 | Ga0068867_100015193 | 3300005459 | Bacteria | 5460 |
| 53 | Ga0068867_100036341 | 3300005459 | Bacteria | 3575 |
| 54 | Ga0068867_100109211 | 3300005459 | Bacteria | 2123 |
| 55 | Ga0068867_100111318 | 3300005459 | Bacteria | 2104 |
| 56 | Ga0070685_10060752 | 3300005466 | Archaea | 2211 |
| 57 | Ga0070706_100024925 | 3300005467 | Bacteria | 5506 |
| 58 | Ga0070706_100383167 | 3300005467 | Bacteria | 1309 |
| 59 | Ga0070707_100278032 | 3300005468 | Bacteria | 1627 |
| 60 | Ga0070698_100199962 | 3300005471 | Bacteria | 1934 |
| 61 | Ga0070699_100218041 | 3300005518 | Bacteria | 1700 |
| 62 | Ga0070699_100571828 | 3300005518 | Bacteria | 1029 |
| 63 | Ga0070672_100000713 | 3300005543 | Bacteria | 19704 |
| 64 | Ga0070672_100797042 | 3300005543 | Bacteria | 831 |
| 65 | Ga0070686_100002589 | 3300005544 | Bacteria | 9979 |
| 66 | Ga0070695_100296868 | 3300005545 | Bacteria | 1193 |
| 67 | Ga0070696_100643793 | 3300005546 | Bacteria | 859 |
| 68 | Ga0070664_100346377 | 3300005564 | Bacteria | 1351 |
| 69 | Ga0068857_100891069 | 3300005577 | Bacteria | 853 |
| 70 | Ga0068854_100150023 | 3300005578 | Bacteria | 1797 |
| 71 | Ga0068854_100868293 | 3300005578 | Bacteria | 791 |
| 72 | Ga0070702_100241175 | 3300005615 | Bacteria | 1220 |
| 73 | Ga0068852_100135914 | 3300005616 | Bacteria | 2270 |
| 74 | Ga0068852_101326863 | 3300005616 | Bacteria | 741 |
| 75 | Ga0068852_101618528 | 3300005616 | Bacteria | 670 |
| 76 | Ga0068859_100140571 | 3300005617 | Bacteria | 2488 |
| 77 | Ga0068859_100367314 | 3300005617 | Bacteria | 1534 |
| 78 | Ga0068859_100642224 | 3300005617 | Bacteria | 1153 |
| 79 | Ga0068859_100774962 | 3300005617 | Bacteria | 1047 |
| 80 | Ga0068859_101416820 | 3300005617 | Bacteria | 766 |
| 81 | Ga0068864_100077889 | 3300005618 | Bacteria | 2900 |
| 82 | Ga0068866_10018851 | 3300005718 | Bacteria | 3130 |
| 83 | Ga0068861_100027092 | 3300005719 | Bacteria | 4171 |
| 84 | Ga0068851_10000105 | 3300005834 | Bacteria | 45381 |
| 85 | Ga0068863_100003469 | 3300005841 | Bacteria | 15551 |
| 86 | Ga0068863_100164219 | 3300005841 | Bacteria | 2129 |
| 87 | Ga0068863_100220125 | 3300005841 | Bacteria | 1829 |
| 88 | Ga0068863_100429061 | 3300005841 | Bacteria | 1295 |
| 89 | Ga0068863_100551019 | 3300005841 | Bacteria | 1139 |
| 90 | Ga0068858_100174556 | 3300005842 | Bacteria | 2027 |
| 91 | Ga0068858_100427167 | 3300005842 | Bacteria | 1275 |
| 92 | Ga0068860_100207844 | 3300005843 | Bacteria | 1898 |
| 93 | Ga0068860_100229627 | 3300005843 | Bacteria | 1803 |
| 94 | Ga0068862_100280058 | 3300005844 | Bacteria | 1528 |
| 95 | Ga0081539_10148603 | 3300005985 | Bacteria | 1130 |
| 96 | Ga0075366_10250064 | 3300006195 | Bacteria | 1081 |
| 97 | Ga0097621_100216666 | 3300006237 | Bacteria | 1667 |
| 98 | Ga0068871_101109989 | 3300006358 | Bacteria | 740 |
| 99 | Ga0075428_100010731 | 3300006844 | Bacteria | 10183 |
| 100 | Ga0075431_100015208 | 3300006847 | Bacteria | 7798 |
| 101 | Ga0075431_100100044 | 3300006847 | Bacteria | 2991 |
| 102 | Ga0097620_100140583 | 3300006931 | Bacteria | 2488 |
| 103 | Ga0097620_100367301 | 3300006931 | Bacteria | 1534 |
| 104 | Ga0097620_100642183 | 3300006931 | Bacteria | 1153 |
| 105 | Ga0097620_100774958 | 3300006931 | Bacteria | 1047 |
| 106 | Ga0097620_101416794 | 3300006931 | Bacteria | 766 |
| 107 | Ga0075435_100465223 | 3300007076 | Bacteria | 1091 |
| 108 | Ga0105251_10293105 | 3300009011 | Bacteria | 737 |
| 109 | Ga0105245_10425372 | 3300009098 | Archaea | 1332 |
| 110 | Ga0105247_10000761 | 3300009101 | Bacteria | 24873 |
| 111 | Ga0105247_10470299 | 3300009101 | Bacteria | 910 |
| 112 | Ga0114129_10226907 | 3300009147 | Bacteria | 2517 |
| 113 | Ga0114129_10263507 | 3300009147 | Bacteria | 2308 |
| 114 | Ga0105243_10021347 | 3300009148 | Bacteria | 4914 |
| 115 | Ga0105243_11213768 | 3300009148 | Bacteria | 768 |
| 116 | Ga0105241_10055340 | 3300009174 | Bacteria | 3039 |
| 117 | Ga0105241_10435657 | 3300009174 | Bacteria | 1157 |
| 118 | Ga0105242_10777987 | 3300009176 | Bacteria | 945 |
| 119 | Ga0105242_11473759 | 3300009176 | Bacteria | 710 |
| 120 | Ga0105238_10001288 | 3300009551 | Bacteria | 25197 |
| 121 | Ga0105249_10015629 | 3300009553 | Bacteria | 6720 |
| 122 | Ga0105239_10953020 | 3300010375 | Bacteria | 986 |
| 123 | Ga0105246_10055233 | 3300011119 | Archaea | 2740 |
| 124 | Ga0105246_10692105 | 3300011119 | Bacteria | 892 |
| 125 | Ga0157371_10126205 | 3300013102 | Bacteria | 1820 |
| 126 | Ga0157371_10541679 | 3300013102 | Unclassified | 862 |
| 127 | Ga0157378_10005662 | 3300013297 | Bacteria | 10935 |
| 128 | Ga0157378_10017686 | 3300013297 | Bacteria | 6259 |
| 129 | Ga0157378_10017871 | 3300013297 | Bacteria | 6223 |
| 130 | Ga0157378_10039830 | 3300013297 | Bacteria | 4167 |
| 131 | Ga0157378_10362666 | 3300013297 | Bacteria | 1418 |
| 132 | Ga0157378_10484876 | 3300013297 | Bacteria | 1232 |
| 133 | Ga0163162_10064457 | 3300013306 | Bacteria | 3709 |
| 134 | Ga0163162_10174454 | 3300013306 | Bacteria | 2275 |
| 135 | Ga0163162_11127243 | 3300013306 | Bacteria | 889 |
| 136 | Ga0157372_10178504 | 3300013307 | Bacteria | 2458 |
| 137 | Ga0157372_10674828 | 3300013307 | Bacteria | 1203 |
| 138 | Ga0157372_10985360 | 3300013307 | Bacteria | 976 |
| 139 | Ga0157375_10000014 | 3300013308 | Bacteria | 319231 |
| 140 | Ga0157375_10100242 | 3300013308 | Bacteria | 2976 |
| 141 | Ga0157375_10132097 | 3300013308 | Bacteria | 2617 |
| 142 | Ga0157375_10356853 | 3300013308 | Bacteria | 1628 |
| 143 | Ga0157375_10385622 | 3300013308 | Bacteria | 1568 |
| 144 | Ga0157375_10435762 | 3300013308 | Bacteria | 1477 |
| 145 | Ga0163163_10110099 | 3300014325 | Bacteria | 2782 |
| 146 | Ga0163163_10417963 | 3300014325 | Bacteria | 1400 |
| 147 | Ga0163163_10776432 | 3300014325 | Unclassified | 1021 |
| 148 | Ga0157380_10014128 | 3300014326 | Bacteria | 5837 |
| 149 | Ga0157380_10397579 | 3300014326 | Archaea | 1306 |
| 150 | Ga0157380_10420449 | 3300014326 | Bacteria | 1275 |
| 151 | Ga0157377_10021934 | 3300014745 | Archaea | 3366 |
| 152 | Ga0157379_10569924 | 3300014968 | Bacteria | 1055 |
| 153 | Ga0182007_10004268 | 3300015262 | Bacteria | 6520 |
| 154 | Ga0163161_10112153 | 3300017792 | Bacteria | 2040 |
| 155 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 156 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 157 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 158 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 159 | Ga0209564_1000328 | 3300025295 | Bacteria | 92405 |
| 160 | Ga0209564_1043410 | 3300025295 | Bacteria | 1180 |
| 161 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 162 | Ga0209758_1002394 | 3300025297 | Bacteria | 19281 |
| 163 | Ga0209758_1006613 | 3300025297 | Bacteria | 8214 |
| 164 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 165 | Ga0207426_1000925 | 3300025302 | Bacteria | 29342 |
| 166 | Ga0207426_1067980 | 3300025302 | Bacteria | 1003 |
| 167 | Ga0209051_1023842 | 3300025303 | Bacteria | 2534 |
| 168 | Ga0209257_1001535 | 3300025304 | Bacteria | 26927 |
| 169 | Ga0207656_10000170 | 3300025321 | Bacteria | 23964 |
| 170 | Ga0207682_10302917 | 3300025893 | Bacteria | 749 |
| 171 | Ga0207710_10007980 | 3300025900 | Bacteria | 4475 |
| 172 | Ga0207710_10447309 | 3300025900 | Unclassified | 667 |
| 173 | Ga0207680_10064174 | 3300025903 | Bacteria | 2251 |
| 174 | Ga0207645_10013933 | 3300025907 | Bacteria | 5392 |
| 175 | Ga0207643_10094383 | 3300025908 | Bacteria | 1748 |
| 176 | Ga0207684_10032852 | 3300025910 | Bacteria | 4413 |
| 177 | Ga0207684_10143262 | 3300025910 | Bacteria | 2055 |
| 178 | Ga0207654_10055270 | 3300025911 | Bacteria | 2298 |
| 179 | Ga0207695_10000181 | 3300025913 | Bacteria | 185042 |
| 180 | Ga0207662_10062446 | 3300025918 | Bacteria | 2239 |
| 181 | Ga0207662_10065398 | 3300025918 | Bacteria | 2190 |
| 182 | Ga0207649_10250894 | 3300025920 | Bacteria | 1274 |
| 183 | Ga0207646_10137696 | 3300025922 | Bacteria | 2198 |
| 184 | Ga0207681_10340149 | 3300025923 | Bacteria | 1198 |
| 185 | Ga0207694_10001419 | 3300025924 | Bacteria | 20527 |
| 186 | Ga0207659_10224797 | 3300025926 | Bacteria | 1511 |
| 187 | Ga0207644_10491556 | 3300025931 | Bacteria | 1011 |
| 188 | Ga0207690_10331552 | 3300025932 | Archaea | 1199 |
| 189 | Ga0207706_10020437 | 3300025933 | Bacteria | 5953 |
| 190 | Ga0207709_10003848 | 3300025935 | Bacteria | 8792 |
| 191 | Ga0207709_10031615 | 3300025935 | Bacteria | 3093 |
| 192 | Ga0207670_10566949 | 3300025936 | Bacteria | 929 |
| 193 | Ga0207704_10351141 | 3300025938 | Bacteria | 1148 |
| 194 | Ga0207704_10790956 | 3300025938 | Bacteria | 791 |
| 195 | Ga0207691_10001244 | 3300025940 | Bacteria | 25435 |
| 196 | Ga0207691_10423155 | 3300025940 | Bacteria | 1135 |
| 197 | Ga0207691_10696562 | 3300025940 | Bacteria | 857 |
| 198 | Ga0207689_10033324 | 3300025942 | Bacteria | 4281 |
| 199 | Ga0207689_10256421 | 3300025942 | Bacteria | 1447 |
| 200 | Ga0207689_10870707 | 3300025942 | Bacteria | 760 |
| 201 | Ga0207689_10956542 | 3300025942 | Bacteria | 723 |
| 202 | Ga0207661_11283318 | 3300025944 | Bacteria | 673 |
| 203 | Ga0207679_10940111 | 3300025945 | Bacteria | 791 |
| 204 | Ga0207667_10000242 | 3300025949 | Bacteria | 76730 |
| 205 | Ga0207651_10091695 | 3300025960 | Bacteria | 2226 |
| 206 | Ga0207712_10142610 | 3300025961 | Bacteria | 1841 |
| 207 | Ga0207712_10332741 | 3300025961 | Bacteria | 1257 |
| 208 | Ga0207668_10193173 | 3300025972 | Bacteria | 1615 |
| 209 | Ga0207668_10493431 | 3300025972 | Bacteria | 1052 |
| 210 | Ga0207640_10310619 | 3300025981 | Bacteria | 1251 |
| 211 | Ga0207658_10037842 | 3300025986 | Bacteria | 3471 |
| 212 | Ga0207658_10203372 | 3300025986 | Bacteria | 1655 |
| 213 | Ga0207658_10371026 | 3300025986 | Bacteria | 1251 |
| 214 | Ga0207677_10077828 | 3300026023 | Bacteria | 2366 |
| 215 | Ga0207708_10054305 | 3300026075 | Archaea | 3054 |
| 216 | Ga0207708_10709114 | 3300026075 | Bacteria | 861 |
| 217 | Ga0207702_10129529 | 3300026078 | Bacteria | 2269 |
| 218 | Ga0207641_10000601 | 3300026088 | Bacteria | 39530 |
| 219 | Ga0207641_10124297 | 3300026088 | Bacteria | 2307 |
| 220 | Ga0207641_11413482 | 3300026088 | Bacteria | 697 |
| 221 | Ga0207648_10001875 | 3300026089 | Bacteria | 22995 |
| 222 | Ga0207648_10061273 | 3300026089 | Bacteria | 3281 |
| 223 | Ga0207648_10172184 | 3300026089 | Bacteria | 1914 |
| 224 | Ga0207648_10378847 | 3300026089 | Archaea | 1279 |
| 225 | Ga0207676_10051427 | 3300026095 | Bacteria | 3217 |
| 226 | Ga0207676_10087016 | 3300026095 | Bacteria | 2554 |
| 227 | Ga0207674_10544905 | 3300026116 | Bacteria | 1121 |
| 228 | Ga0207674_10795449 | 3300026116 | Bacteria | 913 |
| 229 | Ga0207674_10858022 | 3300026116 | Bacteria | 876 |
| 230 | Ga0207675_100132643 | 3300026118 | Bacteria | 2362 |
| 231 | Ga0207675_100235438 | 3300026118 | Bacteria | 1768 |
| 232 | Ga0207675_101453298 | 3300026118 | Bacteria | 706 |
| 233 | Ga0207698_11181344 | 3300026142 | Bacteria | 779 |
| 234 | Ga0207698_11523146 | 3300026142 | Bacteria | 684 |
| 235 | Ga0268266_10335151 | 3300028379 | Bacteria | 1419 |
| 236 | Ga0268265_10191191 | 3300028380 | Bacteria | 1768 |
| 237 | Ga0268264_10032788 | 3300028381 | Bacteria | 4262 |
| 238 | Ga0268264_10093042 | 3300028381 | Bacteria | 2603 |
| 239 | Ga0265323_10001076 | 3300028653 | Bacteria | 14126 |
| 240 | Ga0307509_10089826 | 3300031507 | Bacteria | 3149 |
| 241 | Ga0307408_100002051 | 3300031548 | Bacteria | 14501 |
| 242 | Ga0307408_100063162 | 3300031548 | Bacteria | 2708 |
| 243 | Ga0307516_10010004 | 3300031730 | Bacteria | 10501 |
| 244 | Ga0307516_10418432 | 3300031730 | Bacteria | 998 |
| 245 | Ga0307405_10052493 | 3300031731 | Bacteria | 2535 |
| 246 | Ga0307406_10082207 | 3300031901 | Bacteria | 2144 |
| 247 | Ga0307406_10243308 | 3300031901 | Bacteria | 1351 |
| 248 | Ga0307407_10088531 | 3300031903 | Bacteria | 1892 |
| 249 | Ga0307412_10132917 | 3300031911 | Bacteria | 1810 |
| 250 | Ga0307414_10889187 | 3300032004 | Bacteria | 816 |
| 251 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 252 | Ga0373951_0111681 | 3300035091 | Bacteria | 736 |
| 253 | Ga0373932_0000151 | 3300035112 | Bacteria | 19930 |
| 254 | Ga0373945_0235064 | 3300035116 | Bacteria | 770 |
| 255 | Ga0373935_0685708 | 3300035692 | Bacteria | 753 |
| 256 | Ga0373927_0026209 | 3300035695 | Bacteria | 3810 |
| 257 | Ga0373937_0882534 | 3300036401 | Bacteria | 843 |
| 258 | Ga0395900_0281112 | 3300037418 | Bacteria | 1656 |
| 259 | Ga0395900_0426110 | 3300037418 | Bacteria | 1287 |
| 260 | Ga0395905_0058961 | 3300037471 | Bacteria | 3589 |
| 261 | Ga0395905_0358547 | 3300037471 | Bacteria | 1351 |
| 262 | Ga0451800_0490252 | 3300041459 | Bacteria | 701 |
| 263 | Ga0450923_011579 | 3300042125 | Bacteria | 1588 |
| 264 | Ga0439458_0075696 | 3300042157 | Bacteria | 854 |
| 265 | Ga0451577_0156611 | 3300042876 | Bacteria | 2050 |
| 266 | Ga0451577_0378054 | 3300042876 | Bacteria | 1285 |
| 267 | Ga0466972_0000030 | 3300044658 | Bacteria | 161580 |
| 268 | Ga0453683_0041067 | 3300044673 | Bacteria | 2904 |
| 269 | Ga0453683_0046475 | 3300044673 | Bacteria | 2722 |
| 270 | Ga0453683_0163611 | 3300044673 | Bacteria | 1408 |
| 271 | Ga0466965_0181589 | 3300044683 | Bacteria | 1110 |
| 272 | Ga0453684_0000388 | 3300044712 | Bacteria | 180685 |
| 273 | Ga0453684_0000538 | 3300044712 | Bacteria | 143872 |
| 274 | Ga0453684_0005319 | 3300044712 | Bacteria | 25648 |
| 275 | Ga0453684_0648343 | 3300044712 | Unclassified | 1152 |
| 276 | Ga0451576_0000604 | 3300045051 | Bacteria | 75646 |
| 277 | Ga0451576_0234982 | 3300045051 | Bacteria | 1914 |
| 278 | Ga0451576_0236711 | 3300045051 | Bacteria | 1907 |
| 279 | Ga0451576_0368262 | 3300045051 | Bacteria | 1505 |
| 280 | Ga0451576_0507132 | 3300045051 | Unclassified | 1267 |
| 281 | Ga0495582_0194754 | 3300046473 | Bacteria | 1157 |
| 282 | Ga0495648_0008648 | 3300046524 | Bacteria | 7982 |
| 283 | Ga0495652_0180801 | 3300046529 | Bacteria | 1619 |
| 284 | Ga0495635_0020844 | 3300046663 | Bacteria | 4566 |
| 285 | Ga0495599_0068957 | 3300046678 | Bacteria | 2208 |
| 286 | Ga0495687_000119 | 3300047443 | Bacteria | 121587 |
| 287 | Ga0495675_0170285 | 3300047444 | Bacteria | 1338 |
| 288 | Ga0501034_0027449 | 3300049571 | Bacteria | 5791 |
| 289 | Ga0501038_0161267 | 3300049574 | Bacteria | 1822 |
| 290 | Ga0501071_0102753 | 3300049587 | Bacteria | 2108 |
| 291 | Ga0501249_002810 | 3300049679 | Bacteria | 3504 |
| 292 | Ga0501257_057988 | 3300049686 | Unclassified | 975 |
| 293 | Ga0501264_000026 | 3300049761 | Bacteria | 22924 |
| 294 | Ga0501266_000048 | 3300049763 | Bacteria | 20803 |
| 295 | Ga0501044_0367095 | 3300049823 | Bacteria | 1357 |
| 296 | nmdc:mga0k408_138088_c1 | 3300050493 | Bacteria | 1449 |
| 297 | nmdc:mga0k408_216873_c1 | 3300050493 | Bacteria | 1142 |
| 298 | nmdc:mga0qj67_193247_c1 | 3300050509 | Bacteria | 1654 |
| 299 | nmdc:mga06r32_193692_c1 | 3300050510 | Bacteria | 2020 |
| 300 | nmdc:mga06r32_2273_c1 | 3300050510 | Bacteria | 17178 |
| 301 | nmdc:mga0rr50_535664_c1 | 3300050513 | Bacteria | 997 |
| 302 | Ga0495601_0109456 | 3300053077 | Bacteria | 1788 |
| 303 | Ga0500644_0000211 | 3300053088 | Bacteria | 34996 |
| 304 | Ga0500642_0050106 | 3300053130 | Bacteria | 1839 |
| 305 | Ga0500652_161854 | 3300053131 | Bacteria | 924 |
| 306 | Ga0500658_0000003 | 3300053134 | Bacteria | 512506 |
| 307 | Ga0500603_048239 | 3300053150 | Bacteria | 1158 |
| 308 | Ga0500622_0006216 | 3300053156 | Bacteria | 6988 |
| 309 | Ga0500633_0000660 | 3300053160 | Bacteria | 5761 |
| 310 | Ga0500634_0111459 | 3300053161 | Bacteria | 1349 |
| 311 | Ga0590071_003777 | 3300059421 | Bacteria | 3715 |
| 312 | Ga0590075_009804 | 3300059424 | Bacteria | 2299 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032004 | Ga0307414_10889187 | Ga0307414_108891871 | 173 |
| 2 | 3300025918 | Ga0207662_10062446 | Ga0207662_100624464 | 178 |
| 3 | 3300025940 | Ga0207691_10696562 | Ga0207691_106965621 | 179 |
| 4 | 3300003323 | rootH1_10077475 | rootH1_100774756 | 181 |
| 5 | 3300005367 | Ga0070667_100694275 | Ga0070667_1006942752 | 181 |
| 6 | 3300005456 | Ga0070678_100145871 | Ga0070678_1001458711 | 181 |
| 7 | 3300005543 | Ga0070672_100797042 | Ga0070672_1007970421 | 181 |
| 8 | 3300005844 | Ga0068862_100280058 | Ga0068862_1002800581 | 181 |
| 9 | 3300013297 | Ga0157378_10005662 | Ga0157378_100056625 | 181 |
| 10 | 3300013297 | Ga0157378_10484876 | Ga0157378_104848761 | 181 |
| 11 | 3300013306 | Ga0163162_10174454 | Ga0163162_101744543 | 181 |
| 12 | 3300013308 | Ga0157375_10000014 | Ga0157375_10000014190 | 181 |
| 13 | 3300014325 | Ga0163163_10417963 | Ga0163163_104179631 | 181 |
| 14 | 3300025918 | Ga0207662_10065398 | Ga0207662_100653984 | 181 |
| 15 | 3300025938 | Ga0207704_10790956 | Ga0207704_107909562 | 181 |
| 16 | 3300031548 | Ga0307408_100002051 | Ga0307408_1000020514 | 181 |
| 17 | 3300031730 | Ga0307516_10010004 | Ga0307516_100100045 | 181 |
| 18 | 3300031901 | Ga0307406_10082207 | Ga0307406_100822073 | 181 |
| 19 | 3300035091 | Ga0373951_0111681 | Ga0373951_0111681_48_593 | 181 |
| 20 | 3300049587 | Ga0501071_0102753 | Ga0501071_0102753_511_1056 | 181 |
| 21 | 3300059421 | Ga0590071_003777 | Ga0590071_003777_379_924 | 181 |
| 22 | 3300059424 | Ga0590075_009804 | Ga0590075_009804_1128_1673 | 181 |
| 23 | iso_pu_bacteria | 2857618242 | 2857618717 | 181 |
| 24 | iso_pu_bacteria | 2889295896 | 2889300383 | 181 |
| 25 | iso_pu_bacteria | 2977254563 | 2977255540 | 181 |
| 26 | iso_pu_bacteria | 2981284811 | 2981287703 | 181 |
| 27 | iso_pu_bacteria | 2981289755 | 2981292897 | 181 |
| 28 | iso_pu_bacteria | 2981980479 | 2981982889 | 181 |
| 29 | iso_pu_bacteria | 2981985349 | 2981987799 | 181 |
| 30 | iso_pu_bacteria | 2788500588 | 2791213333 | 182 |
| 31 | iso_pu_bacteria | 2818991451 | 2819625631 | 182 |
| 32 | iso_pu_bacteria | 2904606771 | 2904608677 | 182 |
| 33 | 3300025302 | Ga0207426_1067980 | Ga0207426_10679801 | 183 |
| 34 | 3300005617 | Ga0068859_101416820 | Ga0068859_1014168201 | 184 |
| 35 | 3300005985 | Ga0081539_10148603 | Ga0081539_101486032 | 184 |
| 36 | 3300006195 | Ga0075366_10250064 | Ga0075366_102500642 | 184 |
| 37 | 3300006931 | Ga0097620_101416794 | Ga0097620_1014167941 | 184 |
| 38 | 3300031507 | Ga0307509_10089826 | Ga0307509_100898265 | 184 |
| 39 | 3300050493 | nmdc:mga0k408_138088_c1 | nmdc:mga0k408_138088_c1_745_1362 | 184 |
| 40 | iso_pu_bacteria | 2896109856 | 2896111170 | 184 |
| 41 | iso_pu_bacteria | 2928510474 | 2928515020 | 184 |
| 42 | iso_pu_bacteria | 3006988479 | 3006992628 | 184 |
| 43 | 3300005290 | Ga0065712_10247132 | Ga0065712_102471321 | 185 |
| 44 | 3300005293 | Ga0065715_10115169 | Ga0065715_101151691 | 185 |
| 45 | 3300005545 | Ga0070695_100296868 | Ga0070695_1002968681 | 185 |
| 46 | 3300005578 | Ga0068854_100150023 | Ga0068854_1001500232 | 185 |
| 47 | 3300005616 | Ga0068852_101326863 | Ga0068852_1013268632 | 185 |
| 48 | 3300005617 | Ga0068859_100367314 | Ga0068859_1003673142 | 185 |
| 49 | 3300005841 | Ga0068863_100164219 | Ga0068863_1001642192 | 185 |
| 50 | 3300005841 | Ga0068863_100220125 | Ga0068863_1002201253 | 185 |
| 51 | 3300005842 | Ga0068858_100427167 | Ga0068858_1004271672 | 185 |
| 52 | 3300005843 | Ga0068860_100229627 | Ga0068860_1002296272 | 185 |
| 53 | 3300006931 | Ga0097620_100367301 | Ga0097620_1003673012 | 185 |
| 54 | 3300009098 | Ga0105245_10425372 | Ga0105245_104253721 | 185 |
| 55 | 3300009101 | Ga0105247_10000761 | Ga0105247_100007615 | 185 |
| 56 | 3300009101 | Ga0105247_10470299 | Ga0105247_104702991 | 185 |
| 57 | 3300009174 | Ga0105241_10055340 | Ga0105241_100553401 | 185 |
| 58 | 3300009176 | Ga0105242_10777987 | Ga0105242_107779872 | 185 |
| 59 | 3300009176 | Ga0105242_11473759 | Ga0105242_114737591 | 185 |
| 60 | 3300009551 | Ga0105238_10001288 | Ga0105238_1000128812 | 185 |
| 61 | 3300010375 | Ga0105239_10953020 | Ga0105239_109530202 | 185 |
| 62 | 3300013308 | Ga0157375_10385622 | Ga0157375_103856222 | 185 |
| 63 | 3300014326 | Ga0157380_10420449 | Ga0157380_104204491 | 185 |
| 64 | 3300014968 | Ga0157379_10569924 | Ga0157379_105699242 | 185 |
| 65 | 3300025900 | Ga0207710_10007980 | Ga0207710_100079805 | 185 |
| 66 | 3300025911 | Ga0207654_10055270 | Ga0207654_100552703 | 185 |
| 67 | 3300025924 | Ga0207694_10001419 | Ga0207694_1000141917 | 185 |
| 68 | 3300025935 | Ga0207709_10031615 | Ga0207709_100316153 | 185 |
| 69 | 3300026078 | Ga0207702_10129529 | Ga0207702_101295291 | 185 |
| 70 | 3300028381 | Ga0268264_10093042 | Ga0268264_100930422 | 185 |
| 71 | 3300031730 | Ga0307516_10418432 | Ga0307516_104184321 | 185 |
| 72 | 3300032005 | Ga0307411_10000001 | Ga0307411_10000001388 | 185 |
| 73 | 3300035112 | Ga0373932_0000151 | Ga0373932_0000151_5318_5875 | 185 |
| 74 | 3300035692 | Ga0373935_0685708 | Ga0373935_0685708_38_595 | 185 |
| 75 | 3300045051 | Ga0451576_0236711 | Ga0451576_0236711_173_730 | 185 |
| 76 | 3300049679 | Ga0501249_002810 | Ga0501249_002810_1098_1655 | 185 |
| 77 | 3300049763 | Ga0501266_000048 | Ga0501266_000048_19451_20008 | 185 |
| 78 | 3300053134 | Ga0500658_0000003 | Ga0500658_0000003_229403_229960 | 185 |
| 79 | 3300005347 | Ga0070668_100313719 | Ga0070668_1003137192 | 186 |
| 80 | 3300005441 | Ga0070700_100398553 | Ga0070700_1003985532 | 186 |
| 81 | 3300005466 | Ga0070685_10060752 | Ga0070685_100607523 | 186 |
| 82 | 3300005543 | Ga0070672_100000713 | Ga0070672_10000071314 | 186 |
| 83 | 3300005615 | Ga0070702_100241175 | Ga0070702_1002411752 | 186 |
| 84 | 3300005617 | Ga0068859_100642224 | Ga0068859_1006422241 | 186 |
| 85 | 3300005719 | Ga0068861_100027092 | Ga0068861_1000270925 | 186 |
| 86 | 3300005841 | Ga0068863_100003469 | Ga0068863_10000346912 | 186 |
| 87 | 3300006931 | Ga0097620_100642183 | Ga0097620_1006421831 | 186 |
| 88 | 3300007076 | Ga0075435_100465223 | Ga0075435_1004652232 | 186 |
| 89 | 3300011119 | Ga0105246_10055233 | Ga0105246_100552333 | 186 |
| 90 | 3300013297 | Ga0157378_10017871 | Ga0157378_100178716 | 186 |
| 91 | 3300013308 | Ga0157375_10435762 | Ga0157375_104357623 | 186 |
| 92 | 3300014326 | Ga0157380_10397579 | Ga0157380_103975791 | 186 |
| 93 | 3300014745 | Ga0157377_10021934 | Ga0157377_100219341 | 186 |
| 94 | 3300025908 | Ga0207643_10094383 | Ga0207643_100943833 | 186 |
| 95 | 3300025932 | Ga0207690_10331552 | Ga0207690_103315521 | 186 |
| 96 | 3300025940 | Ga0207691_10001244 | Ga0207691_1000124417 | 186 |
| 97 | 3300025972 | Ga0207668_10493431 | Ga0207668_104934312 | 186 |
| 98 | 3300026075 | Ga0207708_10054305 | Ga0207708_100543051 | 186 |
| 99 | 3300026075 | Ga0207708_10709114 | Ga0207708_107091141 | 186 |
| 100 | 3300026088 | Ga0207641_10000601 | Ga0207641_1000060129 | 186 |
| 101 | 3300026089 | Ga0207648_10378847 | Ga0207648_103788471 | 186 |
| 102 | 3300028380 | Ga0268265_10191191 | Ga0268265_101911913 | 186 |
| 103 | 3300041459 | Ga0451800_0490252 | Ga0451800_0490252_61_621 | 186 |
| 104 | 3300044712 | Ga0453684_0648343 | Ga0453684_0648343_252_812 | 186 |
| 105 | 3300046473 | Ga0495582_0194754 | Ga0495582_0194754_543_1103 | 186 |
| 106 | 3300046524 | Ga0495648_0008648 | Ga0495648_0008648_5980_6540 | 186 |
| 107 | 3300049686 | Ga0501257_057988 | Ga0501257_057988_69_629 | 186 |
| 108 | 3300050513 | nmdc:mga0rr50_535664_c1 | nmdc:mga0rr50_535664_c1_137_697 | 186 |
| 109 | 3300053130 | Ga0500642_0050106 | Ga0500642_0050106_491_1051 | 186 |
| 110 | 3300053156 | Ga0500622_0006216 | Ga0500622_0006216_1981_2541 | 186 |
| 111 | 3300003322 | rootL2_10080850 | rootL2_100808503 | 187 |
| 112 | 3300005293 | Ga0065715_10175080 | Ga0065715_101750801 | 187 |
| 113 | 3300005328 | Ga0070676_10052158 | Ga0070676_100521581 | 187 |
| 114 | 3300005334 | Ga0068869_100094532 | Ga0068869_1000945322 | 187 |
| 115 | 3300005338 | Ga0068868_100008724 | Ga0068868_10000872410 | 187 |
| 116 | 3300005339 | Ga0070660_101276186 | Ga0070660_1012761861 | 187 |
| 117 | 3300005340 | Ga0070689_100294611 | Ga0070689_1002946111 | 187 |
| 118 | 3300005344 | Ga0070661_100229110 | Ga0070661_1002291102 | 187 |
| 119 | 3300005353 | Ga0070669_100064279 | Ga0070669_1000642794 | 187 |
| 120 | 3300005355 | Ga0070671_100001514 | Ga0070671_10000151410 | 187 |
| 121 | 3300005364 | Ga0070673_100037100 | Ga0070673_1000371005 | 187 |
| 122 | 3300005366 | Ga0070659_100294336 | Ga0070659_1002943362 | 187 |
| 123 | 3300005457 | Ga0070662_100086235 | Ga0070662_1000862352 | 187 |
| 124 | 3300005459 | Ga0068867_100015193 | Ga0068867_1000151936 | 187 |
| 125 | 3300005564 | Ga0070664_100346377 | Ga0070664_1003463772 | 187 |
| 126 | 3300005616 | Ga0068852_100135914 | Ga0068852_1001359141 | 187 |
| 127 | 3300005617 | Ga0068859_100140571 | Ga0068859_1001405712 | 187 |
| 128 | 3300006847 | Ga0075431_100015208 | Ga0075431_1000152081 | 187 |
| 129 | 3300006931 | Ga0097620_100140583 | Ga0097620_1001405832 | 187 |
| 130 | 3300013102 | Ga0157371_10126205 | Ga0157371_101262052 | 187 |
| 131 | 3300013306 | Ga0163162_10064457 | Ga0163162_100644572 | 187 |
| 132 | 3300013306 | Ga0163162_11127243 | Ga0163162_111272432 | 187 |
| 133 | 3300014325 | Ga0163163_10776432 | Ga0163163_107764322 | 187 |
| 134 | 3300017792 | Ga0163161_10112153 | Ga0163161_101121532 | 187 |
| 135 | 3300025893 | Ga0207682_10302917 | Ga0207682_103029171 | 187 |
| 136 | 3300025907 | Ga0207645_10013933 | Ga0207645_100139336 | 187 |
| 137 | 3300025920 | Ga0207649_10250894 | Ga0207649_102508941 | 187 |
| 138 | 3300025931 | Ga0207644_10491556 | Ga0207644_104915561 | 187 |
| 139 | 3300025933 | Ga0207706_10020437 | Ga0207706_100204376 | 187 |
| 140 | 3300025936 | Ga0207670_10566949 | Ga0207670_105669492 | 187 |
| 141 | 3300025938 | Ga0207704_10351141 | Ga0207704_103511411 | 187 |
| 142 | 3300025942 | Ga0207689_10033324 | Ga0207689_100333246 | 187 |
| 143 | 3300025942 | Ga0207689_10870707 | Ga0207689_108707071 | 187 |
| 144 | 3300025944 | Ga0207661_11283318 | Ga0207661_112833181 | 187 |
| 145 | 3300025945 | Ga0207679_10940111 | Ga0207679_109401111 | 187 |
| 146 | 3300025960 | Ga0207651_10091695 | Ga0207651_100916952 | 187 |
| 147 | 3300025981 | Ga0207640_10310619 | Ga0207640_103106192 | 187 |
| 148 | 3300026023 | Ga0207677_10077828 | Ga0207677_100778281 | 187 |
| 149 | 3300026088 | Ga0207641_10124297 | Ga0207641_101242973 | 187 |
| 150 | 3300026089 | Ga0207648_10172184 | Ga0207648_101721843 | 187 |
| 151 | 3300026116 | Ga0207674_10544905 | Ga0207674_105449051 | 187 |
| 152 | 3300026118 | Ga0207675_100132643 | Ga0207675_1001326431 | 187 |
| 153 | 3300031731 | Ga0307405_10052493 | Ga0307405_100524933 | 187 |
| 154 | 3300031901 | Ga0307406_10243308 | Ga0307406_102433082 | 187 |
| 155 | 3300031911 | Ga0307412_10132917 | Ga0307412_101329172 | 187 |
| 156 | 3300036401 | Ga0373937_0882534 | Ga0373937_0882534_56_619 | 187 |
| 157 | 3300037418 | Ga0395900_0426110 | Ga0395900_0426110_599_1162 | 187 |
| 158 | 3300042125 | Ga0450923_011579 | Ga0450923_011579_258_821 | 187 |
| 159 | 3300042157 | Ga0439458_0075696 | Ga0439458_0075696_128_691 | 187 |
| 160 | 3300042876 | Ga0451577_0378054 | Ga0451577_0378054_169_732 | 187 |
| 161 | 3300045051 | Ga0451576_0234982 | Ga0451576_0234982_819_1382 | 187 |
| 162 | 3300046529 | Ga0495652_0180801 | Ga0495652_0180801_521_1084 | 187 |
| 163 | 3300046678 | Ga0495599_0068957 | Ga0495599_0068957_434_997 | 187 |
| 164 | 3300047444 | Ga0495675_0170285 | Ga0495675_0170285_419_982 | 187 |
| 165 | 3300050510 | nmdc:mga06r32_2273_c1 | nmdc:mga06r32_2273_c1_37_600 | 187 |
| 166 | 3300053131 | Ga0500652_161854 | Ga0500652_161854_103_672 | 187 |
| 167 | 3300002459 | JGI24751J29686_10001015 | JGI24751J29686_100010155 | 188 |
| 168 | 3300002773 | JGI25152J39213_1002536 | JGI25152J39213_10025363 | 188 |
| 169 | 3300002774 | JGI25150J39212_1000057 | JGI25150J39212_100005741 | 188 |
| 170 | 3300003187 | JGI25151J46595_10000229 | JGI25151J46595_1000022941 | 188 |
| 171 | 3300003215 | JGI25153J46596_10000164 | JGI25153J46596_100001644 | 188 |
| 172 | 3300005331 | Ga0070670_100054490 | Ga0070670_1000544905 | 188 |
| 173 | 3300005334 | Ga0068869_100916007 | Ga0068869_1009160072 | 188 |
| 174 | 3300005335 | Ga0070666_10087116 | Ga0070666_100871162 | 188 |
| 175 | 3300005337 | Ga0070682_100479927 | Ga0070682_1004799272 | 188 |
| 176 | 3300005347 | Ga0070668_100255825 | Ga0070668_1002558252 | 188 |
| 177 | 3300005367 | Ga0070667_100285428 | Ga0070667_1002854282 | 188 |
| 178 | 3300005459 | Ga0068867_100036341 | Ga0068867_1000363412 | 188 |
| 179 | 3300005459 | Ga0068867_100109211 | Ga0068867_1001092113 | 188 |
| 180 | 3300005518 | Ga0070699_100218041 | Ga0070699_1002180413 | 188 |
| 181 | 3300005544 | Ga0070686_100002589 | Ga0070686_1000025898 | 188 |
| 182 | 3300005546 | Ga0070696_100643793 | Ga0070696_1006437932 | 188 |
| 183 | 3300005577 | Ga0068857_100891069 | Ga0068857_1008910691 | 188 |
| 184 | 3300005578 | Ga0068854_100868293 | Ga0068854_1008682932 | 188 |
| 185 | 3300005616 | Ga0068852_101618528 | Ga0068852_1016185281 | 188 |
| 186 | 3300005618 | Ga0068864_100077889 | Ga0068864_1000778892 | 188 |
| 187 | 3300005718 | Ga0068866_10018851 | Ga0068866_100188512 | 188 |
| 188 | 3300006844 | Ga0075428_100010731 | Ga0075428_1000107317 | 188 |
| 189 | 3300009011 | Ga0105251_10293105 | Ga0105251_102931052 | 188 |
| 190 | 3300009148 | Ga0105243_10021347 | Ga0105243_100213473 | 188 |
| 191 | 3300009174 | Ga0105241_10435657 | Ga0105241_104356572 | 188 |
| 192 | 3300009553 | Ga0105249_10015629 | Ga0105249_100156296 | 188 |
| 193 | 3300011119 | Ga0105246_10692105 | Ga0105246_106921051 | 188 |
| 194 | 3300013102 | Ga0157371_10541679 | Ga0157371_105416792 | 188 |
| 195 | 3300013297 | Ga0157378_10017686 | Ga0157378_100176864 | 188 |
| 196 | 3300013297 | Ga0157378_10039830 | Ga0157378_100398303 | 188 |
| 197 | 3300013297 | Ga0157378_10362666 | Ga0157378_103626662 | 188 |
| 198 | 3300013307 | Ga0157372_10178504 | Ga0157372_101785042 | 188 |
| 199 | 3300013307 | Ga0157372_10674828 | Ga0157372_106748281 | 188 |
| 200 | 3300013308 | Ga0157375_10356853 | Ga0157375_103568532 | 188 |
| 201 | 3300014325 | Ga0163163_10110099 | Ga0163163_101100993 | 188 |
| 202 | 3300014326 | Ga0157380_10014128 | Ga0157380_100141284 | 188 |
| 203 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007174 | 188 |
| 204 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006174 | 188 |
| 205 | 3300025294 | Ga0209025_1000025 | Ga0209025_10000254 | 188 |
| 206 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016174 | 188 |
| 207 | 3300025903 | Ga0207680_10064174 | Ga0207680_100641743 | 188 |
| 208 | 3300025935 | Ga0207709_10003848 | Ga0207709_100038487 | 188 |
| 209 | 3300025940 | Ga0207691_10423155 | Ga0207691_104231552 | 188 |
| 210 | 3300025961 | Ga0207712_10142610 | Ga0207712_101426101 | 188 |
| 211 | 3300025972 | Ga0207668_10193173 | Ga0207668_101931732 | 188 |
| 212 | 3300025986 | Ga0207658_10371026 | Ga0207658_103710262 | 188 |
| 213 | 3300026089 | Ga0207648_10001875 | Ga0207648_1000187512 | 188 |
| 214 | 3300026089 | Ga0207648_10061273 | Ga0207648_100612733 | 188 |
| 215 | 3300026095 | Ga0207676_10051427 | Ga0207676_100514274 | 188 |
| 216 | 3300026095 | Ga0207676_10087016 | Ga0207676_100870164 | 188 |
| 217 | 3300026116 | Ga0207674_10795449 | Ga0207674_107954491 | 188 |
| 218 | 3300026116 | Ga0207674_10858022 | Ga0207674_108580222 | 188 |
| 219 | 3300026118 | Ga0207675_100235438 | Ga0207675_1002354382 | 188 |
| 220 | 3300026118 | Ga0207675_101453298 | Ga0207675_1014532981 | 188 |
| 221 | 3300028381 | Ga0268264_10032788 | Ga0268264_100327882 | 188 |
| 222 | 3300028653 | Ga0265323_10001076 | Ga0265323_100010768 | 188 |
| 223 | 3300031548 | Ga0307408_100063162 | Ga0307408_1000631623 | 188 |
| 224 | 3300031903 | Ga0307407_10088531 | Ga0307407_100885313 | 188 |
| 225 | 3300037418 | Ga0395900_0281112 | Ga0395900_0281112_212_778 | 188 |
| 226 | 3300037471 | Ga0395905_0058961 | Ga0395905_0058961_1337_1903 | 188 |
| 227 | 3300044673 | Ga0453683_0041067 | Ga0453683_0041067_184_756 | 188 |
| 228 | 3300044712 | Ga0453684_0000388 | Ga0453684_0000388_2581_3153 | 188 |
| 229 | 3300045051 | Ga0451576_0000604 | Ga0451576_0000604_47095_47661 | 188 |
| 230 | 3300045051 | Ga0451576_0368262 | Ga0451576_0368262_240_812 | 188 |
| 231 | 3300045051 | Ga0451576_0507132 | Ga0451576_0507132_499_1068 | 188 |
| 232 | 3300046663 | Ga0495635_0020844 | Ga0495635_0020844_3790_4356 | 188 |
| 233 | 3300049571 | Ga0501034_0027449 | Ga0501034_0027449_4265_4834 | 188 |
| 234 | 3300049574 | Ga0501038_0161267 | Ga0501038_0161267_903_1490 | 188 |
| 235 | 3300049761 | Ga0501264_000026 | Ga0501264_000026_22347_22913 | 188 |
| 236 | 3300049823 | Ga0501044_0367095 | Ga0501044_0367095_478_1065 | 188 |
| 237 | 3300050493 | nmdc:mga0k408_216873_c1 | nmdc:mga0k408_216873_c1_261_827 | 188 |
| 238 | 3300053077 | Ga0495601_0109456 | Ga0495601_0109456_1022_1588 | 188 |
| 239 | 3300053088 | Ga0500644_0000211 | Ga0500644_0000211_7573_8139 | 188 |
| 240 | 3300053160 | Ga0500633_0000660 | Ga0500633_0000660_1159_1725 | 188 |
| 241 | 3300053161 | Ga0500634_0111459 | Ga0500634_0111459_112_678 | 188 |
| 242 | 3300005334 | Ga0068869_100125088 | Ga0068869_1001250883 | 189 |
| 243 | 3300005364 | Ga0070673_100159506 | Ga0070673_1001595062 | 189 |
| 244 | 3300005365 | Ga0070688_100520162 | Ga0070688_1005201622 | 189 |
| 245 | 3300005436 | Ga0070713_100415721 | Ga0070713_1004157212 | 189 |
| 246 | 3300005459 | Ga0068867_100111318 | Ga0068867_1001113182 | 189 |
| 247 | 3300005617 | Ga0068859_100774962 | Ga0068859_1007749622 | 189 |
| 248 | 3300005841 | Ga0068863_100429061 | Ga0068863_1004290611 | 189 |
| 249 | 3300005841 | Ga0068863_100551019 | Ga0068863_1005510192 | 189 |
| 250 | 3300005842 | Ga0068858_100174556 | Ga0068858_1001745562 | 189 |
| 251 | 3300005843 | Ga0068860_100207844 | Ga0068860_1002078443 | 189 |
| 252 | 3300006237 | Ga0097621_100216666 | Ga0097621_1002166662 | 189 |
| 253 | 3300006931 | Ga0097620_100774958 | Ga0097620_1007749582 | 189 |
| 254 | 3300013308 | Ga0157375_10132097 | Ga0157375_101320973 | 189 |
| 255 | 3300025986 | Ga0207658_10037842 | Ga0207658_100378423 | 189 |
| 256 | 3300026088 | Ga0207641_11413482 | Ga0207641_114134821 | 189 |
| 257 | 3300042876 | Ga0451577_0156611 | Ga0451577_0156611_709_1281 | 189 |
| 258 | 3300044658 | Ga0466972_0000030 | Ga0466972_0000030_13926_14591 | 189 |
| 259 | 3300044673 | Ga0453683_0163611 | Ga0453683_0163611_685_1254 | 189 |
| 260 | 3300044712 | Ga0453684_0000538 | Ga0453684_0000538_117474_118046 | 189 |
| 261 | 3300044712 | Ga0453684_0005319 | Ga0453684_0005319_347_916 | 189 |
| 262 | 3300005467 | Ga0070706_100024925 | Ga0070706_1000249253 | 190 |
| 263 | 3300013307 | Ga0157372_10985360 | Ga0157372_109853602 | 190 |
| 264 | 3300025910 | Ga0207684_10032852 | Ga0207684_100328524 | 190 |
| 265 | 3300025913 | Ga0207695_10000181 | Ga0207695_10000181149 | 190 |
| 266 | 3300001989 | JGI24739J22299_10012469 | JGI24739J22299_100124695 | 191 |
| 267 | 3300003215 | JGI25153J46596_10011436 | JGI25153J46596_100114364 | 191 |
| 268 | 3300003215 | JGI25153J46596_10020949 | JGI25153J46596_100209494 | 191 |
| 269 | 3300003320 | rootH2_10087534 | rootH2_100875344 | 191 |
| 270 | 3300003320 | rootH2_10311480 | rootH2_103114802 | 191 |
| 271 | 3300003323 | rootH1_10157402 | rootH1_101574023 | 191 |
| 272 | 3300003354 | JGI25160J50197_1000453 | JGI25160J50197_100045317 | 191 |
| 273 | 3300003771 | Ga0055526_1015529 | Ga0055526_10155294 | 191 |
| 274 | 3300003791 | Ga0055530_10000619 | Ga0055530_100006198 | 191 |
| 275 | 3300005262 | Ga0065165_1000182 | Ga0065165_100018245 | 191 |
| 276 | 3300005289 | Ga0065704_10130290 | Ga0065704_101302903 | 191 |
| 277 | 3300005290 | Ga0065712_10247744 | Ga0065712_102477441 | 191 |
| 278 | 3300005293 | Ga0065715_10299863 | Ga0065715_102998632 | 191 |
| 279 | 3300005331 | Ga0070670_100067326 | Ga0070670_1000673264 | 191 |
| 280 | 3300005354 | Ga0070675_100351793 | Ga0070675_1003517932 | 191 |
| 281 | 3300005445 | Ga0070708_100399291 | Ga0070708_1003992912 | 191 |
| 282 | 3300005467 | Ga0070706_100383167 | Ga0070706_1003831672 | 191 |
| 283 | 3300005468 | Ga0070707_100278032 | Ga0070707_1002780323 | 191 |
| 284 | 3300005471 | Ga0070698_100199962 | Ga0070698_1001999621 | 191 |
| 285 | 3300005518 | Ga0070699_100571828 | Ga0070699_1005718282 | 191 |
| 286 | 3300005834 | Ga0068851_10000105 | Ga0068851_1000010515 | 191 |
| 287 | 3300006358 | Ga0068871_101109989 | Ga0068871_1011099891 | 191 |
| 288 | 3300006847 | Ga0075431_100100044 | Ga0075431_1001000444 | 191 |
| 289 | 3300009147 | Ga0114129_10226907 | Ga0114129_102269073 | 191 |
| 290 | 3300009147 | Ga0114129_10263507 | Ga0114129_102635072 | 191 |
| 291 | 3300009148 | Ga0105243_11213768 | Ga0105243_112137682 | 191 |
| 292 | 3300013308 | Ga0157375_10100242 | Ga0157375_101002423 | 191 |
| 293 | 3300015262 | Ga0182007_10004268 | Ga0182007_100042686 | 191 |
| 294 | 3300025273 | Ga0209673_1000016 | Ga0209673_100001614 | 191 |
| 295 | 3300025295 | Ga0209564_1000328 | Ga0209564_100032868 | 191 |
| 296 | 3300025295 | Ga0209564_1043410 | Ga0209564_10434103 | 191 |
| 297 | 3300025297 | Ga0209758_1002394 | Ga0209758_100239410 | 191 |
| 298 | 3300025297 | Ga0209758_1006613 | Ga0209758_10066137 | 191 |
| 299 | 3300025298 | Ga0209050_1000124 | Ga0209050_1000124164 | 191 |
| 300 | 3300025302 | Ga0207426_1000925 | Ga0207426_100092515 | 191 |
| 301 | 3300025303 | Ga0209051_1023842 | Ga0209051_10238422 | 191 |
| 302 | 3300025304 | Ga0209257_1001535 | Ga0209257_100153517 | 191 |
| 303 | 3300025321 | Ga0207656_10000170 | Ga0207656_100001706 | 191 |
| 304 | 3300025900 | Ga0207710_10447309 | Ga0207710_104473091 | 191 |
| 305 | 3300025910 | Ga0207684_10143262 | Ga0207684_101432622 | 191 |
| 306 | 3300025922 | Ga0207646_10137696 | Ga0207646_101376963 | 191 |
| 307 | 3300025923 | Ga0207681_10340149 | Ga0207681_103401493 | 191 |
| 308 | 3300025926 | Ga0207659_10224797 | Ga0207659_102247973 | 191 |
| 309 | 3300025942 | Ga0207689_10256421 | Ga0207689_102564211 | 191 |
| 310 | 3300025942 | Ga0207689_10956542 | Ga0207689_109565421 | 191 |
| 311 | 3300025949 | Ga0207667_10000242 | Ga0207667_1000024241 | 191 |
| 312 | 3300025961 | Ga0207712_10332741 | Ga0207712_103327411 | 191 |
| 313 | 3300025986 | Ga0207658_10203372 | Ga0207658_102033723 | 191 |
| 314 | 3300026142 | Ga0207698_11181344 | Ga0207698_111813441 | 191 |
| 315 | 3300026142 | Ga0207698_11523146 | Ga0207698_115231461 | 191 |
| 316 | 3300028379 | Ga0268266_10335151 | Ga0268266_103351511 | 191 |
| 317 | 3300035116 | Ga0373945_0235064 | Ga0373945_0235064_18_593 | 191 |
| 318 | 3300035695 | Ga0373927_0026209 | Ga0373927_0026209_2221_2796 | 191 |
| 319 | 3300037471 | Ga0395905_0358547 | Ga0395905_0358547_623_1198 | 191 |
| 320 | 3300044673 | Ga0453683_0046475 | Ga0453683_0046475_524_1099 | 191 |
| 321 | 3300044683 | Ga0466965_0181589 | Ga0466965_0181589_262_837 | 191 |
| 322 | 3300047443 | Ga0495687_000119 | Ga0495687_000119_54124_54699 | 191 |
| 323 | 3300050509 | nmdc:mga0qj67_193247_c1 | nmdc:mga0qj67_193247_c1_341_916 | 191 |
| 324 | 3300050510 | nmdc:mga06r32_193692_c1 | nmdc:mga06r32_193692_c1_1358_1933 | 191 |
| 325 | 3300053150 | Ga0500603_048239 | Ga0500603_048239_308_883 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8oks-assembly1.cif.gz_A | crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain | 0.7252 | 60 | 186 |
| 6tjv-assembly1.cif.gz_S | structure of the ndh-1ms complex from thermosynechococcus elongatus | 0.7004 | 143 | 175 |
| 8oks-assembly1.cif.gz_A | crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain | 0.6844 | 60 | 186 |
| 7r7l-assembly2.cif.gz_B | structure of human shp2 in complex with compound 30 | 0.6646 | 122 | 172 |
| 4k45-assembly1.cif.gz_A | auto-inhibition and phosphorylation-induced activation of plc-gamma isozymes | 0.6621 | 120 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xtcT03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7032 | 154 | 177 | 2.40.50.140 |
| af_Q9LRZ5_221_341_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.6955 | 136 | 172 | 2.30.29.30 |
| af_F1RDK4_103_219_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.6836 | 140 | 172 | 3.30.1520.10 |
| af_A0A0R0G6N2_34_284_2.60.120.200 | Mainly Beta;Sandwich;Jelly Rolls; | 0.679 | 155 | 171 | 2.60.120.200 |
| af_B6T927_131_200_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.6785 | 143 | 173 | 2.30.30.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1SAB8-F1-model_v4 | DUF4256 family protein | 0.9955 | 93 | 188 |
|
| AF-A0A6N7R535-F1-model_v4 | GNAT family N-acetyltransferase | 0.9944 | 7 | 188 |
GO:0016747
|
| AF-A0A550GI25-F1-model_v4 | DUF4256 domain-containing protein | 0.9942 | 59 | 188 |
|
| AF-A0A7X6SAK1-F1-model_v4 | DUF4256 domain-containing protein | 0.9936 | 50 | 188 |
|
| AF-U2CLL0-F1-model_v4 | DUF4256 domain-containing protein | 0.9934 | 6 | 188 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar