F407756

General Info

Members Datasets Scaffolds Average Seq Length
325 195 650 369

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100050857|Ga0070716_1000508573
Length 334
Sequence VNEDKATRYHRLKRRASVLRTAAERLGAGASPALHPFLVVLIYVVFLTVLNEAVGVPLAFYSGYFLEHRYDLSKQTIGGWLADQAKSFGVGILLGAGAAELVYALIRAYPAQWWIPTNLAPVVLLPLFYPVKPLDRDALRARLLALADRAGARVLGAYEWGLGAKTKKANAALAGLGSTRRILVSDTMLAEYSDEEIEVVLAHELAHHVHGDIWKGIVFESALVLAGFYAAAVGRAGVRGVDDPAGLPLLLLAAGAVSLVAVPAGHAISRAFERRADRFALDLTGNPAAFISAMRRLGAQNLAEEHPSRVVQWLFYSHPPMRDRIASAQSRIRN

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
115 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
116 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.92
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100050857 3300006173 Bacteria 2354
2 Ga0070676_10002985 3300005328 Bacteria 8746
3 Ga0070676_10145239 3300005328 Bacteria 1514
4 Ga0070683_100251157 3300005329 Unclassified 1682
5 Ga0070683_100326447 3300005329 Bacteria 1461
6 Ga0068869_100143229 3300005334 Bacteria 1848
7 Ga0070666_10031176 3300005335 Bacteria 3518
8 Ga0070680_100099012 3300005336 Bacteria 2419
9 Ga0070660_100043747 3300005339 Bacteria 3423
10 Ga0070668_100060231 3300005347 Bacteria 2939
11 Ga0070668_100140474 3300005347 Bacteria 1946
12 Ga0070669_100021119 3300005353 Bacteria 4653
13 Ga0070669_100115767 3300005353 Unclassified 2040
14 Ga0070675_100002124 3300005354 Bacteria 14642
15 Ga0070674_100016007 3300005356 Bacteria 4695
16 Ga0070673_100045436 3300005364 Bacteria 3406
17 Ga0070673_100123733 3300005364 Bacteria 2162
18 Ga0070659_100046078 3300005366 Unclassified 3418
19 Ga0070667_100020615 3300005367 Bacteria 5472
20 Ga0070709_10007801 3300005434 Bacteria 5877
21 Ga0070709_10199648 3300005434 Bacteria 1416
22 Ga0070701_10009446 3300005438 Bacteria 4272
23 Ga0070701_10032627 3300005438 Bacteria 2595
24 Ga0070705_100020629 3300005440 Bacteria 3492
25 Ga0070700_100000765 3300005441 Bacteria 15886
26 Ga0070694_100021677 3300005444 Bacteria 4110
27 Ga0070694_100258353 3300005444 Bacteria 1320
28 Ga0070708_100016501 3300005445 Bacteria 6130
29 Ga0070708_100153018 3300005445 Unclassified 2146
30 Ga0070662_100301085 3300005457 Bacteria 1303
31 Ga0070681_10043292 3300005458 Bacteria 4510
32 Ga0068867_100021796 3300005459 Bacteria 4575
33 Ga0070706_100351001 3300005467 Bacteria 1375
34 Ga0070707_100045906 3300005468 Bacteria 4181
35 Ga0070698_100064757 3300005471 Bacteria 3682
36 Ga0070698_100068092 3300005471 Bacteria 3579
37 Ga0070698_100338469 3300005471 Unclassified 1436
38 Ga0070699_100009771 3300005518 Bacteria 8300
39 Ga0070699_100027387 3300005518 Bacteria 4916
40 Ga0070699_100089608 3300005518 Bacteria 2688
41 Ga0070679_100108283 3300005530 Bacteria 2765
42 Ga0070697_100060444 3300005536 Bacteria 3088
43 Ga0070686_100095994 3300005544 Bacteria 1993
44 Ga0070695_100005208 3300005545 Bacteria 7671
45 Ga0070696_100006147 3300005546 Bacteria 8023
46 Ga0070696_100215373 3300005546 Bacteria 1439
47 Ga0070665_100003413 3300005548 Bacteria 16975
48 Ga0070665_100004520 3300005548 Bacteria 14572
49 Ga0070665_100057344 3300005548 Bacteria 3904
50 Ga0070704_100064587 3300005549 Bacteria 2632
51 Ga0070704_100082582 3300005549 Bacteria 2370
52 Ga0068855_100018205 3300005563 Bacteria 8439
53 Ga0068857_100071941 3300005577 Bacteria 3082
54 Ga0070702_100033430 3300005615 Bacteria 2828
55 Ga0068859_100130329 3300005617 Bacteria 2586
56 Ga0068859_100150749 3300005617 Bacteria 2401
57 Ga0068864_100289317 3300005618 Bacteria 1531
58 Ga0068866_10022439 3300005718 Bacteria 2921
59 Ga0068863_100028249 3300005841 Bacteria 5356
60 Ga0068863_100258900 3300005841 Bacteria 1682
61 Ga0068858_100050234 3300005842 Bacteria 3860
62 Ga0068858_100058086 3300005842 Bacteria 3576
63 Ga0068858_100250133 3300005842 Bacteria 1683
64 Ga0068858_100285468 3300005842 Bacteria 1572
65 Ga0068860_100075871 3300005843 Bacteria 3197
66 Ga0068860_100123129 3300005843 Unclassified 2484
67 Ga0068860_100131206 3300005843 Bacteria 2405
68 Ga0068862_100003664 3300005844 Bacteria 13142
69 Ga0068862_100085953 3300005844 Bacteria 2733
70 Ga0081455_10054098 3300005937 Bacteria 3424
71 Ga0097621_100000621 3300006237 Bacteria 25044
72 Ga0097621_100005889 3300006237 Bacteria 8663
73 Ga0097621_100010848 3300006237 Bacteria 6686
74 Ga0097621_100067797 3300006237 Bacteria 2941
75 Ga0097621_100070340 3300006237 Bacteria 2890
76 Ga0097621_100287410 3300006237 Bacteria 1449
77 Ga0068871_100000308 3300006358 Bacteria 34022
78 Ga0068871_100001785 3300006358 Bacteria 14501
79 Ga0068871_100011736 3300006358 Bacteria 6435
80 Ga0068871_100030954 3300006358 Bacteria 4217
81 Ga0068871_100050248 3300006358 Bacteria 3373
82 Ga0075433_10070524 3300006852 Bacteria 3072
83 Ga0075433_10096901 3300006852 Bacteria 2611
84 Ga0075434_100001575 3300006871 Bacteria 19332
85 Ga0075434_100002563 3300006871 Bacteria 16046
86 Ga0075434_100008177 3300006871 Bacteria 9705
87 Ga0075434_100068530 3300006871 Bacteria 3535
88 Ga0075434_100157877 3300006871 Bacteria 2288
89 Ga0075434_100186588 3300006871 Bacteria 2094
90 Ga0075434_100267978 3300006871 Bacteria 1727
91 Ga0075429_100083573 3300006880 Unclassified 2783
92 Ga0068865_100002818 3300006881 Bacteria 10339
93 Ga0068865_100011595 3300006881 Bacteria 5524
94 Ga0068865_100050876 3300006881 Bacteria 2864
95 Ga0075436_100001140 3300006914 Bacteria 17973
96 Ga0075436_100056637 3300006914 Bacteria 2707
97 Ga0097620_100130327 3300006931 Bacteria 2586
98 Ga0097620_100150756 3300006931 Bacteria 2401
99 Ga0075435_100000417 3300007076 Bacteria 26219
100 Ga0075435_100010338 3300007076 Bacteria 6822
101 Ga0075435_100012019 3300007076 Bacteria 6396
102 Ga0075435_100122700 3300007076 Bacteria 2169
103 Ga0105240_10008866 3300009093 Bacteria 14316
104 Ga0111539_10006212 3300009094 Bacteria 15418
105 Ga0111539_10438647 3300009094 Unclassified 1521
106 Ga0105245_10378011 3300009098 Bacteria 1410
107 Ga0105247_10010308 3300009101 Bacteria 5654
108 Ga0114129_10004143 3300009147 Bacteria 20488
109 Ga0114129_10007298 3300009147 Bacteria 15736
110 Ga0114129_10027200 3300009147 Bacteria 8098
111 Ga0114129_10036422 3300009147 Bacteria 6947
112 Ga0114129_10114224 3300009147 Bacteria 3723
113 Ga0114129_10149224 3300009147 Bacteria 3200
114 Ga0114129_10166195 3300009147 Bacteria 3011
115 Ga0114129_10330575 3300009147 Bacteria 2024
116 Ga0114129_10540541 3300009147 Bacteria 1517
117 Ga0105243_10015941 3300009148 Bacteria 5683
118 Ga0105243_10039813 3300009148 Bacteria 3667
119 Ga0105243_10065594 3300009148 Bacteria 2917
120 Ga0105242_10015291 3300009176 Bacteria 5960
121 Ga0105242_10028560 3300009176 Bacteria 4443
122 Ga0105242_10151588 3300009176 Bacteria 2021
123 Ga0105248_10004004 3300009177 Bacteria 16289
124 Ga0105248_10004308 3300009177 Bacteria 15745
125 Ga0105248_10011632 3300009177 Bacteria 9695
126 Ga0105248_10044648 3300009177 Bacteria 4970
127 Ga0105248_10065973 3300009177 Bacteria 4064
128 Ga0105248_10142337 3300009177 Bacteria 2705
129 Ga0105248_10162884 3300009177 Bacteria 2515
130 Ga0105248_10180257 3300009177 Bacteria 2380
131 Ga0105248_10291917 3300009177 Bacteria 1836
132 Ga0105249_10055304 3300009553 Bacteria 3630
133 Ga0157370_10312558 3300013104 Unclassified 1450
134 Ga0157378_10007290 3300013297 Bacteria 9657
135 Ga0163162_10039237 3300013306 Bacteria 4731
136 Ga0157375_10157395 3300013308 Bacteria 2411
137 Ga0157375_10214258 3300013308 Bacteria 2084
138 Ga0163163_10016740 3300014325 Bacteria 6820
139 Ga0163163_10054949 3300014325 Bacteria 3935
140 Ga0163163_10102675 3300014325 Bacteria 2883
141 Ga0157380_10069759 3300014326 Bacteria 2837
142 Ga0157380_10125496 3300014326 Unclassified 2181
143 Ga0157377_10011577 3300014745 Bacteria 4409
144 Ga0157379_10002823 3300014968 Bacteria 14633
145 Ga0157379_10017160 3300014968 Bacteria 6376
146 Ga0157376_10020085 3300014969 Bacteria 5161
147 Ga0157376_10029387 3300014969 Bacteria 4378
148 Ga0157376_10041262 3300014969 Unclassified 3777
149 Ga0157376_10108505 3300014969 Bacteria 2439
150 Ga0157376_10454942 3300014969 Unclassified 1249
151 Ga0207645_10012994 3300025907 Bacteria 5629
152 Ga0207645_10063780 3300025907 Bacteria 2354
153 Ga0207705_10285809 3300025909 Bacteria 1263
154 Ga0207707_10028731 3300025912 Bacteria 4859
155 Ga0207662_10062288 3300025918 Unclassified 2241
156 Ga0207657_10030208 3300025919 Bacteria 4921
157 Ga0207649_10155596 3300025920 Bacteria 1579
158 Ga0207652_10121661 3300025921 Bacteria 2322
159 Ga0207681_10039398 3300025923 Bacteria 3137
160 Ga0207659_10000196 3300025926 Bacteria 35986
161 Ga0207659_10006609 3300025926 Bacteria 7120
162 Ga0207700_10205722 3300025928 Bacteria 1661
163 Ga0207644_10124032 3300025931 Unclassified 1970
164 Ga0207706_10131509 3300025933 Unclassified 2201
165 Ga0207706_10151634 3300025933 Bacteria 2038
166 Ga0207686_10065376 3300025934 Bacteria 2319
167 Ga0207686_10085793 3300025934 Unclassified 2066
168 Ga0207709_10016010 3300025935 Bacteria 4162
169 Ga0207709_10023276 3300025935 Bacteria 3524
170 Ga0207670_10097826 3300025936 Bacteria 2090
171 Ga0207669_10066425 3300025937 Bacteria 2242
172 Ga0207669_10247212 3300025937 Bacteria 1326
173 Ga0207704_10012517 3300025938 Bacteria 4212
174 Ga0207704_10016860 3300025938 Bacteria 3768
175 Ga0207665_10147174 3300025939 Bacteria 1684
176 Ga0207691_10029942 3300025940 Bacteria 5091
177 Ga0207711_10013018 3300025941 Bacteria 6909
178 Ga0207711_10021840 3300025941 Bacteria 5346
179 Ga0207711_10030085 3300025941 Bacteria 4580
180 Ga0207689_10040660 3300025942 Bacteria 3848
181 Ga0207689_10212104 3300025942 Bacteria 1600
182 Ga0207679_10060037 3300025945 Bacteria 2824
183 Ga0207667_10201822 3300025949 Bacteria 2040
184 Ga0207651_10055987 3300025960 Bacteria 2712
185 Ga0207712_10026241 3300025961 Bacteria 3879
186 Ga0207712_10238517 3300025961 Bacteria 1463
187 Ga0207668_10083136 3300025972 Bacteria 2329
188 Ga0207640_10011747 3300025981 Bacteria 4967
189 Ga0207658_10060129 3300025986 Bacteria 2834
190 Ga0207677_10160371 3300026023 Bacteria 1747
191 Ga0207703_10016901 3300026035 Bacteria 5692
192 Ga0207703_10230989 3300026035 Bacteria 1658
193 Ga0207703_10234996 3300026035 Bacteria 1645
194 Ga0207708_10004399 3300026075 Bacteria 10382
195 Ga0207641_10006849 3300026088 Bacteria 9542
196 Ga0207641_10155598 3300026088 Bacteria 2074
197 Ga0207648_10105627 3300026089 Bacteria 2470
198 Ga0207676_10017708 3300026095 Bacteria 5168
199 Ga0207676_10429094 3300026095 Bacteria 1241
200 Ga0207674_10050131 3300026116 Bacteria 4266
201 Ga0207675_100052256 3300026118 Bacteria 3813
202 Ga0207675_100120051 3300026118 Bacteria 2487
203 Ga0207683_10054511 3300026121 Bacteria 3506
204 Ga0207683_10080924 3300026121 Bacteria 2882
205 Ga0207428_10040569 3300027907 Bacteria 3774
206 Ga0207428_10147591 3300027907 Bacteria 1792
207 Ga0268265_10002732 3300028380 Bacteria 13040
208 Ga0268265_10220912 3300028380 Unclassified 1658
209 Ga0265332_10022601 3300031238 Unclassified 2775
210 Ga0265320_10052300 3300031240 Bacteria 1979
211 Ga0373950_0000471 3300034818 Bacteria 4923
212 Ga0373958_0002297 3300034819 Bacteria 2662
213 Ga0373938_0001496 3300034957 Bacteria 3750
214 Ga0373929_0001524 3300035085 Bacteria 4405
215 Ga0373934_0055517 3300035086 Bacteria 1574
216 Ga0373940_0007666 3300035088 Bacteria 2443
217 Ga0373951_0005823 3300035091 Bacteria 2847
218 Ga0373932_0001452 3300035112 Bacteria 6634
219 Ga0373936_0032106 3300035113 Bacteria 2076
220 Ga0373939_0000798 3300035114 Bacteria 7772
221 Ga0373939_0008629 3300035114 Bacteria 2503
222 Ga0373941_0035698 3300035115 Unclassified 1508
223 Ga0373957_0053520 3300035120 Unclassified 1549
224 Ga0373943_0021827 3300035170 Bacteria 2960
225 Ga0373946_0028693 3300035171 Unclassified 2209
226 Ga0373955_0097955 3300035172 Unclassified 1680
227 Ga0373931_0045387 3300035691 Bacteria 2320
228 Ga0373935_0006914 3300035692 Bacteria 6772
229 Ga0373935_0056863 3300035692 Bacteria 2495
230 Ga0373927_0120056 3300035695 Unclassified 1716
231 Ga0373947_0011205 3300035725 Bacteria 5147
232 Ga0373947_0104452 3300035725 Unclassified 1784
233 Ga0373937_0077485 3300036401 Bacteria 3072
234 Ga0373925_0026849 3300037068 Bacteria 4215
235 Ga0373925_0155432 3300037068 Bacteria 1798
236 Ga0395900_0347280 3300037418 Unclassified 1458
237 Ga0436365_1111416 3300039437 Bacteria 2043
238 Ga0451576_0006583 3300045051 Bacteria 14208
239 Ga0466967_0321596 3300045976 Bacteria 1492
240 Ga0495653_0240537 3300046463 Bacteria 1207
241 Ga0495582_0027914 3300046473 Bacteria 3096
242 Ga0495639_0044448 3300046475 Bacteria 2008
243 Ga0495664_0102423 3300046477 Bacteria 1726
244 Ga0495608_0022533 3300046511 Bacteria 4318
245 Ga0495630_0035270 3300046517 Bacteria 3738
246 Ga0495645_0011613 3300046543 Bacteria 6204
247 Ga0495645_0035236 3300046543 Bacteria 3649
248 Ga0495667_0070335 3300046559 Bacteria 2283
249 Ga0495659_0038871 3300046664 Unclassified 1691
250 Ga0495657_0096612 3300046675 Bacteria 1888
251 Ga0495647_0031381 3300046681 Unclassified 1976
252 Ga0495669_0000655 3300046684 Bacteria 15098
253 Ga0495669_0060119 3300046684 Bacteria 1717
254 Ga0495613_0001600 3300046689 Bacteria 17181
255 Ga0495670_0135886 3300046691 Bacteria 1284
256 Ga0495604_0029003 3300047317 Bacteria 4403
257 Ga0495674_0081409 3300047319 Bacteria 2777
258 Ga0495684_0000078 3300047471 Bacteria 66716
259 Ga0496101_0002334 3300048904 Bacteria 11628
260 Ga0496102_0046951 3300048905 Bacteria 3923
261 Ga0496104_0013217 3300048907 Bacteria 7442
262 Ga0496105_0297876 3300048908 Bacteria 1297
263 Ga0496106_0018077 3300048909 Bacteria 5212
264 Ga0496108_0009637 3300048911 Bacteria 7828
265 Ga0496108_0141098 3300048911 Bacteria 2076
266 Ga0496109_0235711 3300048912 Unclassified 1722
267 Ga0496112_0005870 3300048915 Bacteria 10692
268 Ga0496112_0228242 3300048915 Bacteria 1817
269 Ga0496112_0526745 3300048915 Unclassified 1116
270 Ga0496114_0000913 3300048917 Bacteria 22113
271 Ga0496114_0209057 3300048917 Bacteria 1711
272 Ga0496114_0224518 3300048917 Bacteria 1649
273 Ga0496114_0353254 3300048917 Unclassified 1300
274 Ga0496115_0016740 3300048918 Bacteria 5587
275 Ga0501033_0114742 3300049570 Unclassified 1958
276 Ga0501034_0003754 3300049571 Bacteria 17154
277 Ga0501034_0259872 3300049571 Bacteria 1679
278 Ga0501038_0086644 3300049574 Unclassified 2631
279 Ga0501041_0004010 3300049577 Bacteria 8496
280 Ga0501042_0062042 3300049578 Unclassified 2670
281 Ga0501043_0077259 3300049579 Unclassified 2616
282 Ga0501046_0111031 3300049580 Bacteria 2094
283 Ga0501048_0051468 3300049582 Bacteria 2932
284 Ga0501071_0032673 3300049587 Bacteria 3696
285 Ga0501073_0167188 3300049589 Bacteria 1523
286 Ga0501075_0006362 3300049591 Bacteria 8125
287 Ga0501076_0213946 3300049592 Unclassified 1575
288 Ga0501044_0019988 3300049823 Bacteria 7151
289 Ga0501045_0002578 3300049824 Bacteria 12362
290 nmdc:mga05p37_10389_c1 3300050507 Bacteria 11051
291 nmdc:mga05p37_12296_c1 3300050507 Bacteria 10223
292 nmdc:mga05p37_129674_c1 3300050507 Bacteria 3094
293 nmdc:mga05p37_148520_c1 3300050507 Bacteria 2869
294 nmdc:mga05p37_39762_c1 3300050507 Bacteria 5775
295 nmdc:mga05p37_46940_c1 3300050507 Bacteria 5311
296 nmdc:mga05p37_4878_c1 3300050507 Bacteria 15701
297 nmdc:mga09592_69266_c1 3300050508 Unclassified 2992
298 nmdc:mga06r32_394652_c1 3300050510 Bacteria 1366
299 nmdc:mga08y16_5262_c1 3300050511 Bacteria 13517
300 nmdc:mga0n895_182126_c1 3300050512 Bacteria 2132
301 nmdc:mga0n895_182_c1 3300050512 Bacteria 38722
302 nmdc:mga0n895_216110_c1 3300050512 Unclassified 1947
303 nmdc:mga0n895_60616_c1 3300050512 Bacteria 3734
304 nmdc:mga0n895_71659_c1 3300050512 Bacteria 3437
305 nmdc:mga0n895_80370_c1 3300050512 Bacteria 3248
306 nmdc:mga0rr50_110524_c1 3300050513 Bacteria 2174
307 nmdc:mga0rr50_4286_c1 3300050513 Bacteria 8351
308 nmdc:mga0rr50_45_c1 3300050513 Bacteria 74544
309 nmdc:mga0rr50_4631_c1 3300050513 Bacteria 8104
310 nmdc:mga0rr50_8756_c1 3300050513 Bacteria 6314
311 nmdc:mga08x19_309663_c1 3300050514 Unclassified 1098
312 nmdc:mga08x19_753_c1 3300050514 Bacteria 20724
313 nmdc:mga0a205_16881_c1 3300050515 Bacteria 6833
314 nmdc:mga0a205_246002_c1 3300050515 Unclassified 1669
315 nmdc:mga0a205_40157_c1 3300050515 Bacteria 4504
316 Ga0495601_0170700 3300053077 Bacteria 1422
317 Ga0495619_0006705 3300053085 Bacteria 7284
318 Ga0495619_0017669 3300053085 Bacteria 4518
319 Ga0495619_0254284 3300053085 Unclassified 1217
320 Ga0501084_0020974 3300054114 Bacteria 5449
321 Ga0590074_002279 3300059423 Bacteria 3153
322 Ga0590075_000510 3300059424 Bacteria 10525
323 Ga0590077_000345 3300059426 Bacteria 13170
324 Ga0501082_0001710 3300060353 Bacteria 19368
325 Ga0530510_0006222 3300061734 Bacteria 8301
326 Ga0070716_100050857
327 Ga0070676_10002985
328 Ga0070676_10145239
329 Ga0070683_100251157
330 Ga0070683_100326447
331 Ga0068869_100143229
332 Ga0070666_10031176
333 Ga0070680_100099012
334 Ga0070660_100043747
335 Ga0070668_100060231
336 Ga0070668_100140474
337 Ga0070669_100021119
338 Ga0070669_100115767
339 Ga0070675_100002124
340 Ga0070674_100016007
341 Ga0070673_100045436
342 Ga0070673_100123733
343 Ga0070659_100046078
344 Ga0070667_100020615
345 Ga0070709_10007801
346 Ga0070709_10199648
347 Ga0070701_10009446
348 Ga0070701_10032627
349 Ga0070705_100020629
350 Ga0070700_100000765
351 Ga0070694_100021677
352 Ga0070694_100258353
353 Ga0070708_100016501
354 Ga0070708_100153018
355 Ga0070662_100301085
356 Ga0070681_10043292
357 Ga0068867_100021796
358 Ga0070706_100351001
359 Ga0070707_100045906
360 Ga0070698_100064757
361 Ga0070698_100068092
362 Ga0070698_100338469
363 Ga0070699_100009771
364 Ga0070699_100027387
365 Ga0070699_100089608
366 Ga0070679_100108283
367 Ga0070697_100060444
368 Ga0070686_100095994
369 Ga0070695_100005208
370 Ga0070696_100006147
371 Ga0070696_100215373
372 Ga0070665_100003413
373 Ga0070665_100004520
374 Ga0070665_100057344
375 Ga0070704_100064587
376 Ga0070704_100082582
377 Ga0068855_100018205
378 Ga0068857_100071941
379 Ga0070702_100033430
380 Ga0068859_100130329
381 Ga0068859_100150749
382 Ga0068864_100289317
383 Ga0068866_10022439
384 Ga0068863_100028249
385 Ga0068863_100258900
386 Ga0068858_100050234
387 Ga0068858_100058086
388 Ga0068858_100250133
389 Ga0068858_100285468
390 Ga0068860_100075871
391 Ga0068860_100123129
392 Ga0068860_100131206
393 Ga0068862_100003664
394 Ga0068862_100085953
395 Ga0081455_10054098
396 Ga0097621_100000621
397 Ga0097621_100005889
398 Ga0097621_100010848
399 Ga0097621_100067797
400 Ga0097621_100070340
401 Ga0097621_100287410
402 Ga0068871_100000308
403 Ga0068871_100001785
404 Ga0068871_100011736
405 Ga0068871_100030954
406 Ga0068871_100050248
407 Ga0075433_10070524
408 Ga0075433_10096901
409 Ga0075434_100001575
410 Ga0075434_100002563
411 Ga0075434_100008177
412 Ga0075434_100068530
413 Ga0075434_100157877
414 Ga0075434_100186588
415 Ga0075434_100267978
416 Ga0075429_100083573
417 Ga0068865_100002818
418 Ga0068865_100011595
419 Ga0068865_100050876
420 Ga0075436_100001140
421 Ga0075436_100056637
422 Ga0097620_100130327
423 Ga0097620_100150756
424 Ga0075435_100000417
425 Ga0075435_100010338
426 Ga0075435_100012019
427 Ga0075435_100122700
428 Ga0105240_10008866
429 Ga0111539_10006212
430 Ga0111539_10438647
431 Ga0105245_10378011
432 Ga0105247_10010308
433 Ga0114129_10004143
434 Ga0114129_10007298
435 Ga0114129_10027200
436 Ga0114129_10036422
437 Ga0114129_10114224
438 Ga0114129_10149224
439 Ga0114129_10166195
440 Ga0114129_10330575
441 Ga0114129_10540541
442 Ga0105243_10015941
443 Ga0105243_10039813
444 Ga0105243_10065594
445 Ga0105242_10015291
446 Ga0105242_10028560
447 Ga0105242_10151588
448 Ga0105248_10004004
449 Ga0105248_10004308
450 Ga0105248_10011632
451 Ga0105248_10044648
452 Ga0105248_10065973
453 Ga0105248_10142337
454 Ga0105248_10162884
455 Ga0105248_10180257
456 Ga0105248_10291917
457 Ga0105249_10055304
458 Ga0157370_10312558
459 Ga0157378_10007290
460 Ga0163162_10039237
461 Ga0157375_10157395
462 Ga0157375_10214258
463 Ga0163163_10016740
464 Ga0163163_10054949
465 Ga0163163_10102675
466 Ga0157380_10069759
467 Ga0157380_10125496
468 Ga0157377_10011577
469 Ga0157379_10002823
470 Ga0157379_10017160
471 Ga0157376_10020085
472 Ga0157376_10029387
473 Ga0157376_10041262
474 Ga0157376_10108505
475 Ga0157376_10454942
476 Ga0207645_10012994
477 Ga0207645_10063780
478 Ga0207705_10285809
479 Ga0207707_10028731
480 Ga0207662_10062288
481 Ga0207657_10030208
482 Ga0207649_10155596
483 Ga0207652_10121661
484 Ga0207681_10039398
485 Ga0207659_10000196
486 Ga0207659_10006609
487 Ga0207700_10205722
488 Ga0207644_10124032
489 Ga0207706_10131509
490 Ga0207706_10151634
491 Ga0207686_10065376
492 Ga0207686_10085793
493 Ga0207709_10016010
494 Ga0207709_10023276
495 Ga0207670_10097826
496 Ga0207669_10066425
497 Ga0207669_10247212
498 Ga0207704_10012517
499 Ga0207704_10016860
500 Ga0207665_10147174
501 Ga0207691_10029942
502 Ga0207711_10013018
503 Ga0207711_10021840
504 Ga0207711_10030085
505 Ga0207689_10040660
506 Ga0207689_10212104
507 Ga0207679_10060037
508 Ga0207667_10201822
509 Ga0207651_10055987
510 Ga0207712_10026241
511 Ga0207712_10238517
512 Ga0207668_10083136
513 Ga0207640_10011747
514 Ga0207658_10060129
515 Ga0207677_10160371
516 Ga0207703_10016901
517 Ga0207703_10230989
518 Ga0207703_10234996
519 Ga0207708_10004399
520 Ga0207641_10006849
521 Ga0207641_10155598
522 Ga0207648_10105627
523 Ga0207676_10017708
524 Ga0207676_10429094
525 Ga0207674_10050131
526 Ga0207675_100052256
527 Ga0207675_100120051
528 Ga0207683_10054511
529 Ga0207683_10080924
530 Ga0207428_10040569
531 Ga0207428_10147591
532 Ga0268265_10002732
533 Ga0268265_10220912
534 Ga0265332_10022601
535 Ga0265320_10052300
536 Ga0373950_0000471
537 Ga0373958_0002297
538 Ga0373938_0001496
539 Ga0373929_0001524
540 Ga0373934_0055517
541 Ga0373940_0007666
542 Ga0373951_0005823
543 Ga0373932_0001452
544 Ga0373936_0032106
545 Ga0373939_0000798
546 Ga0373939_0008629
547 Ga0373941_0035698
548 Ga0373957_0053520
549 Ga0373943_0021827
550 Ga0373946_0028693
551 Ga0373955_0097955
552 Ga0373931_0045387
553 Ga0373935_0006914
554 Ga0373935_0056863
555 Ga0373927_0120056
556 Ga0373947_0011205
557 Ga0373947_0104452
558 Ga0373937_0077485
559 Ga0373925_0026849
560 Ga0373925_0155432
561 Ga0395900_0347280
562 Ga0436365_1111416
563 Ga0451576_0006583
564 Ga0466967_0321596
565 Ga0495653_0240537
566 Ga0495582_0027914
567 Ga0495639_0044448
568 Ga0495664_0102423
569 Ga0495608_0022533
570 Ga0495630_0035270
571 Ga0495645_0011613
572 Ga0495645_0035236
573 Ga0495667_0070335
574 Ga0495659_0038871
575 Ga0495657_0096612
576 Ga0495647_0031381
577 Ga0495669_0000655
578 Ga0495669_0060119
579 Ga0495613_0001600
580 Ga0495670_0135886
581 Ga0495604_0029003
582 Ga0495674_0081409
583 Ga0495684_0000078
584 Ga0496101_0002334
585 Ga0496102_0046951
586 Ga0496104_0013217
587 Ga0496105_0297876
588 Ga0496106_0018077
589 Ga0496108_0009637
590 Ga0496108_0141098
591 Ga0496109_0235711
592 Ga0496112_0005870
593 Ga0496112_0228242
594 Ga0496112_0526745
595 Ga0496114_0000913
596 Ga0496114_0209057
597 Ga0496114_0224518
598 Ga0496114_0353254
599 Ga0496115_0016740
600 Ga0501033_0114742
601 Ga0501034_0003754
602 Ga0501034_0259872
603 Ga0501038_0086644
604 Ga0501041_0004010
605 Ga0501042_0062042
606 Ga0501043_0077259
607 Ga0501046_0111031
608 Ga0501048_0051468
609 Ga0501071_0032673
610 Ga0501073_0167188
611 Ga0501075_0006362
612 Ga0501076_0213946
613 Ga0501044_0019988
614 Ga0501045_0002578
615 nmdc:mga05p37_10389_c1
616 nmdc:mga05p37_12296_c1
617 nmdc:mga05p37_129674_c1
618 nmdc:mga05p37_148520_c1
619 nmdc:mga05p37_39762_c1
620 nmdc:mga05p37_46940_c1
621 nmdc:mga05p37_4878_c1
622 nmdc:mga09592_69266_c1
623 nmdc:mga06r32_394652_c1
624 nmdc:mga08y16_5262_c1
625 nmdc:mga0n895_182126_c1
626 nmdc:mga0n895_182_c1
627 nmdc:mga0n895_216110_c1
628 nmdc:mga0n895_60616_c1
629 nmdc:mga0n895_71659_c1
630 nmdc:mga0n895_80370_c1
631 nmdc:mga0rr50_110524_c1
632 nmdc:mga0rr50_4286_c1
633 nmdc:mga0rr50_45_c1
634 nmdc:mga0rr50_4631_c1
635 nmdc:mga0rr50_8756_c1
636 nmdc:mga08x19_309663_c1
637 nmdc:mga08x19_753_c1
638 nmdc:mga0a205_16881_c1
639 nmdc:mga0a205_246002_c1
640 nmdc:mga0a205_40157_c1
641 Ga0495601_0170700
642 Ga0495619_0006705
643 Ga0495619_0017669
644 Ga0495619_0254284
645 Ga0501084_0020974
646 Ga0590074_002279
647 Ga0590075_000510
648 Ga0590077_000345
649 Ga0501082_0001710
650 Ga0530510_0006222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

133

332

0.89

PF16491

Peptidase_M48_N

CAAX prenyl protease N-terminal, five membrane helices

14

133

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bh8-assembly1.cif.gz_A crystal structure of zmpste24 in complex with phosphoramidon 0.8746 40 366
4aw6-assembly1.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 (face1) 0.8698 5 368
2ypt-assembly4.cif.gz_E crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.8686 5 367
2ypt-assembly2.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.8662 5 368
6bh8-assembly2.cif.gz_B crystal structure of zmpste24 in complex with phosphoramidon 0.8639 5 366
ID Description Score Start End Superfamily
af_Q55C18_272_352_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9421 162 240 3.30.2010.10
af_A0A1D8PL01_226_308_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9404 162 239 3.30.2010.10
af_Q55C18_272_352_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8982 162 240 3.30.2010.10
af_Q7K172_215_314_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8793 162 241 3.30.2010.10
af_A0A1D8PL01_226_308_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8766 162 239 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A2V8BR26-F1-model_v4 Peptidase 0.9845 1 367 GO:0004222
GO:0016020
GO:0046872
GO:0071586
AF-A0A1F2S0W3-F1-model_v4 Peptidase M48 domain-containing protein 0.9842 1 367 GO:0004222
GO:0006508
GO:0016020
GO:0046872
AF-A0A2V8GFI2-F1-model_v4 Peptidase 0.9839 63 367 GO:0004222
GO:0006508
GO:0016020
GO:0046872
AF-A0A2G4JNE1-F1-model_v4 GP-PDE domain-containing protein 0.9818 1 368 GO:0004222
GO:0006508
GO:0006629
GO:0008081
GO:0016020
GO:0046872
AF-A0A7W1TUE2-F1-model_v4 M48 family metalloprotease 0.9817 2 306 GO:0004222
GO:0006508
GO:0016020
GO:0046872

Map