F407433

General Info

Members Datasets Scaffolds Average Seq Length
324 179 324 294

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10000628|Ga0265320_1000062813
Length 331
Sequence MAGFMPAMTIRWISVKSSQTRARKKRVEKAGAKGHLGPMSNVISFDENDSNWRRMGRAIRFLSANYLDQPRLEDAADAVGLSSFHFQRLFTRYVGVSPKHFVGHLTLGHAKGSLLEGKSLLETAFDVGLSGSSRLHDLCLKIEAMTPGEYAKGGEGLAIEYGFHGCPFGIALVMATPKGVCGLAFGDEGEETAMLNDMRARWPKARFVAAPERTAKLAAAIFTPRKPDTDLRLHLLGTPFQVKVWQALLAIPEGKLSTYGALAAHLGREGASRAVGAAVGRNPISWIIPCHRVLASDGALRGYHWGLERKRAMLAVEAARQSQRPSTSAIA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.54
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001888 3300003320 Bacteria 9122
2 rootH2_10208059 3300003320 Bacteria 1780
3 Ga0070658_10038887 3300005327 Bacteria 3837
4 Ga0070677_10000714 3300005333 Bacteria 11144
5 Ga0068869_100094071 3300005334 Unclassified 2259
6 Ga0070666_10000309 3300005335 Bacteria 31703
7 Ga0070680_100000317 3300005336 Bacteria 32367
8 Ga0070682_100106333 3300005337 Unclassified 1862
9 Ga0070691_10000033 3300005341 Bacteria 39121
10 Ga0070691_10003543 3300005341 Bacteria 7040
11 Ga0070661_100000254 3300005344 Bacteria 43578
12 Ga0070661_100020592 3300005344 Bacteria 4706
13 Ga0070661_100103926 3300005344 Bacteria 2116
14 Ga0070668_100443755 3300005347 Bacteria 1114
15 Ga0070675_100001032 3300005354 Bacteria 20035
16 Ga0070671_100245470 3300005355 Unclassified 1520
17 Ga0070674_100085534 3300005356 Unclassified 2263
18 Ga0070673_100021761 3300005364 Bacteria 4657
19 Ga0070673_100048600 3300005364 Bacteria 3308
20 Ga0070659_100023118 3300005366 Bacteria 4753
21 Ga0070667_100030619 3300005367 Bacteria 4488
22 Ga0070667_100262502 3300005367 Unclassified 1547
23 Ga0070709_10000179 3300005434 Bacteria 40240
24 Ga0070709_10056457 3300005434 Bacteria 2483
25 Ga0070714_100016053 3300005435 Bacteria 6037
26 Ga0070714_100045963 3300005435 Bacteria 3702
27 Ga0070713_100000011 3300005436 Bacteria 146314
28 Ga0070713_100049354 3300005436 Bacteria 3472
29 Ga0070711_100007954 3300005439 Bacteria 6465
30 Ga0070711_100152296 3300005439 Bacteria 1745
31 Ga0070700_100119033 3300005441 Bacteria 1767
32 Ga0070678_100076910 3300005456 Unclassified 2516
33 Ga0070681_10000002 3300005458 Bacteria 821814
34 Ga0070681_10132265 3300005458 Bacteria 2427
35 Ga0070679_100001275 3300005530 Bacteria 22239
36 Ga0068853_100001110 3300005539 Bacteria 19059
37 Ga0068853_100001647 3300005539 Bacteria 16330
38 Ga0068853_100102006 3300005539 Bacteria 2539
39 Ga0070695_100008582 3300005545 Bacteria 6070
40 Ga0070693_100098657 3300005547 Bacteria 1776
41 Ga0070665_100273482 3300005548 Bacteria 1691
42 Ga0068855_100000069 3300005563 Bacteria 124154
43 Ga0068855_100005915 3300005563 Bacteria 14914
44 Ga0070664_100267900 3300005564 Unclassified 1538
45 Ga0068857_100002650 3300005577 Bacteria 14696
46 Ga0068854_100143734 3300005578 Bacteria 1833
47 Ga0068856_100001370 3300005614 Bacteria 25638
48 Ga0068856_100001593 3300005614 Bacteria 23711
49 Ga0068852_100008577 3300005616 Bacteria 7540
50 Ga0068852_100036719 3300005616 Bacteria 4103
51 Ga0068852_100087431 3300005616 Bacteria 2781
52 Ga0068859_100639512 3300005617 Unclassified 1156
53 Ga0068864_100202946 3300005618 Bacteria 1822
54 Ga0068861_100043324 3300005719 Bacteria 3378
55 Ga0068870_10010870 3300005840 Bacteria 4199
56 Ga0068863_100122730 3300005841 Bacteria 2478
57 Ga0068863_100124652 3300005841 Bacteria 2457
58 Ga0070717_10260550 3300006028 Bacteria 1534
59 Ga0070712_100000023 3300006175 Bacteria 80972
60 Ga0070712_100001086 3300006175 Bacteria 16374
61 Ga0097621_100123233 3300006237 Bacteria 2200
62 Ga0097621_100282710 3300006237 Bacteria 1461
63 Ga0075434_100040351 3300006871 Bacteria 4622
64 Ga0075436_100000276 3300006914 Bacteria 32410
65 Ga0075436_100005635 3300006914 Bacteria 8593
66 Ga0097620_100639547 3300006931 Unclassified 1156
67 Ga0075435_100031595 3300007076 Bacteria 4173
68 Ga0075435_100060033 3300007076 Bacteria 3083
69 Ga0105240_10000055 3300009093 Bacteria 225380
70 Ga0105240_10001363 3300009093 Bacteria 41954
71 Ga0105240_10129331 3300009093 Bacteria 3030
72 Ga0105247_10266998 3300009101 Unclassified 1175
73 Ga0105241_10002297 3300009174 Bacteria 14366
74 Ga0105242_10041936 3300009176 Bacteria 3693
75 Ga0105242_10144458 3300009176 Bacteria 2068
76 Ga0105248_10000001 3300009177 Bacteria 1881304
77 Ga0105248_10049367 3300009177 Bacteria 4720
78 Ga0105248_10087663 3300009177 Unclassified 3503
79 Ga0105237_10000746 3300009545 Bacteria 44835
80 Ga0105237_10600465 3300009545 Bacteria 1108
81 Ga0105238_10007767 3300009551 Bacteria 10725
82 Ga0105238_10040779 3300009551 Bacteria 4703
83 Ga0105238_10049009 3300009551 Bacteria 4255
84 Ga0105239_10000716 3300010375 Bacteria 47033
85 Ga0105239_10002420 3300010375 Bacteria 23767
86 Ga0105239_10069089 3300010375 Bacteria 3882
87 Ga0157373_10001483 3300013100 Bacteria 17886
88 Ga0157373_10086632 3300013100 Bacteria 2207
89 Ga0157370_10000753 3300013104 Bacteria 40426
90 Ga0157370_10011069 3300013104 Bacteria 9455
91 Ga0157370_10096241 3300013104 Bacteria 2778
92 Ga0157369_10002018 3300013105 Bacteria 24475
93 Ga0157369_10005371 3300013105 Bacteria 14918
94 Ga0157369_10129518 3300013105 Bacteria 2674
95 Ga0157369_10202507 3300013105 Bacteria 2083
96 Ga0157374_10055603 3300013296 Bacteria 3694
97 Ga0157374_10377520 3300013296 Unclassified 1412
98 Ga0157378_10690481 3300013297 Bacteria 1039
99 Ga0163162_10051325 3300013306 Bacteria 4138
100 Ga0157372_10007018 3300013307 Bacteria 11995
101 Ga0157372_10048709 3300013307 Bacteria 4710
102 Ga0163163_10237668 3300014325 Bacteria 1871
103 Ga0157379_10001588 3300014968 Bacteria 18738
104 Ga0157379_10002050 3300014968 Bacteria 16740
105 Ga0157379_10016532 3300014968 Bacteria 6490
106 Ga0157379_10036941 3300014968 Bacteria 4355
107 Ga0163161_10324223 3300017792 Bacteria 1218
108 Ga0207682_10001837 3300025893 Bacteria 9666
109 Ga0207682_10002748 3300025893 Bacteria 7793
110 Ga0207680_10001895 3300025903 Bacteria 9817
111 Ga0207699_10000758 3300025906 Bacteria 15441
112 Ga0207699_10058775 3300025906 Bacteria 2302
113 Ga0207645_10189927 3300025907 Bacteria 1350
114 Ga0207643_10002188 3300025908 Bacteria 10660
115 Ga0207705_10000105 3300025909 Bacteria 95742
116 Ga0207707_10000002 3300025912 Bacteria 1142054
117 Ga0207707_10002912 3300025912 Bacteria 15271
118 Ga0207707_10511061 3300025912 Bacteria 1024
119 Ga0207695_10000012 3300025913 Bacteria 840961
120 Ga0207695_10016474 3300025913 Bacteria 8643
121 Ga0207671_10019446 3300025914 Bacteria 5192
122 Ga0207693_10000018 3300025915 Bacteria 138365
123 Ga0207693_10000534 3300025915 Bacteria 34415
124 Ga0207660_10000814 3300025917 Bacteria 20597
125 Ga0207660_10001134 3300025917 Bacteria 17804
126 Ga0207657_10000154 3300025919 Bacteria 70197
127 Ga0207649_10000026 3300025920 Bacteria 177395
128 Ga0207649_10012415 3300025920 Bacteria 4726
129 Ga0207652_10001371 3300025921 Bacteria 21659
130 Ga0207652_10003391 3300025921 Bacteria 13158
131 Ga0207694_10000006 3300025924 Bacteria 631109
132 Ga0207694_10040540 3300025924 Bacteria 3585
133 Ga0207650_10020067 3300025925 Bacteria 4708
134 Ga0207659_10028208 3300025926 Bacteria 3812
135 Ga0207700_10000026 3300025928 Bacteria 139690
136 Ga0207664_10005160 3300025929 Bacteria 8901
137 Ga0207664_10072706 3300025929 Bacteria 2773
138 Ga0207644_10441770 3300025931 Unclassified 1068
139 Ga0207690_10035537 3300025932 Bacteria 3219
140 Ga0207686_10065982 3300025934 Unclassified 2310
141 Ga0207686_10151528 3300025934 Bacteria 1615
142 Ga0207670_10220790 3300025936 Bacteria 1450
143 Ga0207669_10014672 3300025937 Bacteria 3933
144 Ga0207669_10064541 3300025937 Bacteria 2266
145 Ga0207704_10026074 3300025938 Bacteria 3201
146 Ga0207691_10004516 3300025940 Bacteria 13459
147 Ga0207711_10000001 3300025941 Bacteria 1325674
148 Ga0207711_10008576 3300025941 Bacteria 8549
149 Ga0207667_10000026 3300025949 Bacteria 343713
150 Ga0207667_10004609 3300025949 Bacteria 16905
151 Ga0207667_10031722 3300025949 Bacteria 5702
152 Ga0207651_10005462 3300025960 Bacteria 6529
153 Ga0207668_10047647 3300025972 Unclassified 2936
154 Ga0207640_10022564 3300025981 Bacteria 3770
155 Ga0207640_10062830 3300025981 Bacteria 2465
156 Ga0207658_10068961 3300025986 Bacteria 2670
157 Ga0207658_10440142 3300025986 Unclassified 1152
158 Ga0207639_10001144 3300026041 Bacteria 18042
159 Ga0207639_10054118 3300026041 Bacteria 3066
160 Ga0207708_10044875 3300026075 Bacteria 3368
161 Ga0207702_10000592 3300026078 Bacteria 40068
162 Ga0207702_10002168 3300026078 Bacteria 18833
163 Ga0207641_10069386 3300026088 Bacteria 3026
164 Ga0207674_10000134 3300026116 Bacteria 86377
165 Ga0207675_100035623 3300026118 Bacteria 4642
166 Ga0207683_10008135 3300026121 Bacteria 8970
167 Ga0207698_10062058 3300026142 Bacteria 2916
168 Ga0207698_10424764 3300026142 Bacteria 1276
169 Ga0207698_10523754 3300026142 Bacteria 1157
170 Ga0265334_10007944 3300028573 Bacteria 4534
171 Ga0265318_10000172 3300028577 Bacteria 57357
172 Ga0265338_10000011 3300028800 Bacteria 433370
173 Ga0265338_10009825 3300028800 Bacteria 11342
174 Ga0265338_10049968 3300028800 Bacteria 3784
175 Ga0265330_10008539 3300031235 Bacteria 4927
176 Ga0265330_10060847 3300031235 Bacteria 1643
177 Ga0265332_10029435 3300031238 Bacteria 2401
178 Ga0265320_10000628 3300031240 Bacteria 27016
179 Ga0265325_10000009 3300031241 Bacteria 184273
180 Ga0265325_10000365 3300031241 Bacteria 31743
181 Ga0265325_10001964 3300031241 Bacteria 14172
182 Ga0265325_10023697 3300031241 Bacteria 3346
183 Ga0265329_10046668 3300031242 Bacteria 1384
184 Ga0265340_10000018 3300031247 Bacteria 90851
185 Ga0265340_10000261 3300031247 Bacteria 27331
186 Ga0265340_10003329 3300031247 Bacteria 9105
187 Ga0265340_10012272 3300031247 Bacteria 4527
188 Ga0265339_10000271 3300031249 Bacteria 41827
189 Ga0265339_10003492 3300031249 Bacteria 10991
190 Ga0265339_10013804 3300031249 Bacteria 4888
191 Ga0265339_10026769 3300031249 Bacteria 3300
192 Ga0265339_10055941 3300031249 Bacteria 2138
193 Ga0265331_10000008 3300031250 Bacteria 324311
194 Ga0265331_10000067 3300031250 Bacteria 158073
195 Ga0265331_10000722 3300031250 Bacteria 27993
196 Ga0265327_10000036 3300031251 Bacteria 312827
197 Ga0265316_10003597 3300031344 Bacteria 15622
198 Ga0265316_10020000 3300031344 Bacteria 5710
199 Ga0265316_10042693 3300031344 Bacteria 3622
200 Ga0265316_10061901 3300031344 Bacteria 2905
201 Ga0265316_10212093 3300031344 Bacteria 1432
202 Ga0307513_10011270 3300031456 Bacteria 11127
203 Ga0307513_10029194 3300031456 Bacteria 6291
204 Ga0265313_10000620 3300031595 Bacteria 36725
205 Ga0265313_10002198 3300031595 Bacteria 17259
206 Ga0265313_10057555 3300031595 Bacteria 1834
207 Ga0265313_10089783 3300031595 Bacteria 1382
208 Ga0265313_10107214 3300031595 Bacteria 1232
209 Ga0265314_10002040 3300031711 Bacteria 21393
210 Ga0265314_10004079 3300031711 Bacteria 13774
211 Ga0265314_10047212 3300031711 Bacteria 3032
212 Ga0265314_10051534 3300031711 Bacteria 2866
213 Ga0265314_10060222 3300031711 Bacteria 2592
214 Ga0265314_10155204 3300031711 Unclassified 1399
215 Ga0265314_10172134 3300031711 Bacteria 1306
216 Ga0265342_10002698 3300031712 Bacteria 15108
217 Ga0265342_10016420 3300031712 Bacteria 4840
218 Ga0265342_10023816 3300031712 Bacteria 3869
219 Ga0265342_10038097 3300031712 Bacteria 2930
220 Ga0265342_10101755 3300031712 Bacteria 1635
221 Ga0316576_10055491 3300031727 Bacteria 2892
222 Ga0316576_10057231 3300031727 Unclassified 2849
223 Ga0307516_10129045 3300031730 Bacteria 2310
224 Ga0307413_10020616 3300031824 Bacteria 3510
225 Ga0307410_10031414 3300031852 Bacteria 3407
226 Ga0307407_10015415 3300031903 Bacteria 3777
227 Ga0307409_100277738 3300031995 Unclassified 1546
228 Ga0316580_10040098 3300032139 Bacteria 1447
229 Ga0373926_0062835 3300035083 Bacteria 1356
230 Ga0373934_0050746 3300035086 Bacteria 1644
231 Ga0373943_0328953 3300035170 Unclassified 872
232 Ga0373955_0298725 3300035172 Unclassified 971
233 Ga0316574_0251967 3300035398 Bacteria 1128
234 Ga0373931_0007350 3300035691 Bacteria 5185
235 Ga0373935_0449846 3300035692 Bacteria 930
236 Ga0373933_0030310 3300035724 Bacteria 3132
237 Ga0373933_0055321 3300035724 Bacteria 2380
238 Ga0373937_0000880 3300036401 Bacteria 25714
239 Ga0373937_0003753 3300036401 Bacteria 12834
240 Ga0373937_0064903 3300036401 Bacteria 3359
241 Ga0373937_0137436 3300036401 Bacteria 2285
242 Ga0373937_0196048 3300036401 Bacteria 1898
243 Ga0316584_0055993 3300036712 Bacteria 2952
244 Ga0373925_0136792 3300037068 Bacteria 1915
245 Ga0436365_1115723 3300039437 Bacteria 1620
246 Ga0436365_1513507 3300039437 Bacteria 68714
247 Ga0495664_0010262 3300046477 Bacteria 5255
248 Ga0495664_0059660 3300046477 Bacteria 2271
249 Ga0495645_0061987 3300046543 Bacteria 2709
250 Ga0495649_0163966 3300046694 Bacteria 1165
251 Ga0496101_0093498 3300048904 Bacteria 2240
252 Ga0496106_0407006 3300048909 Bacteria 1093
253 Ga0496110_0284859 3300048913 Bacteria 1505
254 Ga0496112_0311512 3300048915 Bacteria 1519
255 Ga0496115_0098501 3300048918 Bacteria 2395
256 Ga0495682_0002321 3300049460 Bacteria 9049
257 Ga0501031_0007007 3300049568 Bacteria 7359
258 Ga0501031_0035735 3300049568 Bacteria 3242
259 Ga0501032_0023810 3300049569 Bacteria 4228
260 Ga0501032_0291400 3300049569 Bacteria 1056
261 Ga0501034_0012731 3300049571 Bacteria 8677
262 Ga0501034_0136942 3300049571 Bacteria 2429
263 Ga0501037_0022800 3300049573 Bacteria 4629
264 Ga0501037_0092295 3300049573 Bacteria 2190
265 Ga0501037_0109240 3300049573 Unclassified 1993
266 Ga0501038_0029315 3300049574 Bacteria 4878
267 Ga0501038_0063322 3300049574 Bacteria 3157
268 Ga0501038_0358617 3300049574 Bacteria 1134
269 Ga0501039_0069971 3300049575 Bacteria 2726
270 Ga0501043_0029940 3300049579 Bacteria 4277
271 Ga0501043_0134575 3300049579 Bacteria 1936
272 Ga0501046_0056903 3300049580 Bacteria 3068
273 Ga0501047_0002217 3300049581 Bacteria 18619
274 Ga0501047_0151084 3300049581 Bacteria 2198
275 Ga0501047_0252795 3300049581 Bacteria 1611
276 Ga0501047_0258583 3300049581 Bacteria 1589
277 Ga0501048_0048231 3300049582 Bacteria 3039
278 Ga0501067_0000181 3300049583 Bacteria 35717
279 Ga0501067_0007292 3300049583 Bacteria 6138
280 Ga0501067_0153990 3300049583 Bacteria 1281
281 Ga0501068_0008263 3300049584 Bacteria 5785
282 Ga0501069_0001060 3300049585 Bacteria 13174
283 Ga0501070_0001145 3300049586 Bacteria 23776
284 Ga0501070_0007717 3300049586 Bacteria 9123
285 Ga0501070_0016647 3300049586 Bacteria 6175
286 Ga0501071_0025120 3300049587 Bacteria 4172
287 Ga0501072_0011727 3300049588 Bacteria 6696
288 Ga0501073_0004754 3300049589 Bacteria 10195
289 Ga0501073_0014765 3300049589 Bacteria 5671
290 Ga0501073_0024036 3300049589 Bacteria 4376
291 Ga0501073_0127498 3300049589 Bacteria 1764
292 Ga0501074_0003522 3300049590 Bacteria 11113
293 Ga0501074_0009511 3300049590 Bacteria 7059
294 Ga0501074_0093635 3300049590 Bacteria 2152
295 Ga0501074_0344739 3300049590 Bacteria 1057
296 Ga0501076_0012676 3300049592 Bacteria 6311
297 Ga0501077_0001000 3300049593 Bacteria 17040
298 Ga0501079_0001647 3300049741 Bacteria 15901
299 Ga0501079_0015777 3300049741 Bacteria 5771
300 Ga0501079_0133547 3300049741 Unclassified 1932
301 Ga0501080_0001970 3300049742 Bacteria 17726
302 Ga0501080_0002886 3300049742 Bacteria 15116
303 Ga0501080_0010825 3300049742 Bacteria 8345
304 Ga0501080_0041628 3300049742 Bacteria 4279
305 Ga0501080_0056242 3300049742 Bacteria 3665
306 Ga0501083_0034156 3300049744 Bacteria 3479
307 Ga0501035_0001106 3300049822 Bacteria 28263
308 Ga0501035_0005635 3300049822 Bacteria 11824
309 Ga0501035_0125154 3300049822 Bacteria 2244
310 Ga0501044_0001448 3300049823 Bacteria 27879
311 Ga0501044_0014583 3300049823 Bacteria 8476
312 Ga0501044_0117981 3300049823 Bacteria 2657
313 Ga0501044_0181758 3300049823 Bacteria 2069
314 Ga0501044_0293895 3300049823 Bacteria 1555
315 nmdc:mga0n895_125415_c1 3300050512 Bacteria 2591
316 nmdc:mga0n895_79713_c1 3300050512 Bacteria 3261
317 nmdc:mga0rr50_80846_c1 3300050513 Bacteria 2506
318 nmdc:mga0rr50_87258_c1 3300050513 Bacteria 2422
319 nmdc:mga08x19_19516_c1 3300050514 Bacteria 4161
320 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
321 Ga0501084_0001715 3300054114 Bacteria 17404
322 Ga0501084_0003677 3300054114 Bacteria 12445
323 Ga0501084_0012747 3300054114 Bacteria 6963
324 Ga0501082_0007852 3300060353 Bacteria 9205

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025906 Ga0207699_10058775 Ga0207699_100587754 246
2 3300035170 Ga0373943_0328953 Ga0373943_0328953_37_825 261
3 3300025907 Ga0207645_10189927 Ga0207645_101899271 268
4 3300028577 Ga0265318_10000172 Ga0265318_1000017253 274
5 3300028800 Ga0265338_10049968 Ga0265338_100499684 276
6 3300048909 Ga0496106_0407006 Ga0496106_0407006_234_1067 276
7 3300032139 Ga0316580_10040098 Ga0316580_100400981 278
8 3300036712 Ga0316584_0055993 Ga0316584_0055993_828_1670 278
9 3300031456 Ga0307513_10011270 Ga0307513_100112707 282
10 3300031456 Ga0307513_10029194 Ga0307513_100291942 282
11 3300031727 Ga0316576_10057231 Ga0316576_100572313 282
12 3300005333 Ga0070677_10000714 Ga0070677_1000071411 284
13 3300005334 Ga0068869_100094071 Ga0068869_1000940712 284
14 3300005337 Ga0070682_100106333 Ga0070682_1001063332 284
15 3300005347 Ga0070668_100443755 Ga0070668_1004437551 284
16 3300005354 Ga0070675_100001032 Ga0070675_10000103211 284
17 3300005355 Ga0070671_100245470 Ga0070671_1002454702 284
18 3300005356 Ga0070674_100085534 Ga0070674_1000855342 284
19 3300005364 Ga0070673_100021761 Ga0070673_1000217611 284
20 3300005364 Ga0070673_100048600 Ga0070673_1000486001 284
21 3300005367 Ga0070667_100262502 Ga0070667_1002625022 284
22 3300005441 Ga0070700_100119033 Ga0070700_1001190332 284
23 3300005456 Ga0070678_100076910 Ga0070678_1000769102 284
24 3300005548 Ga0070665_100273482 Ga0070665_1002734822 284
25 3300005564 Ga0070664_100267900 Ga0070664_1002679002 284
26 3300005617 Ga0068859_100639512 Ga0068859_1006395121 284
27 3300005719 Ga0068861_100043324 Ga0068861_1000433243 284
28 3300005840 Ga0068870_10010870 Ga0068870_100108702 284
29 3300005841 Ga0068863_100124652 Ga0068863_1001246522 284
30 3300006237 Ga0097621_100123233 Ga0097621_1001232332 284
31 3300006931 Ga0097620_100639547 Ga0097620_1006395471 284
32 3300009176 Ga0105242_10041936 Ga0105242_100419363 284
33 3300009177 Ga0105248_10087663 Ga0105248_100876633 284
34 3300013296 Ga0157374_10377520 Ga0157374_103775202 284
35 3300013306 Ga0163162_10051325 Ga0163162_100513253 284
36 3300014325 Ga0163163_10237668 Ga0163163_102376682 284
37 3300017792 Ga0163161_10324223 Ga0163161_103242231 284
38 3300025893 Ga0207682_10001837 Ga0207682_100018373 284
39 3300025893 Ga0207682_10002748 Ga0207682_100027485 284
40 3300025908 Ga0207643_10002188 Ga0207643_1000218810 284
41 3300025925 Ga0207650_10020067 Ga0207650_100200675 284
42 3300025926 Ga0207659_10028208 Ga0207659_100282083 284
43 3300025931 Ga0207644_10441770 Ga0207644_104417702 284
44 3300025934 Ga0207686_10065982 Ga0207686_100659822 284
45 3300025936 Ga0207670_10220790 Ga0207670_102207901 284
46 3300025937 Ga0207669_10014672 Ga0207669_100146722 284
47 3300025937 Ga0207669_10064541 Ga0207669_100645412 284
48 3300025938 Ga0207704_10026074 Ga0207704_100260741 284
49 3300025940 Ga0207691_10004516 Ga0207691_100045167 284
50 3300025960 Ga0207651_10005462 Ga0207651_100054622 284
51 3300025972 Ga0207668_10047647 Ga0207668_100476473 284
52 3300025986 Ga0207658_10440142 Ga0207658_104401422 284
53 3300026075 Ga0207708_10044875 Ga0207708_100448753 284
54 3300026118 Ga0207675_100035623 Ga0207675_1000356232 284
55 3300026121 Ga0207683_10008135 Ga0207683_100081356 284
56 3300031727 Ga0316576_10055491 Ga0316576_100554912 284
57 3300046694 Ga0495649_0163966 Ga0495649_0163966_94_978 284
58 3300049583 Ga0501067_0007292 Ga0501067_0007292_726_1625 284
59 3300049584 Ga0501068_0008263 Ga0501068_0008263_3764_4663 284
60 3300049587 Ga0501071_0025120 Ga0501071_0025120_2345_3244 284
61 3300049589 Ga0501073_0014765 Ga0501073_0014765_3778_4677 284
62 3300049590 Ga0501074_0003522 Ga0501074_0003522_1904_2803 284
63 3300049592 Ga0501076_0012676 Ga0501076_0012676_143_1042 284
64 3300049593 Ga0501077_0001000 Ga0501077_0001000_6429_7328 284
65 3300049741 Ga0501079_0015777 Ga0501079_0015777_1187_2086 284
66 3300049742 Ga0501080_0010825 Ga0501080_0010825_5577_6476 284
67 3300054114 Ga0501084_0012747 Ga0501084_0012747_4356_5255 284
68 3300060353 Ga0501082_0007852 Ga0501082_0007852_259_1158 284
69 3300031249 Ga0265339_10026769 Ga0265339_100267694 285
70 3300031344 Ga0265316_10042693 Ga0265316_100426932 285
71 3300031824 Ga0307413_10020616 Ga0307413_100206162 285
72 3300031852 Ga0307410_10031414 Ga0307410_100314142 285
73 3300031903 Ga0307407_10015415 Ga0307407_100154153 285
74 3300031995 Ga0307409_100277738 Ga0307409_1002777382 285
75 3300006028 Ga0070717_10260550 Ga0070717_102605502 286
76 3300035398 Ga0316574_0251967 Ga0316574_0251967_204_1079 286
77 3300035724 Ga0373933_0055321 Ga0373933_0055321_627_1490 286
78 3300036401 Ga0373937_0137436 Ga0373937_0137436_1032_1895 286
79 3300036401 Ga0373937_0196048 Ga0373937_0196048_863_1726 286
80 3300003320 rootH2_10208059 rootH2_102080592 288
81 3300005367 Ga0070667_100030619 Ga0070667_1000306195 288
82 3300025986 Ga0207658_10068961 Ga0207658_100689612 288
83 3300031242 Ga0265329_10046668 Ga0265329_100466682 288
84 3300031712 Ga0265342_10016420 Ga0265342_100164203 288
85 3300035172 Ga0373955_0298725 Ga0373955_0298725_73_942 288
86 3300036401 Ga0373937_0003753 Ga0373937_0003753_11836_12705 288
87 3300039437 Ga0436365_1115723 Ga0436365_1115723_422_1291 288
88 3300005344 Ga0070661_100103926 Ga0070661_1001039262 289
89 3300005335 Ga0070666_10000309 Ga0070666_100003097 290
90 3300005434 Ga0070709_10000179 Ga0070709_1000017934 290
91 3300005435 Ga0070714_100016053 Ga0070714_1000160532 290
92 3300005435 Ga0070714_100045963 Ga0070714_1000459632 290
93 3300005436 Ga0070713_100000011 Ga0070713_10000001111 290
94 3300005539 Ga0068853_100001110 Ga0068853_1000011104 290
95 3300005614 Ga0068856_100001593 Ga0068856_10000159311 290
96 3300005616 Ga0068852_100087431 Ga0068852_1000874314 290
97 3300005618 Ga0068864_100202946 Ga0068864_1002029462 290
98 3300005841 Ga0068863_100122730 Ga0068863_1001227304 290
99 3300006175 Ga0070712_100000023 Ga0070712_10000002342 290
100 3300006914 Ga0075436_100000276 Ga0075436_10000027611 290
101 3300007076 Ga0075435_100031595 Ga0075435_1000315952 290
102 3300009093 Ga0105240_10129331 Ga0105240_101293314 290
103 3300009101 Ga0105247_10266998 Ga0105247_102669982 290
104 3300009177 Ga0105248_10000001 Ga0105248_100000011688 290
105 3300013297 Ga0157378_10690481 Ga0157378_106904811 290
106 3300014968 Ga0157379_10036941 Ga0157379_100369415 290
107 3300025903 Ga0207680_10001895 Ga0207680_100018956 290
108 3300025906 Ga0207699_10000758 Ga0207699_1000075815 290
109 3300025915 Ga0207693_10000018 Ga0207693_10000018105 290
110 3300025928 Ga0207700_10000026 Ga0207700_1000002626 290
111 3300025929 Ga0207664_10005160 Ga0207664_100051605 290
112 3300025929 Ga0207664_10072706 Ga0207664_100727062 290
113 3300025941 Ga0207711_10000001 Ga0207711_10000001184 290
114 3300026041 Ga0207639_10001144 Ga0207639_100011443 290
115 3300026078 Ga0207702_10000592 Ga0207702_1000059220 290
116 3300026088 Ga0207641_10069386 Ga0207641_100693865 290
117 3300028573 Ga0265334_10007944 Ga0265334_100079443 290
118 3300028800 Ga0265338_10000011 Ga0265338_10000011318 290
119 3300031238 Ga0265332_10029435 Ga0265332_100294352 290
120 3300031241 Ga0265325_10000009 Ga0265325_10000009197 290
121 3300031247 Ga0265340_10000261 Ga0265340_100002615 290
122 3300031249 Ga0265339_10000271 Ga0265339_1000027142 290
123 3300031250 Ga0265331_10000722 Ga0265331_100007221 290
124 3300031595 Ga0265313_10000620 Ga0265313_1000062046 290
125 3300031595 Ga0265313_10089783 Ga0265313_100897832 290
126 3300031711 Ga0265314_10004079 Ga0265314_100040793 290
127 3300031711 Ga0265314_10051534 Ga0265314_100515343 290
128 3300031712 Ga0265342_10002698 Ga0265342_100026984 290
129 3300035086 Ga0373934_0050746 Ga0373934_0050746_217_1152 290
130 3300035691 Ga0373931_0007350 Ga0373931_0007350_3337_4209 290
131 3300035692 Ga0373935_0449846 Ga0373935_0449846_28_900 290
132 3300036401 Ga0373937_0064903 Ga0373937_0064903_467_1402 290
133 3300037068 Ga0373925_0136792 Ga0373925_0136792_23_895 290
134 3300049742 Ga0501080_0001970 Ga0501080_0001970_6523_7431 290
135 3300050512 nmdc:mga0n895_125415_c1 nmdc:mga0n895_125415_c1_698_1570 290
136 3300050513 nmdc:mga0rr50_87258_c1 nmdc:mga0rr50_87258_c1_1321_2262 290
137 3300050514 nmdc:mga08x19_54_c1 nmdc:mga08x19_54_c1_95963_96904 290
138 3300005336 Ga0070680_100000317 Ga0070680_10000031712 291
139 3300005341 Ga0070691_10000033 Ga0070691_1000003324 291
140 3300005434 Ga0070709_10056457 Ga0070709_100564572 291
141 3300005439 Ga0070711_100152296 Ga0070711_1001522962 291
142 3300005458 Ga0070681_10000002 Ga0070681_10000002624 291
143 3300005458 Ga0070681_10132265 Ga0070681_101322654 291
144 3300005530 Ga0070679_100001275 Ga0070679_10000127512 291
145 3300005539 Ga0068853_100001647 Ga0068853_10000164717 291
146 3300005545 Ga0070695_100008582 Ga0070695_1000085823 291
147 3300005547 Ga0070693_100098657 Ga0070693_1000986572 291
148 3300005577 Ga0068857_100002650 Ga0068857_10000265012 291
149 3300005614 Ga0068856_100001370 Ga0068856_1000013707 291
150 3300005616 Ga0068852_100008577 Ga0068852_1000085772 291
151 3300006237 Ga0097621_100282710 Ga0097621_1002827102 291
152 3300006871 Ga0075434_100040351 Ga0075434_1000403515 291
153 3300006914 Ga0075436_100005635 Ga0075436_1000056358 291
154 3300007076 Ga0075435_100060033 Ga0075435_1000600333 291
155 3300009093 Ga0105240_10001363 Ga0105240_1000136328 291
156 3300009174 Ga0105241_10002297 Ga0105241_1000229715 291
157 3300009545 Ga0105237_10000746 Ga0105237_1000074624 291
158 3300009551 Ga0105238_10007767 Ga0105238_1000776711 291
159 3300010375 Ga0105239_10002420 Ga0105239_1000242022 291
160 3300010375 Ga0105239_10069089 Ga0105239_100690893 291
161 3300013100 Ga0157373_10001483 Ga0157373_100014836 291
162 3300013104 Ga0157370_10000753 Ga0157370_1000075330 291
163 3300013105 Ga0157369_10002018 Ga0157369_1000201813 291
164 3300013105 Ga0157369_10202507 Ga0157369_102025073 291
165 3300013296 Ga0157374_10055603 Ga0157374_100556033 291
166 3300013307 Ga0157372_10007018 Ga0157372_100070182 291
167 3300014968 Ga0157379_10002050 Ga0157379_100020503 291
168 3300025912 Ga0207707_10000002 Ga0207707_10000002334 291
169 3300025912 Ga0207707_10511061 Ga0207707_105110612 291
170 3300025913 Ga0207695_10016474 Ga0207695_100164746 291
171 3300025914 Ga0207671_10019446 Ga0207671_100194466 291
172 3300025917 Ga0207660_10001134 Ga0207660_100011346 291
173 3300025921 Ga0207652_10003391 Ga0207652_1000339116 291
174 3300025924 Ga0207694_10040540 Ga0207694_100405404 291
175 3300025949 Ga0207667_10004609 Ga0207667_1000460916 291
176 3300025981 Ga0207640_10022564 Ga0207640_100225642 291
177 3300026078 Ga0207702_10002168 Ga0207702_1000216818 291
178 3300026116 Ga0207674_10000134 Ga0207674_1000013463 291
179 3300026142 Ga0207698_10424764 Ga0207698_104247642 291
180 3300028800 Ga0265338_10009825 Ga0265338_100098254 291
181 3300031247 Ga0265340_10003329 Ga0265340_100033299 291
182 3300031711 Ga0265314_10060222 Ga0265314_100602224 291
183 3300046477 Ga0495664_0010262 Ga0495664_0010262_3747_4622 291
184 3300046543 Ga0495645_0061987 Ga0495645_0061987_1085_1960 291
185 3300048918 Ga0496115_0098501 Ga0496115_0098501_998_1873 291
186 3300049568 Ga0501031_0035735 Ga0501031_0035735_1217_2092 291
187 3300049569 Ga0501032_0023810 Ga0501032_0023810_2623_3498 291
188 3300049571 Ga0501034_0012731 Ga0501034_0012731_4730_5605 291
189 3300049573 Ga0501037_0109240 Ga0501037_0109240_571_1446 291
190 3300049581 Ga0501047_0002217 Ga0501047_0002217_4912_5787 291
191 3300049582 Ga0501048_0048231 Ga0501048_0048231_1200_2075 291
192 3300049583 Ga0501067_0000181 Ga0501067_0000181_10604_11479 291
193 3300049585 Ga0501069_0001060 Ga0501069_0001060_4185_5060 291
194 3300049586 Ga0501070_0007717 Ga0501070_0007717_2681_3556 291
195 3300049588 Ga0501072_0011727 Ga0501072_0011727_5541_6416 291
196 3300049589 Ga0501073_0004754 Ga0501073_0004754_1186_2061 291
197 3300049589 Ga0501073_0024036 Ga0501073_0024036_715_1590 291
198 3300049589 Ga0501073_0127498 Ga0501073_0127498_495_1370 291
199 3300049590 Ga0501074_0009511 Ga0501074_0009511_1150_2025 291
200 3300049741 Ga0501079_0001647 Ga0501079_0001647_12540_13415 291
201 3300049741 Ga0501079_0133547 Ga0501079_0133547_851_1726 291
202 3300049742 Ga0501080_0041628 Ga0501080_0041628_232_1107 291
203 3300049744 Ga0501083_0034156 Ga0501083_0034156_1833_2708 291
204 3300049822 Ga0501035_0005635 Ga0501035_0005635_1329_2204 291
205 3300049823 Ga0501044_0014583 Ga0501044_0014583_6887_7762 291
206 3300050512 nmdc:mga0n895_79713_c1 nmdc:mga0n895_79713_c1_2168_3043 291
207 3300050513 nmdc:mga0rr50_80846_c1 nmdc:mga0rr50_80846_c1_870_1745 291
208 3300050514 nmdc:mga08x19_19516_c1 nmdc:mga08x19_19516_c1_2323_3198 291
209 3300054114 Ga0501084_0001715 Ga0501084_0001715_11255_12130 291
210 3300054114 Ga0501084_0003677 Ga0501084_0003677_483_1358 291
211 3300005436 Ga0070713_100049354 Ga0070713_1000493543 292
212 3300005439 Ga0070711_100007954 Ga0070711_1000079546 292
213 3300006175 Ga0070712_100001086 Ga0070712_10000108616 292
214 3300009177 Ga0105248_10049367 Ga0105248_100493674 292
215 3300014968 Ga0157379_10016532 Ga0157379_100165323 292
216 3300025915 Ga0207693_10000534 Ga0207693_1000053434 292
217 3300025941 Ga0207711_10008576 Ga0207711_100085765 292
218 3300031240 Ga0265320_10000628 Ga0265320_1000062813 292
219 3300031241 Ga0265325_10000365 Ga0265325_1000036532 292
220 3300031241 Ga0265325_10001964 Ga0265325_100019642 292
221 3300031247 Ga0265340_10012272 Ga0265340_100122723 292
222 3300031249 Ga0265339_10003492 Ga0265339_100034925 292
223 3300031344 Ga0265316_10061901 Ga0265316_100619011 292
224 3300031595 Ga0265313_10002198 Ga0265313_1000219810 292
225 3300031595 Ga0265313_10107214 Ga0265313_101072142 292
226 3300031712 Ga0265342_10038097 Ga0265342_100380973 292
227 3300035083 Ga0373926_0062835 Ga0373926_0062835_229_1110 292
228 3300035724 Ga0373933_0030310 Ga0373933_0030310_2133_3014 292
229 3300036401 Ga0373937_0000880 Ga0373937_0000880_24780_25661 292
230 3300048904 Ga0496101_0093498 Ga0496101_0093498_131_1012 292
231 3300048913 Ga0496110_0284859 Ga0496110_0284859_379_1260 292
232 3300048915 Ga0496112_0311512 Ga0496112_0311512_123_1004 292
233 3300005344 Ga0070661_100020592 Ga0070661_1000205927 293
234 3300005539 Ga0068853_100102006 Ga0068853_1001020064 293
235 3300005563 Ga0068855_100000069 Ga0068855_10000006985 293
236 3300005616 Ga0068852_100036719 Ga0068852_1000367192 293
237 3300009093 Ga0105240_10000055 Ga0105240_10000055128 293
238 3300009176 Ga0105242_10144458 Ga0105242_101444582 293
239 3300009545 Ga0105237_10600465 Ga0105237_106004651 293
240 3300009551 Ga0105238_10040779 Ga0105238_100407794 293
241 3300010375 Ga0105239_10000716 Ga0105239_1000071624 293
242 3300013105 Ga0157369_10005371 Ga0157369_100053719 293
243 3300013105 Ga0157369_10129518 Ga0157369_101295183 293
244 3300014968 Ga0157379_10001588 Ga0157379_1000158813 293
245 3300025913 Ga0207695_10000012 Ga0207695_10000012209 293
246 3300025920 Ga0207649_10012415 Ga0207649_100124151 293
247 3300025924 Ga0207694_10000006 Ga0207694_10000006454 293
248 3300025934 Ga0207686_10151528 Ga0207686_101515283 293
249 3300025949 Ga0207667_10000026 Ga0207667_10000026183 293
250 3300026041 Ga0207639_10054118 Ga0207639_100541184 293
251 3300026142 Ga0207698_10062058 Ga0207698_100620583 293
252 3300026142 Ga0207698_10523754 Ga0207698_105237542 293
253 3300031250 Ga0265331_10000008 Ga0265331_10000008157 293
254 3300031251 Ga0265327_10000036 Ga0265327_1000003637 293
255 3300031711 Ga0265314_10172134 Ga0265314_101721342 293
256 3300031730 Ga0307516_10129045 Ga0307516_101290452 293
257 3300046477 Ga0495664_0059660 Ga0495664_0059660_639_1520 293
258 3300049460 Ga0495682_0002321 Ga0495682_0002321_7570_8538 293
259 3300049571 Ga0501034_0136942 Ga0501034_0136942_1498_2385 293
260 3300049574 Ga0501038_0029315 Ga0501038_0029315_925_1812 293
261 3300049575 Ga0501039_0069971 Ga0501039_0069971_1353_2297 293
262 3300049579 Ga0501043_0029940 Ga0501043_0029940_698_1585 293
263 3300049581 Ga0501047_0151084 Ga0501047_0151084_1035_1922 293
264 3300049581 Ga0501047_0252795 Ga0501047_0252795_712_1599 293
265 3300049583 Ga0501067_0153990 Ga0501067_0153990_367_1254 293
266 3300049586 Ga0501070_0016647 Ga0501070_0016647_4137_5081 293
267 3300049590 Ga0501074_0093635 Ga0501074_0093635_1197_2141 293
268 3300049742 Ga0501080_0056242 Ga0501080_0056242_711_1598 293
269 3300049822 Ga0501035_0125154 Ga0501035_0125154_1136_2023 293
270 3300049823 Ga0501044_0181758 Ga0501044_0181758_954_1841 293
271 3300005344 Ga0070661_100000254 Ga0070661_10000025416 294
272 3300013104 Ga0157370_10096241 Ga0157370_100962412 294
273 3300025920 Ga0207649_10000026 Ga0207649_1000002636 294
274 3300031241 Ga0265325_10023697 Ga0265325_100236972 294
275 3300031249 Ga0265339_10013804 Ga0265339_100138047 294
276 3300031250 Ga0265331_10000067 Ga0265331_1000006719 294
277 3300031711 Ga0265314_10002040 Ga0265314_1000204011 294
278 3300031711 Ga0265314_10047212 Ga0265314_100472122 294
279 3300039437 Ga0436365_1513507 Ga0436365_1513507_3167_4051 294
280 3300049580 Ga0501046_0056903 Ga0501046_0056903_1592_2533 294
281 3300003320 rootH2_10001888 rootH2_100018886 296
282 3300005327 Ga0070658_10038887 Ga0070658_100388872 296
283 3300005341 Ga0070691_10003543 Ga0070691_100035434 296
284 3300005366 Ga0070659_100023118 Ga0070659_1000231184 296
285 3300005563 Ga0068855_100005915 Ga0068855_10000591517 296
286 3300005578 Ga0068854_100143734 Ga0068854_1001437342 296
287 3300009551 Ga0105238_10049009 Ga0105238_100490092 296
288 3300013100 Ga0157373_10086632 Ga0157373_100866322 296
289 3300013104 Ga0157370_10011069 Ga0157370_100110698 296
290 3300013307 Ga0157372_10048709 Ga0157372_100487092 296
291 3300025909 Ga0207705_10000105 Ga0207705_100001058 296
292 3300025912 Ga0207707_10002912 Ga0207707_100029126 296
293 3300025917 Ga0207660_10000814 Ga0207660_1000081417 296
294 3300025919 Ga0207657_10000154 Ga0207657_1000015452 296
295 3300025921 Ga0207652_10001371 Ga0207652_1000137113 296
296 3300025932 Ga0207690_10035537 Ga0207690_100355372 296
297 3300025949 Ga0207667_10031722 Ga0207667_100317225 296
298 3300025981 Ga0207640_10062830 Ga0207640_100628303 296
299 3300031235 Ga0265330_10008539 Ga0265330_100085396 296
300 3300031235 Ga0265330_10060847 Ga0265330_100608472 296
301 3300031247 Ga0265340_10000018 Ga0265340_1000001841 296
302 3300031249 Ga0265339_10055941 Ga0265339_100559412 296
303 3300031344 Ga0265316_10003597 Ga0265316_1000359719 296
304 3300031344 Ga0265316_10020000 Ga0265316_100200008 296
305 3300031344 Ga0265316_10212093 Ga0265316_102120932 296
306 3300031595 Ga0265313_10057555 Ga0265313_100575552 296
307 3300031711 Ga0265314_10155204 Ga0265314_101552042 296
308 3300031712 Ga0265342_10023816 Ga0265342_100238163 296
309 3300031712 Ga0265342_10101755 Ga0265342_101017552 296
310 3300049568 Ga0501031_0007007 Ga0501031_0007007_2719_3609 296
311 3300049569 Ga0501032_0291400 Ga0501032_0291400_136_1026 296
312 3300049573 Ga0501037_0022800 Ga0501037_0022800_3387_4277 296
313 3300049573 Ga0501037_0092295 Ga0501037_0092295_504_1394 296
314 3300049574 Ga0501038_0063322 Ga0501038_0063322_207_1097 296
315 3300049574 Ga0501038_0358617 Ga0501038_0358617_205_1095 296
316 3300049579 Ga0501043_0134575 Ga0501043_0134575_955_1845 296
317 3300049581 Ga0501047_0258583 Ga0501047_0258583_512_1402 296
318 3300049586 Ga0501070_0001145 Ga0501070_0001145_14340_15230 296
319 3300049590 Ga0501074_0344739 Ga0501074_0344739_130_1020 296
320 3300049742 Ga0501080_0002886 Ga0501080_0002886_7246_8136 296
321 3300049822 Ga0501035_0001106 Ga0501035_0001106_12485_13375 296
322 3300049823 Ga0501044_0001448 Ga0501044_0001448_3775_4665 296
323 3300049823 Ga0501044_0117981 Ga0501044_0117981_828_1718 296
324 3300049823 Ga0501044_0293895 Ga0501044_0293895_268_1158 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

239

319

0.98

PF12833

HTH_18

Helix-turn-helix domain

75

153

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

50

102

0.89

Feature Viewer

pLDDT pTM Quality
66.83 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map