F407761

General Info

Members Datasets Scaffolds Average Seq Length
325 215 312 188

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100010731|Ga0075428_1000107317
Length 192
Sequence MKKAKSGATLSKAQRDELLGVLKARFEKNKNRHKGIEWAGVQAKLEANAEKLSSLQEMERTGGEPDVIGFDKKTGEYVFCDCSAESPKGRRSICYDRDGQEAREKEGIHPEGNAIDMAATMGIELLNEEQYRELQKLGNFDTKTSSWVVTPPEIRKLGGALFCDRRYDHVFVYHNGAQSFYSARAFRGLLRV

Samples

Sample ID Description Type Environment
1 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
2 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
3 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
4 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
5 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
6 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
7 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
8 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
9 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
10 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
11 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
12 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
13 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96
Metatranscriptomes 0
Isolates 4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.77
Nodule 0
Rhizoplane 0.31
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012469 3300001989 Bacteria 3121
2 JGI24751J29686_10001015 3300002459 Bacteria 6155
3 JGI25152J39213_1002536 3300002773 Bacteria 6881
4 JGI25150J39212_1000057 3300002774 Bacteria 66456
5 JGI25151J46595_10000229 3300003187 Bacteria 66456
6 JGI25153J46596_10000164 3300003215 Bacteria 66576
7 JGI25153J46596_10011436 3300003215 Bacteria 3922
8 JGI25153J46596_10020949 3300003215 Bacteria 2453
9 rootH2_10087534 3300003320 Bacteria 2667
10 rootH2_10311480 3300003320 Bacteria 1122
11 rootL2_10080850 3300003322 Bacteria 8439
12 rootH1_10077475 3300003323 Bacteria 6918
13 rootH1_10157402 3300003323 Bacteria 6105
14 JGI25160J50197_1000453 3300003354 Bacteria 25592
15 Ga0055526_1015529 3300003771 Bacteria 3052
16 Ga0055530_10000619 3300003791 Bacteria 30885
17 Ga0065165_1000182 3300005262 Bacteria 110108
18 Ga0065704_10130290 3300005289 Bacteria 1638
19 Ga0065712_10247132 3300005290 Bacteria 969
20 Ga0065712_10247744 3300005290 Bacteria 966
21 Ga0065715_10115169 3300005293 Bacteria 2401
22 Ga0065715_10175080 3300005293 Bacteria 1517
23 Ga0065715_10299863 3300005293 Bacteria 1043
24 Ga0070676_10052158 3300005328 Bacteria 2404
25 Ga0070670_100054490 3300005331 Bacteria 3433
26 Ga0070670_100067326 3300005331 Bacteria 3073
27 Ga0068869_100094532 3300005334 Bacteria 2254
28 Ga0068869_100125088 3300005334 Bacteria 1971
29 Ga0068869_100916007 3300005334 Bacteria 759
30 Ga0070666_10087116 3300005335 Bacteria 2140
31 Ga0070682_100479927 3300005337 Bacteria 959
32 Ga0068868_100008724 3300005338 Bacteria 7258
33 Ga0070660_101276186 3300005339 Bacteria 623
34 Ga0070689_100294611 3300005340 Bacteria 1349
35 Ga0070661_100229110 3300005344 Bacteria 1427
36 Ga0070668_100255825 3300005347 Bacteria 1455
37 Ga0070668_100313719 3300005347 Bacteria 1318
38 Ga0070669_100064279 3300005353 Bacteria 2702
39 Ga0070675_100351793 3300005354 Bacteria 1306
40 Ga0070671_100001514 3300005355 Bacteria 17420
41 Ga0070673_100037100 3300005364 Bacteria 3710
42 Ga0070673_100159506 3300005364 Bacteria 1917
43 Ga0070688_100520162 3300005365 Unclassified 900
44 Ga0070659_100294336 3300005366 Bacteria 1352
45 Ga0070667_100285428 3300005367 Bacteria 1483
46 Ga0070667_100694275 3300005367 Bacteria 941
47 Ga0070713_100415721 3300005436 Bacteria 1258
48 Ga0070700_100398553 3300005441 Archaea 1034
49 Ga0070708_100399291 3300005445 Bacteria 1296
50 Ga0070678_100145871 3300005456 Bacteria 1900
51 Ga0070662_100086235 3300005457 Bacteria 2348
52 Ga0068867_100015193 3300005459 Bacteria 5460
53 Ga0068867_100036341 3300005459 Bacteria 3575
54 Ga0068867_100109211 3300005459 Bacteria 2123
55 Ga0068867_100111318 3300005459 Bacteria 2104
56 Ga0070685_10060752 3300005466 Archaea 2211
57 Ga0070706_100024925 3300005467 Bacteria 5506
58 Ga0070706_100383167 3300005467 Bacteria 1309
59 Ga0070707_100278032 3300005468 Bacteria 1627
60 Ga0070698_100199962 3300005471 Bacteria 1934
61 Ga0070699_100218041 3300005518 Bacteria 1700
62 Ga0070699_100571828 3300005518 Bacteria 1029
63 Ga0070672_100000713 3300005543 Bacteria 19704
64 Ga0070672_100797042 3300005543 Bacteria 831
65 Ga0070686_100002589 3300005544 Bacteria 9979
66 Ga0070695_100296868 3300005545 Bacteria 1193
67 Ga0070696_100643793 3300005546 Bacteria 859
68 Ga0070664_100346377 3300005564 Bacteria 1351
69 Ga0068857_100891069 3300005577 Bacteria 853
70 Ga0068854_100150023 3300005578 Bacteria 1797
71 Ga0068854_100868293 3300005578 Bacteria 791
72 Ga0070702_100241175 3300005615 Bacteria 1220
73 Ga0068852_100135914 3300005616 Bacteria 2270
74 Ga0068852_101326863 3300005616 Bacteria 741
75 Ga0068852_101618528 3300005616 Bacteria 670
76 Ga0068859_100140571 3300005617 Bacteria 2488
77 Ga0068859_100367314 3300005617 Bacteria 1534
78 Ga0068859_100642224 3300005617 Bacteria 1153
79 Ga0068859_100774962 3300005617 Bacteria 1047
80 Ga0068859_101416820 3300005617 Bacteria 766
81 Ga0068864_100077889 3300005618 Bacteria 2900
82 Ga0068866_10018851 3300005718 Bacteria 3130
83 Ga0068861_100027092 3300005719 Bacteria 4171
84 Ga0068851_10000105 3300005834 Bacteria 45381
85 Ga0068863_100003469 3300005841 Bacteria 15551
86 Ga0068863_100164219 3300005841 Bacteria 2129
87 Ga0068863_100220125 3300005841 Bacteria 1829
88 Ga0068863_100429061 3300005841 Bacteria 1295
89 Ga0068863_100551019 3300005841 Bacteria 1139
90 Ga0068858_100174556 3300005842 Bacteria 2027
91 Ga0068858_100427167 3300005842 Bacteria 1275
92 Ga0068860_100207844 3300005843 Bacteria 1898
93 Ga0068860_100229627 3300005843 Bacteria 1803
94 Ga0068862_100280058 3300005844 Bacteria 1528
95 Ga0081539_10148603 3300005985 Bacteria 1130
96 Ga0075366_10250064 3300006195 Bacteria 1081
97 Ga0097621_100216666 3300006237 Bacteria 1667
98 Ga0068871_101109989 3300006358 Bacteria 740
99 Ga0075428_100010731 3300006844 Bacteria 10183
100 Ga0075431_100015208 3300006847 Bacteria 7798
101 Ga0075431_100100044 3300006847 Bacteria 2991
102 Ga0097620_100140583 3300006931 Bacteria 2488
103 Ga0097620_100367301 3300006931 Bacteria 1534
104 Ga0097620_100642183 3300006931 Bacteria 1153
105 Ga0097620_100774958 3300006931 Bacteria 1047
106 Ga0097620_101416794 3300006931 Bacteria 766
107 Ga0075435_100465223 3300007076 Bacteria 1091
108 Ga0105251_10293105 3300009011 Bacteria 737
109 Ga0105245_10425372 3300009098 Archaea 1332
110 Ga0105247_10000761 3300009101 Bacteria 24873
111 Ga0105247_10470299 3300009101 Bacteria 910
112 Ga0114129_10226907 3300009147 Bacteria 2517
113 Ga0114129_10263507 3300009147 Bacteria 2308
114 Ga0105243_10021347 3300009148 Bacteria 4914
115 Ga0105243_11213768 3300009148 Bacteria 768
116 Ga0105241_10055340 3300009174 Bacteria 3039
117 Ga0105241_10435657 3300009174 Bacteria 1157
118 Ga0105242_10777987 3300009176 Bacteria 945
119 Ga0105242_11473759 3300009176 Bacteria 710
120 Ga0105238_10001288 3300009551 Bacteria 25197
121 Ga0105249_10015629 3300009553 Bacteria 6720
122 Ga0105239_10953020 3300010375 Bacteria 986
123 Ga0105246_10055233 3300011119 Archaea 2740
124 Ga0105246_10692105 3300011119 Bacteria 892
125 Ga0157371_10126205 3300013102 Bacteria 1820
126 Ga0157371_10541679 3300013102 Unclassified 862
127 Ga0157378_10005662 3300013297 Bacteria 10935
128 Ga0157378_10017686 3300013297 Bacteria 6259
129 Ga0157378_10017871 3300013297 Bacteria 6223
130 Ga0157378_10039830 3300013297 Bacteria 4167
131 Ga0157378_10362666 3300013297 Bacteria 1418
132 Ga0157378_10484876 3300013297 Bacteria 1232
133 Ga0163162_10064457 3300013306 Bacteria 3709
134 Ga0163162_10174454 3300013306 Bacteria 2275
135 Ga0163162_11127243 3300013306 Bacteria 889
136 Ga0157372_10178504 3300013307 Bacteria 2458
137 Ga0157372_10674828 3300013307 Bacteria 1203
138 Ga0157372_10985360 3300013307 Bacteria 976
139 Ga0157375_10000014 3300013308 Bacteria 319231
140 Ga0157375_10100242 3300013308 Bacteria 2976
141 Ga0157375_10132097 3300013308 Bacteria 2617
142 Ga0157375_10356853 3300013308 Bacteria 1628
143 Ga0157375_10385622 3300013308 Bacteria 1568
144 Ga0157375_10435762 3300013308 Bacteria 1477
145 Ga0163163_10110099 3300014325 Bacteria 2782
146 Ga0163163_10417963 3300014325 Bacteria 1400
147 Ga0163163_10776432 3300014325 Unclassified 1021
148 Ga0157380_10014128 3300014326 Bacteria 5837
149 Ga0157380_10397579 3300014326 Archaea 1306
150 Ga0157380_10420449 3300014326 Bacteria 1275
151 Ga0157377_10021934 3300014745 Archaea 3366
152 Ga0157379_10569924 3300014968 Bacteria 1055
153 Ga0182007_10004268 3300015262 Bacteria 6520
154 Ga0163161_10112153 3300017792 Bacteria 2040
155 Ga0207425_1000007 3300025245 Bacteria 777411
156 Ga0209129_1000006 3300025258 Bacteria 777761
157 Ga0209673_1000016 3300025273 Bacteria 506202
158 Ga0209025_1000025 3300025294 Bacteria 524454
159 Ga0209564_1000328 3300025295 Bacteria 92405
160 Ga0209564_1043410 3300025295 Bacteria 1180
161 Ga0209758_1000016 3300025297 Bacteria 778557
162 Ga0209758_1002394 3300025297 Bacteria 19281
163 Ga0209758_1006613 3300025297 Bacteria 8214
164 Ga0209050_1000124 3300025298 Bacteria 194022
165 Ga0207426_1000925 3300025302 Bacteria 29342
166 Ga0207426_1067980 3300025302 Bacteria 1003
167 Ga0209051_1023842 3300025303 Bacteria 2534
168 Ga0209257_1001535 3300025304 Bacteria 26927
169 Ga0207656_10000170 3300025321 Bacteria 23964
170 Ga0207682_10302917 3300025893 Bacteria 749
171 Ga0207710_10007980 3300025900 Bacteria 4475
172 Ga0207710_10447309 3300025900 Unclassified 667
173 Ga0207680_10064174 3300025903 Bacteria 2251
174 Ga0207645_10013933 3300025907 Bacteria 5392
175 Ga0207643_10094383 3300025908 Bacteria 1748
176 Ga0207684_10032852 3300025910 Bacteria 4413
177 Ga0207684_10143262 3300025910 Bacteria 2055
178 Ga0207654_10055270 3300025911 Bacteria 2298
179 Ga0207695_10000181 3300025913 Bacteria 185042
180 Ga0207662_10062446 3300025918 Bacteria 2239
181 Ga0207662_10065398 3300025918 Bacteria 2190
182 Ga0207649_10250894 3300025920 Bacteria 1274
183 Ga0207646_10137696 3300025922 Bacteria 2198
184 Ga0207681_10340149 3300025923 Bacteria 1198
185 Ga0207694_10001419 3300025924 Bacteria 20527
186 Ga0207659_10224797 3300025926 Bacteria 1511
187 Ga0207644_10491556 3300025931 Bacteria 1011
188 Ga0207690_10331552 3300025932 Archaea 1199
189 Ga0207706_10020437 3300025933 Bacteria 5953
190 Ga0207709_10003848 3300025935 Bacteria 8792
191 Ga0207709_10031615 3300025935 Bacteria 3093
192 Ga0207670_10566949 3300025936 Bacteria 929
193 Ga0207704_10351141 3300025938 Bacteria 1148
194 Ga0207704_10790956 3300025938 Bacteria 791
195 Ga0207691_10001244 3300025940 Bacteria 25435
196 Ga0207691_10423155 3300025940 Bacteria 1135
197 Ga0207691_10696562 3300025940 Bacteria 857
198 Ga0207689_10033324 3300025942 Bacteria 4281
199 Ga0207689_10256421 3300025942 Bacteria 1447
200 Ga0207689_10870707 3300025942 Bacteria 760
201 Ga0207689_10956542 3300025942 Bacteria 723
202 Ga0207661_11283318 3300025944 Bacteria 673
203 Ga0207679_10940111 3300025945 Bacteria 791
204 Ga0207667_10000242 3300025949 Bacteria 76730
205 Ga0207651_10091695 3300025960 Bacteria 2226
206 Ga0207712_10142610 3300025961 Bacteria 1841
207 Ga0207712_10332741 3300025961 Bacteria 1257
208 Ga0207668_10193173 3300025972 Bacteria 1615
209 Ga0207668_10493431 3300025972 Bacteria 1052
210 Ga0207640_10310619 3300025981 Bacteria 1251
211 Ga0207658_10037842 3300025986 Bacteria 3471
212 Ga0207658_10203372 3300025986 Bacteria 1655
213 Ga0207658_10371026 3300025986 Bacteria 1251
214 Ga0207677_10077828 3300026023 Bacteria 2366
215 Ga0207708_10054305 3300026075 Archaea 3054
216 Ga0207708_10709114 3300026075 Bacteria 861
217 Ga0207702_10129529 3300026078 Bacteria 2269
218 Ga0207641_10000601 3300026088 Bacteria 39530
219 Ga0207641_10124297 3300026088 Bacteria 2307
220 Ga0207641_11413482 3300026088 Bacteria 697
221 Ga0207648_10001875 3300026089 Bacteria 22995
222 Ga0207648_10061273 3300026089 Bacteria 3281
223 Ga0207648_10172184 3300026089 Bacteria 1914
224 Ga0207648_10378847 3300026089 Archaea 1279
225 Ga0207676_10051427 3300026095 Bacteria 3217
226 Ga0207676_10087016 3300026095 Bacteria 2554
227 Ga0207674_10544905 3300026116 Bacteria 1121
228 Ga0207674_10795449 3300026116 Bacteria 913
229 Ga0207674_10858022 3300026116 Bacteria 876
230 Ga0207675_100132643 3300026118 Bacteria 2362
231 Ga0207675_100235438 3300026118 Bacteria 1768
232 Ga0207675_101453298 3300026118 Bacteria 706
233 Ga0207698_11181344 3300026142 Bacteria 779
234 Ga0207698_11523146 3300026142 Bacteria 684
235 Ga0268266_10335151 3300028379 Bacteria 1419
236 Ga0268265_10191191 3300028380 Bacteria 1768
237 Ga0268264_10032788 3300028381 Bacteria 4262
238 Ga0268264_10093042 3300028381 Bacteria 2603
239 Ga0265323_10001076 3300028653 Bacteria 14126
240 Ga0307509_10089826 3300031507 Bacteria 3149
241 Ga0307408_100002051 3300031548 Bacteria 14501
242 Ga0307408_100063162 3300031548 Bacteria 2708
243 Ga0307516_10010004 3300031730 Bacteria 10501
244 Ga0307516_10418432 3300031730 Bacteria 998
245 Ga0307405_10052493 3300031731 Bacteria 2535
246 Ga0307406_10082207 3300031901 Bacteria 2144
247 Ga0307406_10243308 3300031901 Bacteria 1351
248 Ga0307407_10088531 3300031903 Bacteria 1892
249 Ga0307412_10132917 3300031911 Bacteria 1810
250 Ga0307414_10889187 3300032004 Bacteria 816
251 Ga0307411_10000001 3300032005 Bacteria 931810
252 Ga0373951_0111681 3300035091 Bacteria 736
253 Ga0373932_0000151 3300035112 Bacteria 19930
254 Ga0373945_0235064 3300035116 Bacteria 770
255 Ga0373935_0685708 3300035692 Bacteria 753
256 Ga0373927_0026209 3300035695 Bacteria 3810
257 Ga0373937_0882534 3300036401 Bacteria 843
258 Ga0395900_0281112 3300037418 Bacteria 1656
259 Ga0395900_0426110 3300037418 Bacteria 1287
260 Ga0395905_0058961 3300037471 Bacteria 3589
261 Ga0395905_0358547 3300037471 Bacteria 1351
262 Ga0451800_0490252 3300041459 Bacteria 701
263 Ga0450923_011579 3300042125 Bacteria 1588
264 Ga0439458_0075696 3300042157 Bacteria 854
265 Ga0451577_0156611 3300042876 Bacteria 2050
266 Ga0451577_0378054 3300042876 Bacteria 1285
267 Ga0466972_0000030 3300044658 Bacteria 161580
268 Ga0453683_0041067 3300044673 Bacteria 2904
269 Ga0453683_0046475 3300044673 Bacteria 2722
270 Ga0453683_0163611 3300044673 Bacteria 1408
271 Ga0466965_0181589 3300044683 Bacteria 1110
272 Ga0453684_0000388 3300044712 Bacteria 180685
273 Ga0453684_0000538 3300044712 Bacteria 143872
274 Ga0453684_0005319 3300044712 Bacteria 25648
275 Ga0453684_0648343 3300044712 Unclassified 1152
276 Ga0451576_0000604 3300045051 Bacteria 75646
277 Ga0451576_0234982 3300045051 Bacteria 1914
278 Ga0451576_0236711 3300045051 Bacteria 1907
279 Ga0451576_0368262 3300045051 Bacteria 1505
280 Ga0451576_0507132 3300045051 Unclassified 1267
281 Ga0495582_0194754 3300046473 Bacteria 1157
282 Ga0495648_0008648 3300046524 Bacteria 7982
283 Ga0495652_0180801 3300046529 Bacteria 1619
284 Ga0495635_0020844 3300046663 Bacteria 4566
285 Ga0495599_0068957 3300046678 Bacteria 2208
286 Ga0495687_000119 3300047443 Bacteria 121587
287 Ga0495675_0170285 3300047444 Bacteria 1338
288 Ga0501034_0027449 3300049571 Bacteria 5791
289 Ga0501038_0161267 3300049574 Bacteria 1822
290 Ga0501071_0102753 3300049587 Bacteria 2108
291 Ga0501249_002810 3300049679 Bacteria 3504
292 Ga0501257_057988 3300049686 Unclassified 975
293 Ga0501264_000026 3300049761 Bacteria 22924
294 Ga0501266_000048 3300049763 Bacteria 20803
295 Ga0501044_0367095 3300049823 Bacteria 1357
296 nmdc:mga0k408_138088_c1 3300050493 Bacteria 1449
297 nmdc:mga0k408_216873_c1 3300050493 Bacteria 1142
298 nmdc:mga0qj67_193247_c1 3300050509 Bacteria 1654
299 nmdc:mga06r32_193692_c1 3300050510 Bacteria 2020
300 nmdc:mga06r32_2273_c1 3300050510 Bacteria 17178
301 nmdc:mga0rr50_535664_c1 3300050513 Bacteria 997
302 Ga0495601_0109456 3300053077 Bacteria 1788
303 Ga0500644_0000211 3300053088 Bacteria 34996
304 Ga0500642_0050106 3300053130 Bacteria 1839
305 Ga0500652_161854 3300053131 Bacteria 924
306 Ga0500658_0000003 3300053134 Bacteria 512506
307 Ga0500603_048239 3300053150 Bacteria 1158
308 Ga0500622_0006216 3300053156 Bacteria 6988
309 Ga0500633_0000660 3300053160 Bacteria 5761
310 Ga0500634_0111459 3300053161 Bacteria 1349
311 Ga0590071_003777 3300059421 Bacteria 3715
312 Ga0590075_009804 3300059424 Bacteria 2299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10889187 Ga0307414_108891871 173
2 3300025918 Ga0207662_10062446 Ga0207662_100624464 178
3 3300025940 Ga0207691_10696562 Ga0207691_106965621 179
4 3300003323 rootH1_10077475 rootH1_100774756 181
5 3300005367 Ga0070667_100694275 Ga0070667_1006942752 181
6 3300005456 Ga0070678_100145871 Ga0070678_1001458711 181
7 3300005543 Ga0070672_100797042 Ga0070672_1007970421 181
8 3300005844 Ga0068862_100280058 Ga0068862_1002800581 181
9 3300013297 Ga0157378_10005662 Ga0157378_100056625 181
10 3300013297 Ga0157378_10484876 Ga0157378_104848761 181
11 3300013306 Ga0163162_10174454 Ga0163162_101744543 181
12 3300013308 Ga0157375_10000014 Ga0157375_10000014190 181
13 3300014325 Ga0163163_10417963 Ga0163163_104179631 181
14 3300025918 Ga0207662_10065398 Ga0207662_100653984 181
15 3300025938 Ga0207704_10790956 Ga0207704_107909562 181
16 3300031548 Ga0307408_100002051 Ga0307408_1000020514 181
17 3300031730 Ga0307516_10010004 Ga0307516_100100045 181
18 3300031901 Ga0307406_10082207 Ga0307406_100822073 181
19 3300035091 Ga0373951_0111681 Ga0373951_0111681_48_593 181
20 3300049587 Ga0501071_0102753 Ga0501071_0102753_511_1056 181
21 3300059421 Ga0590071_003777 Ga0590071_003777_379_924 181
22 3300059424 Ga0590075_009804 Ga0590075_009804_1128_1673 181
23 iso_pu_bacteria 2857618242 2857618717 181
24 iso_pu_bacteria 2889295896 2889300383 181
25 iso_pu_bacteria 2977254563 2977255540 181
26 iso_pu_bacteria 2981284811 2981287703 181
27 iso_pu_bacteria 2981289755 2981292897 181
28 iso_pu_bacteria 2981980479 2981982889 181
29 iso_pu_bacteria 2981985349 2981987799 181
30 iso_pu_bacteria 2788500588 2791213333 182
31 iso_pu_bacteria 2818991451 2819625631 182
32 iso_pu_bacteria 2904606771 2904608677 182
33 3300025302 Ga0207426_1067980 Ga0207426_10679801 183
34 3300005617 Ga0068859_101416820 Ga0068859_1014168201 184
35 3300005985 Ga0081539_10148603 Ga0081539_101486032 184
36 3300006195 Ga0075366_10250064 Ga0075366_102500642 184
37 3300006931 Ga0097620_101416794 Ga0097620_1014167941 184
38 3300031507 Ga0307509_10089826 Ga0307509_100898265 184
39 3300050493 nmdc:mga0k408_138088_c1 nmdc:mga0k408_138088_c1_745_1362 184
40 iso_pu_bacteria 2896109856 2896111170 184
41 iso_pu_bacteria 2928510474 2928515020 184
42 iso_pu_bacteria 3006988479 3006992628 184
43 3300005290 Ga0065712_10247132 Ga0065712_102471321 185
44 3300005293 Ga0065715_10115169 Ga0065715_101151691 185
45 3300005545 Ga0070695_100296868 Ga0070695_1002968681 185
46 3300005578 Ga0068854_100150023 Ga0068854_1001500232 185
47 3300005616 Ga0068852_101326863 Ga0068852_1013268632 185
48 3300005617 Ga0068859_100367314 Ga0068859_1003673142 185
49 3300005841 Ga0068863_100164219 Ga0068863_1001642192 185
50 3300005841 Ga0068863_100220125 Ga0068863_1002201253 185
51 3300005842 Ga0068858_100427167 Ga0068858_1004271672 185
52 3300005843 Ga0068860_100229627 Ga0068860_1002296272 185
53 3300006931 Ga0097620_100367301 Ga0097620_1003673012 185
54 3300009098 Ga0105245_10425372 Ga0105245_104253721 185
55 3300009101 Ga0105247_10000761 Ga0105247_100007615 185
56 3300009101 Ga0105247_10470299 Ga0105247_104702991 185
57 3300009174 Ga0105241_10055340 Ga0105241_100553401 185
58 3300009176 Ga0105242_10777987 Ga0105242_107779872 185
59 3300009176 Ga0105242_11473759 Ga0105242_114737591 185
60 3300009551 Ga0105238_10001288 Ga0105238_1000128812 185
61 3300010375 Ga0105239_10953020 Ga0105239_109530202 185
62 3300013308 Ga0157375_10385622 Ga0157375_103856222 185
63 3300014326 Ga0157380_10420449 Ga0157380_104204491 185
64 3300014968 Ga0157379_10569924 Ga0157379_105699242 185
65 3300025900 Ga0207710_10007980 Ga0207710_100079805 185
66 3300025911 Ga0207654_10055270 Ga0207654_100552703 185
67 3300025924 Ga0207694_10001419 Ga0207694_1000141917 185
68 3300025935 Ga0207709_10031615 Ga0207709_100316153 185
69 3300026078 Ga0207702_10129529 Ga0207702_101295291 185
70 3300028381 Ga0268264_10093042 Ga0268264_100930422 185
71 3300031730 Ga0307516_10418432 Ga0307516_104184321 185
72 3300032005 Ga0307411_10000001 Ga0307411_10000001388 185
73 3300035112 Ga0373932_0000151 Ga0373932_0000151_5318_5875 185
74 3300035692 Ga0373935_0685708 Ga0373935_0685708_38_595 185
75 3300045051 Ga0451576_0236711 Ga0451576_0236711_173_730 185
76 3300049679 Ga0501249_002810 Ga0501249_002810_1098_1655 185
77 3300049763 Ga0501266_000048 Ga0501266_000048_19451_20008 185
78 3300053134 Ga0500658_0000003 Ga0500658_0000003_229403_229960 185
79 3300005347 Ga0070668_100313719 Ga0070668_1003137192 186
80 3300005441 Ga0070700_100398553 Ga0070700_1003985532 186
81 3300005466 Ga0070685_10060752 Ga0070685_100607523 186
82 3300005543 Ga0070672_100000713 Ga0070672_10000071314 186
83 3300005615 Ga0070702_100241175 Ga0070702_1002411752 186
84 3300005617 Ga0068859_100642224 Ga0068859_1006422241 186
85 3300005719 Ga0068861_100027092 Ga0068861_1000270925 186
86 3300005841 Ga0068863_100003469 Ga0068863_10000346912 186
87 3300006931 Ga0097620_100642183 Ga0097620_1006421831 186
88 3300007076 Ga0075435_100465223 Ga0075435_1004652232 186
89 3300011119 Ga0105246_10055233 Ga0105246_100552333 186
90 3300013297 Ga0157378_10017871 Ga0157378_100178716 186
91 3300013308 Ga0157375_10435762 Ga0157375_104357623 186
92 3300014326 Ga0157380_10397579 Ga0157380_103975791 186
93 3300014745 Ga0157377_10021934 Ga0157377_100219341 186
94 3300025908 Ga0207643_10094383 Ga0207643_100943833 186
95 3300025932 Ga0207690_10331552 Ga0207690_103315521 186
96 3300025940 Ga0207691_10001244 Ga0207691_1000124417 186
97 3300025972 Ga0207668_10493431 Ga0207668_104934312 186
98 3300026075 Ga0207708_10054305 Ga0207708_100543051 186
99 3300026075 Ga0207708_10709114 Ga0207708_107091141 186
100 3300026088 Ga0207641_10000601 Ga0207641_1000060129 186
101 3300026089 Ga0207648_10378847 Ga0207648_103788471 186
102 3300028380 Ga0268265_10191191 Ga0268265_101911913 186
103 3300041459 Ga0451800_0490252 Ga0451800_0490252_61_621 186
104 3300044712 Ga0453684_0648343 Ga0453684_0648343_252_812 186
105 3300046473 Ga0495582_0194754 Ga0495582_0194754_543_1103 186
106 3300046524 Ga0495648_0008648 Ga0495648_0008648_5980_6540 186
107 3300049686 Ga0501257_057988 Ga0501257_057988_69_629 186
108 3300050513 nmdc:mga0rr50_535664_c1 nmdc:mga0rr50_535664_c1_137_697 186
109 3300053130 Ga0500642_0050106 Ga0500642_0050106_491_1051 186
110 3300053156 Ga0500622_0006216 Ga0500622_0006216_1981_2541 186
111 3300003322 rootL2_10080850 rootL2_100808503 187
112 3300005293 Ga0065715_10175080 Ga0065715_101750801 187
113 3300005328 Ga0070676_10052158 Ga0070676_100521581 187
114 3300005334 Ga0068869_100094532 Ga0068869_1000945322 187
115 3300005338 Ga0068868_100008724 Ga0068868_10000872410 187
116 3300005339 Ga0070660_101276186 Ga0070660_1012761861 187
117 3300005340 Ga0070689_100294611 Ga0070689_1002946111 187
118 3300005344 Ga0070661_100229110 Ga0070661_1002291102 187
119 3300005353 Ga0070669_100064279 Ga0070669_1000642794 187
120 3300005355 Ga0070671_100001514 Ga0070671_10000151410 187
121 3300005364 Ga0070673_100037100 Ga0070673_1000371005 187
122 3300005366 Ga0070659_100294336 Ga0070659_1002943362 187
123 3300005457 Ga0070662_100086235 Ga0070662_1000862352 187
124 3300005459 Ga0068867_100015193 Ga0068867_1000151936 187
125 3300005564 Ga0070664_100346377 Ga0070664_1003463772 187
126 3300005616 Ga0068852_100135914 Ga0068852_1001359141 187
127 3300005617 Ga0068859_100140571 Ga0068859_1001405712 187
128 3300006847 Ga0075431_100015208 Ga0075431_1000152081 187
129 3300006931 Ga0097620_100140583 Ga0097620_1001405832 187
130 3300013102 Ga0157371_10126205 Ga0157371_101262052 187
131 3300013306 Ga0163162_10064457 Ga0163162_100644572 187
132 3300013306 Ga0163162_11127243 Ga0163162_111272432 187
133 3300014325 Ga0163163_10776432 Ga0163163_107764322 187
134 3300017792 Ga0163161_10112153 Ga0163161_101121532 187
135 3300025893 Ga0207682_10302917 Ga0207682_103029171 187
136 3300025907 Ga0207645_10013933 Ga0207645_100139336 187
137 3300025920 Ga0207649_10250894 Ga0207649_102508941 187
138 3300025931 Ga0207644_10491556 Ga0207644_104915561 187
139 3300025933 Ga0207706_10020437 Ga0207706_100204376 187
140 3300025936 Ga0207670_10566949 Ga0207670_105669492 187
141 3300025938 Ga0207704_10351141 Ga0207704_103511411 187
142 3300025942 Ga0207689_10033324 Ga0207689_100333246 187
143 3300025942 Ga0207689_10870707 Ga0207689_108707071 187
144 3300025944 Ga0207661_11283318 Ga0207661_112833181 187
145 3300025945 Ga0207679_10940111 Ga0207679_109401111 187
146 3300025960 Ga0207651_10091695 Ga0207651_100916952 187
147 3300025981 Ga0207640_10310619 Ga0207640_103106192 187
148 3300026023 Ga0207677_10077828 Ga0207677_100778281 187
149 3300026088 Ga0207641_10124297 Ga0207641_101242973 187
150 3300026089 Ga0207648_10172184 Ga0207648_101721843 187
151 3300026116 Ga0207674_10544905 Ga0207674_105449051 187
152 3300026118 Ga0207675_100132643 Ga0207675_1001326431 187
153 3300031731 Ga0307405_10052493 Ga0307405_100524933 187
154 3300031901 Ga0307406_10243308 Ga0307406_102433082 187
155 3300031911 Ga0307412_10132917 Ga0307412_101329172 187
156 3300036401 Ga0373937_0882534 Ga0373937_0882534_56_619 187
157 3300037418 Ga0395900_0426110 Ga0395900_0426110_599_1162 187
158 3300042125 Ga0450923_011579 Ga0450923_011579_258_821 187
159 3300042157 Ga0439458_0075696 Ga0439458_0075696_128_691 187
160 3300042876 Ga0451577_0378054 Ga0451577_0378054_169_732 187
161 3300045051 Ga0451576_0234982 Ga0451576_0234982_819_1382 187
162 3300046529 Ga0495652_0180801 Ga0495652_0180801_521_1084 187
163 3300046678 Ga0495599_0068957 Ga0495599_0068957_434_997 187
164 3300047444 Ga0495675_0170285 Ga0495675_0170285_419_982 187
165 3300050510 nmdc:mga06r32_2273_c1 nmdc:mga06r32_2273_c1_37_600 187
166 3300053131 Ga0500652_161854 Ga0500652_161854_103_672 187
167 3300002459 JGI24751J29686_10001015 JGI24751J29686_100010155 188
168 3300002773 JGI25152J39213_1002536 JGI25152J39213_10025363 188
169 3300002774 JGI25150J39212_1000057 JGI25150J39212_100005741 188
170 3300003187 JGI25151J46595_10000229 JGI25151J46595_1000022941 188
171 3300003215 JGI25153J46596_10000164 JGI25153J46596_100001644 188
172 3300005331 Ga0070670_100054490 Ga0070670_1000544905 188
173 3300005334 Ga0068869_100916007 Ga0068869_1009160072 188
174 3300005335 Ga0070666_10087116 Ga0070666_100871162 188
175 3300005337 Ga0070682_100479927 Ga0070682_1004799272 188
176 3300005347 Ga0070668_100255825 Ga0070668_1002558252 188
177 3300005367 Ga0070667_100285428 Ga0070667_1002854282 188
178 3300005459 Ga0068867_100036341 Ga0068867_1000363412 188
179 3300005459 Ga0068867_100109211 Ga0068867_1001092113 188
180 3300005518 Ga0070699_100218041 Ga0070699_1002180413 188
181 3300005544 Ga0070686_100002589 Ga0070686_1000025898 188
182 3300005546 Ga0070696_100643793 Ga0070696_1006437932 188
183 3300005577 Ga0068857_100891069 Ga0068857_1008910691 188
184 3300005578 Ga0068854_100868293 Ga0068854_1008682932 188
185 3300005616 Ga0068852_101618528 Ga0068852_1016185281 188
186 3300005618 Ga0068864_100077889 Ga0068864_1000778892 188
187 3300005718 Ga0068866_10018851 Ga0068866_100188512 188
188 3300006844 Ga0075428_100010731 Ga0075428_1000107317 188
189 3300009011 Ga0105251_10293105 Ga0105251_102931052 188
190 3300009148 Ga0105243_10021347 Ga0105243_100213473 188
191 3300009174 Ga0105241_10435657 Ga0105241_104356572 188
192 3300009553 Ga0105249_10015629 Ga0105249_100156296 188
193 3300011119 Ga0105246_10692105 Ga0105246_106921051 188
194 3300013102 Ga0157371_10541679 Ga0157371_105416792 188
195 3300013297 Ga0157378_10017686 Ga0157378_100176864 188
196 3300013297 Ga0157378_10039830 Ga0157378_100398303 188
197 3300013297 Ga0157378_10362666 Ga0157378_103626662 188
198 3300013307 Ga0157372_10178504 Ga0157372_101785042 188
199 3300013307 Ga0157372_10674828 Ga0157372_106748281 188
200 3300013308 Ga0157375_10356853 Ga0157375_103568532 188
201 3300014325 Ga0163163_10110099 Ga0163163_101100993 188
202 3300014326 Ga0157380_10014128 Ga0157380_100141284 188
203 3300025245 Ga0207425_1000007 Ga0207425_1000007174 188
204 3300025258 Ga0209129_1000006 Ga0209129_1000006174 188
205 3300025294 Ga0209025_1000025 Ga0209025_10000254 188
206 3300025297 Ga0209758_1000016 Ga0209758_1000016174 188
207 3300025903 Ga0207680_10064174 Ga0207680_100641743 188
208 3300025935 Ga0207709_10003848 Ga0207709_100038487 188
209 3300025940 Ga0207691_10423155 Ga0207691_104231552 188
210 3300025961 Ga0207712_10142610 Ga0207712_101426101 188
211 3300025972 Ga0207668_10193173 Ga0207668_101931732 188
212 3300025986 Ga0207658_10371026 Ga0207658_103710262 188
213 3300026089 Ga0207648_10001875 Ga0207648_1000187512 188
214 3300026089 Ga0207648_10061273 Ga0207648_100612733 188
215 3300026095 Ga0207676_10051427 Ga0207676_100514274 188
216 3300026095 Ga0207676_10087016 Ga0207676_100870164 188
217 3300026116 Ga0207674_10795449 Ga0207674_107954491 188
218 3300026116 Ga0207674_10858022 Ga0207674_108580222 188
219 3300026118 Ga0207675_100235438 Ga0207675_1002354382 188
220 3300026118 Ga0207675_101453298 Ga0207675_1014532981 188
221 3300028381 Ga0268264_10032788 Ga0268264_100327882 188
222 3300028653 Ga0265323_10001076 Ga0265323_100010768 188
223 3300031548 Ga0307408_100063162 Ga0307408_1000631623 188
224 3300031903 Ga0307407_10088531 Ga0307407_100885313 188
225 3300037418 Ga0395900_0281112 Ga0395900_0281112_212_778 188
226 3300037471 Ga0395905_0058961 Ga0395905_0058961_1337_1903 188
227 3300044673 Ga0453683_0041067 Ga0453683_0041067_184_756 188
228 3300044712 Ga0453684_0000388 Ga0453684_0000388_2581_3153 188
229 3300045051 Ga0451576_0000604 Ga0451576_0000604_47095_47661 188
230 3300045051 Ga0451576_0368262 Ga0451576_0368262_240_812 188
231 3300045051 Ga0451576_0507132 Ga0451576_0507132_499_1068 188
232 3300046663 Ga0495635_0020844 Ga0495635_0020844_3790_4356 188
233 3300049571 Ga0501034_0027449 Ga0501034_0027449_4265_4834 188
234 3300049574 Ga0501038_0161267 Ga0501038_0161267_903_1490 188
235 3300049761 Ga0501264_000026 Ga0501264_000026_22347_22913 188
236 3300049823 Ga0501044_0367095 Ga0501044_0367095_478_1065 188
237 3300050493 nmdc:mga0k408_216873_c1 nmdc:mga0k408_216873_c1_261_827 188
238 3300053077 Ga0495601_0109456 Ga0495601_0109456_1022_1588 188
239 3300053088 Ga0500644_0000211 Ga0500644_0000211_7573_8139 188
240 3300053160 Ga0500633_0000660 Ga0500633_0000660_1159_1725 188
241 3300053161 Ga0500634_0111459 Ga0500634_0111459_112_678 188
242 3300005334 Ga0068869_100125088 Ga0068869_1001250883 189
243 3300005364 Ga0070673_100159506 Ga0070673_1001595062 189
244 3300005365 Ga0070688_100520162 Ga0070688_1005201622 189
245 3300005436 Ga0070713_100415721 Ga0070713_1004157212 189
246 3300005459 Ga0068867_100111318 Ga0068867_1001113182 189
247 3300005617 Ga0068859_100774962 Ga0068859_1007749622 189
248 3300005841 Ga0068863_100429061 Ga0068863_1004290611 189
249 3300005841 Ga0068863_100551019 Ga0068863_1005510192 189
250 3300005842 Ga0068858_100174556 Ga0068858_1001745562 189
251 3300005843 Ga0068860_100207844 Ga0068860_1002078443 189
252 3300006237 Ga0097621_100216666 Ga0097621_1002166662 189
253 3300006931 Ga0097620_100774958 Ga0097620_1007749582 189
254 3300013308 Ga0157375_10132097 Ga0157375_101320973 189
255 3300025986 Ga0207658_10037842 Ga0207658_100378423 189
256 3300026088 Ga0207641_11413482 Ga0207641_114134821 189
257 3300042876 Ga0451577_0156611 Ga0451577_0156611_709_1281 189
258 3300044658 Ga0466972_0000030 Ga0466972_0000030_13926_14591 189
259 3300044673 Ga0453683_0163611 Ga0453683_0163611_685_1254 189
260 3300044712 Ga0453684_0000538 Ga0453684_0000538_117474_118046 189
261 3300044712 Ga0453684_0005319 Ga0453684_0005319_347_916 189
262 3300005467 Ga0070706_100024925 Ga0070706_1000249253 190
263 3300013307 Ga0157372_10985360 Ga0157372_109853602 190
264 3300025910 Ga0207684_10032852 Ga0207684_100328524 190
265 3300025913 Ga0207695_10000181 Ga0207695_10000181149 190
266 3300001989 JGI24739J22299_10012469 JGI24739J22299_100124695 191
267 3300003215 JGI25153J46596_10011436 JGI25153J46596_100114364 191
268 3300003215 JGI25153J46596_10020949 JGI25153J46596_100209494 191
269 3300003320 rootH2_10087534 rootH2_100875344 191
270 3300003320 rootH2_10311480 rootH2_103114802 191
271 3300003323 rootH1_10157402 rootH1_101574023 191
272 3300003354 JGI25160J50197_1000453 JGI25160J50197_100045317 191
273 3300003771 Ga0055526_1015529 Ga0055526_10155294 191
274 3300003791 Ga0055530_10000619 Ga0055530_100006198 191
275 3300005262 Ga0065165_1000182 Ga0065165_100018245 191
276 3300005289 Ga0065704_10130290 Ga0065704_101302903 191
277 3300005290 Ga0065712_10247744 Ga0065712_102477441 191
278 3300005293 Ga0065715_10299863 Ga0065715_102998632 191
279 3300005331 Ga0070670_100067326 Ga0070670_1000673264 191
280 3300005354 Ga0070675_100351793 Ga0070675_1003517932 191
281 3300005445 Ga0070708_100399291 Ga0070708_1003992912 191
282 3300005467 Ga0070706_100383167 Ga0070706_1003831672 191
283 3300005468 Ga0070707_100278032 Ga0070707_1002780323 191
284 3300005471 Ga0070698_100199962 Ga0070698_1001999621 191
285 3300005518 Ga0070699_100571828 Ga0070699_1005718282 191
286 3300005834 Ga0068851_10000105 Ga0068851_1000010515 191
287 3300006358 Ga0068871_101109989 Ga0068871_1011099891 191
288 3300006847 Ga0075431_100100044 Ga0075431_1001000444 191
289 3300009147 Ga0114129_10226907 Ga0114129_102269073 191
290 3300009147 Ga0114129_10263507 Ga0114129_102635072 191
291 3300009148 Ga0105243_11213768 Ga0105243_112137682 191
292 3300013308 Ga0157375_10100242 Ga0157375_101002423 191
293 3300015262 Ga0182007_10004268 Ga0182007_100042686 191
294 3300025273 Ga0209673_1000016 Ga0209673_100001614 191
295 3300025295 Ga0209564_1000328 Ga0209564_100032868 191
296 3300025295 Ga0209564_1043410 Ga0209564_10434103 191
297 3300025297 Ga0209758_1002394 Ga0209758_100239410 191
298 3300025297 Ga0209758_1006613 Ga0209758_10066137 191
299 3300025298 Ga0209050_1000124 Ga0209050_1000124164 191
300 3300025302 Ga0207426_1000925 Ga0207426_100092515 191
301 3300025303 Ga0209051_1023842 Ga0209051_10238422 191
302 3300025304 Ga0209257_1001535 Ga0209257_100153517 191
303 3300025321 Ga0207656_10000170 Ga0207656_100001706 191
304 3300025900 Ga0207710_10447309 Ga0207710_104473091 191
305 3300025910 Ga0207684_10143262 Ga0207684_101432622 191
306 3300025922 Ga0207646_10137696 Ga0207646_101376963 191
307 3300025923 Ga0207681_10340149 Ga0207681_103401493 191
308 3300025926 Ga0207659_10224797 Ga0207659_102247973 191
309 3300025942 Ga0207689_10256421 Ga0207689_102564211 191
310 3300025942 Ga0207689_10956542 Ga0207689_109565421 191
311 3300025949 Ga0207667_10000242 Ga0207667_1000024241 191
312 3300025961 Ga0207712_10332741 Ga0207712_103327411 191
313 3300025986 Ga0207658_10203372 Ga0207658_102033723 191
314 3300026142 Ga0207698_11181344 Ga0207698_111813441 191
315 3300026142 Ga0207698_11523146 Ga0207698_115231461 191
316 3300028379 Ga0268266_10335151 Ga0268266_103351511 191
317 3300035116 Ga0373945_0235064 Ga0373945_0235064_18_593 191
318 3300035695 Ga0373927_0026209 Ga0373927_0026209_2221_2796 191
319 3300037471 Ga0395905_0358547 Ga0395905_0358547_623_1198 191
320 3300044673 Ga0453683_0046475 Ga0453683_0046475_524_1099 191
321 3300044683 Ga0466965_0181589 Ga0466965_0181589_262_837 191
322 3300047443 Ga0495687_000119 Ga0495687_000119_54124_54699 191
323 3300050509 nmdc:mga0qj67_193247_c1 nmdc:mga0qj67_193247_c1_341_916 191
324 3300050510 nmdc:mga06r32_193692_c1 nmdc:mga06r32_193692_c1_1358_1933 191
325 3300053150 Ga0500603_048239 Ga0500603_048239_308_883 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14066

DUF4256

Protein of unknown function (DUF4256)

18

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.7252 60 186
6tjv-assembly1.cif.gz_S structure of the ndh-1ms complex from thermosynechococcus elongatus 0.7004 143 175
8oks-assembly1.cif.gz_A crystal structure of bdellovibrio bacteriovorus bd2740 c-terminal domain 0.6844 60 186
7r7l-assembly2.cif.gz_B structure of human shp2 in complex with compound 30 0.6646 122 172
4k45-assembly1.cif.gz_A auto-inhibition and phosphorylation-induced activation of plc-gamma isozymes 0.6621 120 172
ID Description Score Start End Superfamily
4xtcT03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7032 154 177 2.40.50.140
af_Q9LRZ5_221_341_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6955 136 172 2.30.29.30
af_F1RDK4_103_219_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6836 140 172 3.30.1520.10
af_A0A0R0G6N2_34_284_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.679 155 171 2.60.120.200
af_B6T927_131_200_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.6785 143 173 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A4V1SAB8-F1-model_v4 DUF4256 family protein 0.9955 93 188
AF-A0A6N7R535-F1-model_v4 GNAT family N-acetyltransferase 0.9944 7 188 GO:0016747
AF-A0A550GI25-F1-model_v4 DUF4256 domain-containing protein 0.9942 59 188
AF-A0A7X6SAK1-F1-model_v4 DUF4256 domain-containing protein 0.9936 50 188
AF-U2CLL0-F1-model_v4 DUF4256 domain-containing protein 0.9934 6 188 GO:0016020

Feature Viewer

pLDDT pTM Quality
93.64 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map