F407433
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 324 | 179 | 324 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300031240|Ga0265320_10000628|Ga0265320_1000062813 |
| Length | 331 |
| Sequence | MAGFMPAMTIRWISVKSSQTRARKKRVEKAGAKGHLGPMSNVISFDENDSNWRRMGRAIRFLSANYLDQPRLEDAADAVGLSSFHFQRLFTRYVGVSPKHFVGHLTLGHAKGSLLEGKSLLETAFDVGLSGSSRLHDLCLKIEAMTPGEYAKGGEGLAIEYGFHGCPFGIALVMATPKGVCGLAFGDEGEETAMLNDMRARWPKARFVAAPERTAKLAAAIFTPRKPDTDLRLHLLGTPFQVKVWQALLAIPEGKLSTYGALAAHLGREGASRAVGAAVGRNPISWIIPCHRVLASDGALRGYHWGLERKRAMLAVEAARQSQRPSTSAIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 123 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 129 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 130 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 149 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.54 |
| Rhizosphere | 96.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10001888 | 3300003320 | Bacteria | 9122 |
| 2 | rootH2_10208059 | 3300003320 | Bacteria | 1780 |
| 3 | Ga0070658_10038887 | 3300005327 | Bacteria | 3837 |
| 4 | Ga0070677_10000714 | 3300005333 | Bacteria | 11144 |
| 5 | Ga0068869_100094071 | 3300005334 | Unclassified | 2259 |
| 6 | Ga0070666_10000309 | 3300005335 | Bacteria | 31703 |
| 7 | Ga0070680_100000317 | 3300005336 | Bacteria | 32367 |
| 8 | Ga0070682_100106333 | 3300005337 | Unclassified | 1862 |
| 9 | Ga0070691_10000033 | 3300005341 | Bacteria | 39121 |
| 10 | Ga0070691_10003543 | 3300005341 | Bacteria | 7040 |
| 11 | Ga0070661_100000254 | 3300005344 | Bacteria | 43578 |
| 12 | Ga0070661_100020592 | 3300005344 | Bacteria | 4706 |
| 13 | Ga0070661_100103926 | 3300005344 | Bacteria | 2116 |
| 14 | Ga0070668_100443755 | 3300005347 | Bacteria | 1114 |
| 15 | Ga0070675_100001032 | 3300005354 | Bacteria | 20035 |
| 16 | Ga0070671_100245470 | 3300005355 | Unclassified | 1520 |
| 17 | Ga0070674_100085534 | 3300005356 | Unclassified | 2263 |
| 18 | Ga0070673_100021761 | 3300005364 | Bacteria | 4657 |
| 19 | Ga0070673_100048600 | 3300005364 | Bacteria | 3308 |
| 20 | Ga0070659_100023118 | 3300005366 | Bacteria | 4753 |
| 21 | Ga0070667_100030619 | 3300005367 | Bacteria | 4488 |
| 22 | Ga0070667_100262502 | 3300005367 | Unclassified | 1547 |
| 23 | Ga0070709_10000179 | 3300005434 | Bacteria | 40240 |
| 24 | Ga0070709_10056457 | 3300005434 | Bacteria | 2483 |
| 25 | Ga0070714_100016053 | 3300005435 | Bacteria | 6037 |
| 26 | Ga0070714_100045963 | 3300005435 | Bacteria | 3702 |
| 27 | Ga0070713_100000011 | 3300005436 | Bacteria | 146314 |
| 28 | Ga0070713_100049354 | 3300005436 | Bacteria | 3472 |
| 29 | Ga0070711_100007954 | 3300005439 | Bacteria | 6465 |
| 30 | Ga0070711_100152296 | 3300005439 | Bacteria | 1745 |
| 31 | Ga0070700_100119033 | 3300005441 | Bacteria | 1767 |
| 32 | Ga0070678_100076910 | 3300005456 | Unclassified | 2516 |
| 33 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 34 | Ga0070681_10132265 | 3300005458 | Bacteria | 2427 |
| 35 | Ga0070679_100001275 | 3300005530 | Bacteria | 22239 |
| 36 | Ga0068853_100001110 | 3300005539 | Bacteria | 19059 |
| 37 | Ga0068853_100001647 | 3300005539 | Bacteria | 16330 |
| 38 | Ga0068853_100102006 | 3300005539 | Bacteria | 2539 |
| 39 | Ga0070695_100008582 | 3300005545 | Bacteria | 6070 |
| 40 | Ga0070693_100098657 | 3300005547 | Bacteria | 1776 |
| 41 | Ga0070665_100273482 | 3300005548 | Bacteria | 1691 |
| 42 | Ga0068855_100000069 | 3300005563 | Bacteria | 124154 |
| 43 | Ga0068855_100005915 | 3300005563 | Bacteria | 14914 |
| 44 | Ga0070664_100267900 | 3300005564 | Unclassified | 1538 |
| 45 | Ga0068857_100002650 | 3300005577 | Bacteria | 14696 |
| 46 | Ga0068854_100143734 | 3300005578 | Bacteria | 1833 |
| 47 | Ga0068856_100001370 | 3300005614 | Bacteria | 25638 |
| 48 | Ga0068856_100001593 | 3300005614 | Bacteria | 23711 |
| 49 | Ga0068852_100008577 | 3300005616 | Bacteria | 7540 |
| 50 | Ga0068852_100036719 | 3300005616 | Bacteria | 4103 |
| 51 | Ga0068852_100087431 | 3300005616 | Bacteria | 2781 |
| 52 | Ga0068859_100639512 | 3300005617 | Unclassified | 1156 |
| 53 | Ga0068864_100202946 | 3300005618 | Bacteria | 1822 |
| 54 | Ga0068861_100043324 | 3300005719 | Bacteria | 3378 |
| 55 | Ga0068870_10010870 | 3300005840 | Bacteria | 4199 |
| 56 | Ga0068863_100122730 | 3300005841 | Bacteria | 2478 |
| 57 | Ga0068863_100124652 | 3300005841 | Bacteria | 2457 |
| 58 | Ga0070717_10260550 | 3300006028 | Bacteria | 1534 |
| 59 | Ga0070712_100000023 | 3300006175 | Bacteria | 80972 |
| 60 | Ga0070712_100001086 | 3300006175 | Bacteria | 16374 |
| 61 | Ga0097621_100123233 | 3300006237 | Bacteria | 2200 |
| 62 | Ga0097621_100282710 | 3300006237 | Bacteria | 1461 |
| 63 | Ga0075434_100040351 | 3300006871 | Bacteria | 4622 |
| 64 | Ga0075436_100000276 | 3300006914 | Bacteria | 32410 |
| 65 | Ga0075436_100005635 | 3300006914 | Bacteria | 8593 |
| 66 | Ga0097620_100639547 | 3300006931 | Unclassified | 1156 |
| 67 | Ga0075435_100031595 | 3300007076 | Bacteria | 4173 |
| 68 | Ga0075435_100060033 | 3300007076 | Bacteria | 3083 |
| 69 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 70 | Ga0105240_10001363 | 3300009093 | Bacteria | 41954 |
| 71 | Ga0105240_10129331 | 3300009093 | Bacteria | 3030 |
| 72 | Ga0105247_10266998 | 3300009101 | Unclassified | 1175 |
| 73 | Ga0105241_10002297 | 3300009174 | Bacteria | 14366 |
| 74 | Ga0105242_10041936 | 3300009176 | Bacteria | 3693 |
| 75 | Ga0105242_10144458 | 3300009176 | Bacteria | 2068 |
| 76 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 77 | Ga0105248_10049367 | 3300009177 | Bacteria | 4720 |
| 78 | Ga0105248_10087663 | 3300009177 | Unclassified | 3503 |
| 79 | Ga0105237_10000746 | 3300009545 | Bacteria | 44835 |
| 80 | Ga0105237_10600465 | 3300009545 | Bacteria | 1108 |
| 81 | Ga0105238_10007767 | 3300009551 | Bacteria | 10725 |
| 82 | Ga0105238_10040779 | 3300009551 | Bacteria | 4703 |
| 83 | Ga0105238_10049009 | 3300009551 | Bacteria | 4255 |
| 84 | Ga0105239_10000716 | 3300010375 | Bacteria | 47033 |
| 85 | Ga0105239_10002420 | 3300010375 | Bacteria | 23767 |
| 86 | Ga0105239_10069089 | 3300010375 | Bacteria | 3882 |
| 87 | Ga0157373_10001483 | 3300013100 | Bacteria | 17886 |
| 88 | Ga0157373_10086632 | 3300013100 | Bacteria | 2207 |
| 89 | Ga0157370_10000753 | 3300013104 | Bacteria | 40426 |
| 90 | Ga0157370_10011069 | 3300013104 | Bacteria | 9455 |
| 91 | Ga0157370_10096241 | 3300013104 | Bacteria | 2778 |
| 92 | Ga0157369_10002018 | 3300013105 | Bacteria | 24475 |
| 93 | Ga0157369_10005371 | 3300013105 | Bacteria | 14918 |
| 94 | Ga0157369_10129518 | 3300013105 | Bacteria | 2674 |
| 95 | Ga0157369_10202507 | 3300013105 | Bacteria | 2083 |
| 96 | Ga0157374_10055603 | 3300013296 | Bacteria | 3694 |
| 97 | Ga0157374_10377520 | 3300013296 | Unclassified | 1412 |
| 98 | Ga0157378_10690481 | 3300013297 | Bacteria | 1039 |
| 99 | Ga0163162_10051325 | 3300013306 | Bacteria | 4138 |
| 100 | Ga0157372_10007018 | 3300013307 | Bacteria | 11995 |
| 101 | Ga0157372_10048709 | 3300013307 | Bacteria | 4710 |
| 102 | Ga0163163_10237668 | 3300014325 | Bacteria | 1871 |
| 103 | Ga0157379_10001588 | 3300014968 | Bacteria | 18738 |
| 104 | Ga0157379_10002050 | 3300014968 | Bacteria | 16740 |
| 105 | Ga0157379_10016532 | 3300014968 | Bacteria | 6490 |
| 106 | Ga0157379_10036941 | 3300014968 | Bacteria | 4355 |
| 107 | Ga0163161_10324223 | 3300017792 | Bacteria | 1218 |
| 108 | Ga0207682_10001837 | 3300025893 | Bacteria | 9666 |
| 109 | Ga0207682_10002748 | 3300025893 | Bacteria | 7793 |
| 110 | Ga0207680_10001895 | 3300025903 | Bacteria | 9817 |
| 111 | Ga0207699_10000758 | 3300025906 | Bacteria | 15441 |
| 112 | Ga0207699_10058775 | 3300025906 | Bacteria | 2302 |
| 113 | Ga0207645_10189927 | 3300025907 | Bacteria | 1350 |
| 114 | Ga0207643_10002188 | 3300025908 | Bacteria | 10660 |
| 115 | Ga0207705_10000105 | 3300025909 | Bacteria | 95742 |
| 116 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 117 | Ga0207707_10002912 | 3300025912 | Bacteria | 15271 |
| 118 | Ga0207707_10511061 | 3300025912 | Bacteria | 1024 |
| 119 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 120 | Ga0207695_10016474 | 3300025913 | Bacteria | 8643 |
| 121 | Ga0207671_10019446 | 3300025914 | Bacteria | 5192 |
| 122 | Ga0207693_10000018 | 3300025915 | Bacteria | 138365 |
| 123 | Ga0207693_10000534 | 3300025915 | Bacteria | 34415 |
| 124 | Ga0207660_10000814 | 3300025917 | Bacteria | 20597 |
| 125 | Ga0207660_10001134 | 3300025917 | Bacteria | 17804 |
| 126 | Ga0207657_10000154 | 3300025919 | Bacteria | 70197 |
| 127 | Ga0207649_10000026 | 3300025920 | Bacteria | 177395 |
| 128 | Ga0207649_10012415 | 3300025920 | Bacteria | 4726 |
| 129 | Ga0207652_10001371 | 3300025921 | Bacteria | 21659 |
| 130 | Ga0207652_10003391 | 3300025921 | Bacteria | 13158 |
| 131 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 132 | Ga0207694_10040540 | 3300025924 | Bacteria | 3585 |
| 133 | Ga0207650_10020067 | 3300025925 | Bacteria | 4708 |
| 134 | Ga0207659_10028208 | 3300025926 | Bacteria | 3812 |
| 135 | Ga0207700_10000026 | 3300025928 | Bacteria | 139690 |
| 136 | Ga0207664_10005160 | 3300025929 | Bacteria | 8901 |
| 137 | Ga0207664_10072706 | 3300025929 | Bacteria | 2773 |
| 138 | Ga0207644_10441770 | 3300025931 | Unclassified | 1068 |
| 139 | Ga0207690_10035537 | 3300025932 | Bacteria | 3219 |
| 140 | Ga0207686_10065982 | 3300025934 | Unclassified | 2310 |
| 141 | Ga0207686_10151528 | 3300025934 | Bacteria | 1615 |
| 142 | Ga0207670_10220790 | 3300025936 | Bacteria | 1450 |
| 143 | Ga0207669_10014672 | 3300025937 | Bacteria | 3933 |
| 144 | Ga0207669_10064541 | 3300025937 | Bacteria | 2266 |
| 145 | Ga0207704_10026074 | 3300025938 | Bacteria | 3201 |
| 146 | Ga0207691_10004516 | 3300025940 | Bacteria | 13459 |
| 147 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 148 | Ga0207711_10008576 | 3300025941 | Bacteria | 8549 |
| 149 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 150 | Ga0207667_10004609 | 3300025949 | Bacteria | 16905 |
| 151 | Ga0207667_10031722 | 3300025949 | Bacteria | 5702 |
| 152 | Ga0207651_10005462 | 3300025960 | Bacteria | 6529 |
| 153 | Ga0207668_10047647 | 3300025972 | Unclassified | 2936 |
| 154 | Ga0207640_10022564 | 3300025981 | Bacteria | 3770 |
| 155 | Ga0207640_10062830 | 3300025981 | Bacteria | 2465 |
| 156 | Ga0207658_10068961 | 3300025986 | Bacteria | 2670 |
| 157 | Ga0207658_10440142 | 3300025986 | Unclassified | 1152 |
| 158 | Ga0207639_10001144 | 3300026041 | Bacteria | 18042 |
| 159 | Ga0207639_10054118 | 3300026041 | Bacteria | 3066 |
| 160 | Ga0207708_10044875 | 3300026075 | Bacteria | 3368 |
| 161 | Ga0207702_10000592 | 3300026078 | Bacteria | 40068 |
| 162 | Ga0207702_10002168 | 3300026078 | Bacteria | 18833 |
| 163 | Ga0207641_10069386 | 3300026088 | Bacteria | 3026 |
| 164 | Ga0207674_10000134 | 3300026116 | Bacteria | 86377 |
| 165 | Ga0207675_100035623 | 3300026118 | Bacteria | 4642 |
| 166 | Ga0207683_10008135 | 3300026121 | Bacteria | 8970 |
| 167 | Ga0207698_10062058 | 3300026142 | Bacteria | 2916 |
| 168 | Ga0207698_10424764 | 3300026142 | Bacteria | 1276 |
| 169 | Ga0207698_10523754 | 3300026142 | Bacteria | 1157 |
| 170 | Ga0265334_10007944 | 3300028573 | Bacteria | 4534 |
| 171 | Ga0265318_10000172 | 3300028577 | Bacteria | 57357 |
| 172 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 173 | Ga0265338_10009825 | 3300028800 | Bacteria | 11342 |
| 174 | Ga0265338_10049968 | 3300028800 | Bacteria | 3784 |
| 175 | Ga0265330_10008539 | 3300031235 | Bacteria | 4927 |
| 176 | Ga0265330_10060847 | 3300031235 | Bacteria | 1643 |
| 177 | Ga0265332_10029435 | 3300031238 | Bacteria | 2401 |
| 178 | Ga0265320_10000628 | 3300031240 | Bacteria | 27016 |
| 179 | Ga0265325_10000009 | 3300031241 | Bacteria | 184273 |
| 180 | Ga0265325_10000365 | 3300031241 | Bacteria | 31743 |
| 181 | Ga0265325_10001964 | 3300031241 | Bacteria | 14172 |
| 182 | Ga0265325_10023697 | 3300031241 | Bacteria | 3346 |
| 183 | Ga0265329_10046668 | 3300031242 | Bacteria | 1384 |
| 184 | Ga0265340_10000018 | 3300031247 | Bacteria | 90851 |
| 185 | Ga0265340_10000261 | 3300031247 | Bacteria | 27331 |
| 186 | Ga0265340_10003329 | 3300031247 | Bacteria | 9105 |
| 187 | Ga0265340_10012272 | 3300031247 | Bacteria | 4527 |
| 188 | Ga0265339_10000271 | 3300031249 | Bacteria | 41827 |
| 189 | Ga0265339_10003492 | 3300031249 | Bacteria | 10991 |
| 190 | Ga0265339_10013804 | 3300031249 | Bacteria | 4888 |
| 191 | Ga0265339_10026769 | 3300031249 | Bacteria | 3300 |
| 192 | Ga0265339_10055941 | 3300031249 | Bacteria | 2138 |
| 193 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 194 | Ga0265331_10000067 | 3300031250 | Bacteria | 158073 |
| 195 | Ga0265331_10000722 | 3300031250 | Bacteria | 27993 |
| 196 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 197 | Ga0265316_10003597 | 3300031344 | Bacteria | 15622 |
| 198 | Ga0265316_10020000 | 3300031344 | Bacteria | 5710 |
| 199 | Ga0265316_10042693 | 3300031344 | Bacteria | 3622 |
| 200 | Ga0265316_10061901 | 3300031344 | Bacteria | 2905 |
| 201 | Ga0265316_10212093 | 3300031344 | Bacteria | 1432 |
| 202 | Ga0307513_10011270 | 3300031456 | Bacteria | 11127 |
| 203 | Ga0307513_10029194 | 3300031456 | Bacteria | 6291 |
| 204 | Ga0265313_10000620 | 3300031595 | Bacteria | 36725 |
| 205 | Ga0265313_10002198 | 3300031595 | Bacteria | 17259 |
| 206 | Ga0265313_10057555 | 3300031595 | Bacteria | 1834 |
| 207 | Ga0265313_10089783 | 3300031595 | Bacteria | 1382 |
| 208 | Ga0265313_10107214 | 3300031595 | Bacteria | 1232 |
| 209 | Ga0265314_10002040 | 3300031711 | Bacteria | 21393 |
| 210 | Ga0265314_10004079 | 3300031711 | Bacteria | 13774 |
| 211 | Ga0265314_10047212 | 3300031711 | Bacteria | 3032 |
| 212 | Ga0265314_10051534 | 3300031711 | Bacteria | 2866 |
| 213 | Ga0265314_10060222 | 3300031711 | Bacteria | 2592 |
| 214 | Ga0265314_10155204 | 3300031711 | Unclassified | 1399 |
| 215 | Ga0265314_10172134 | 3300031711 | Bacteria | 1306 |
| 216 | Ga0265342_10002698 | 3300031712 | Bacteria | 15108 |
| 217 | Ga0265342_10016420 | 3300031712 | Bacteria | 4840 |
| 218 | Ga0265342_10023816 | 3300031712 | Bacteria | 3869 |
| 219 | Ga0265342_10038097 | 3300031712 | Bacteria | 2930 |
| 220 | Ga0265342_10101755 | 3300031712 | Bacteria | 1635 |
| 221 | Ga0316576_10055491 | 3300031727 | Bacteria | 2892 |
| 222 | Ga0316576_10057231 | 3300031727 | Unclassified | 2849 |
| 223 | Ga0307516_10129045 | 3300031730 | Bacteria | 2310 |
| 224 | Ga0307413_10020616 | 3300031824 | Bacteria | 3510 |
| 225 | Ga0307410_10031414 | 3300031852 | Bacteria | 3407 |
| 226 | Ga0307407_10015415 | 3300031903 | Bacteria | 3777 |
| 227 | Ga0307409_100277738 | 3300031995 | Unclassified | 1546 |
| 228 | Ga0316580_10040098 | 3300032139 | Bacteria | 1447 |
| 229 | Ga0373926_0062835 | 3300035083 | Bacteria | 1356 |
| 230 | Ga0373934_0050746 | 3300035086 | Bacteria | 1644 |
| 231 | Ga0373943_0328953 | 3300035170 | Unclassified | 872 |
| 232 | Ga0373955_0298725 | 3300035172 | Unclassified | 971 |
| 233 | Ga0316574_0251967 | 3300035398 | Bacteria | 1128 |
| 234 | Ga0373931_0007350 | 3300035691 | Bacteria | 5185 |
| 235 | Ga0373935_0449846 | 3300035692 | Bacteria | 930 |
| 236 | Ga0373933_0030310 | 3300035724 | Bacteria | 3132 |
| 237 | Ga0373933_0055321 | 3300035724 | Bacteria | 2380 |
| 238 | Ga0373937_0000880 | 3300036401 | Bacteria | 25714 |
| 239 | Ga0373937_0003753 | 3300036401 | Bacteria | 12834 |
| 240 | Ga0373937_0064903 | 3300036401 | Bacteria | 3359 |
| 241 | Ga0373937_0137436 | 3300036401 | Bacteria | 2285 |
| 242 | Ga0373937_0196048 | 3300036401 | Bacteria | 1898 |
| 243 | Ga0316584_0055993 | 3300036712 | Bacteria | 2952 |
| 244 | Ga0373925_0136792 | 3300037068 | Bacteria | 1915 |
| 245 | Ga0436365_1115723 | 3300039437 | Bacteria | 1620 |
| 246 | Ga0436365_1513507 | 3300039437 | Bacteria | 68714 |
| 247 | Ga0495664_0010262 | 3300046477 | Bacteria | 5255 |
| 248 | Ga0495664_0059660 | 3300046477 | Bacteria | 2271 |
| 249 | Ga0495645_0061987 | 3300046543 | Bacteria | 2709 |
| 250 | Ga0495649_0163966 | 3300046694 | Bacteria | 1165 |
| 251 | Ga0496101_0093498 | 3300048904 | Bacteria | 2240 |
| 252 | Ga0496106_0407006 | 3300048909 | Bacteria | 1093 |
| 253 | Ga0496110_0284859 | 3300048913 | Bacteria | 1505 |
| 254 | Ga0496112_0311512 | 3300048915 | Bacteria | 1519 |
| 255 | Ga0496115_0098501 | 3300048918 | Bacteria | 2395 |
| 256 | Ga0495682_0002321 | 3300049460 | Bacteria | 9049 |
| 257 | Ga0501031_0007007 | 3300049568 | Bacteria | 7359 |
| 258 | Ga0501031_0035735 | 3300049568 | Bacteria | 3242 |
| 259 | Ga0501032_0023810 | 3300049569 | Bacteria | 4228 |
| 260 | Ga0501032_0291400 | 3300049569 | Bacteria | 1056 |
| 261 | Ga0501034_0012731 | 3300049571 | Bacteria | 8677 |
| 262 | Ga0501034_0136942 | 3300049571 | Bacteria | 2429 |
| 263 | Ga0501037_0022800 | 3300049573 | Bacteria | 4629 |
| 264 | Ga0501037_0092295 | 3300049573 | Bacteria | 2190 |
| 265 | Ga0501037_0109240 | 3300049573 | Unclassified | 1993 |
| 266 | Ga0501038_0029315 | 3300049574 | Bacteria | 4878 |
| 267 | Ga0501038_0063322 | 3300049574 | Bacteria | 3157 |
| 268 | Ga0501038_0358617 | 3300049574 | Bacteria | 1134 |
| 269 | Ga0501039_0069971 | 3300049575 | Bacteria | 2726 |
| 270 | Ga0501043_0029940 | 3300049579 | Bacteria | 4277 |
| 271 | Ga0501043_0134575 | 3300049579 | Bacteria | 1936 |
| 272 | Ga0501046_0056903 | 3300049580 | Bacteria | 3068 |
| 273 | Ga0501047_0002217 | 3300049581 | Bacteria | 18619 |
| 274 | Ga0501047_0151084 | 3300049581 | Bacteria | 2198 |
| 275 | Ga0501047_0252795 | 3300049581 | Bacteria | 1611 |
| 276 | Ga0501047_0258583 | 3300049581 | Bacteria | 1589 |
| 277 | Ga0501048_0048231 | 3300049582 | Bacteria | 3039 |
| 278 | Ga0501067_0000181 | 3300049583 | Bacteria | 35717 |
| 279 | Ga0501067_0007292 | 3300049583 | Bacteria | 6138 |
| 280 | Ga0501067_0153990 | 3300049583 | Bacteria | 1281 |
| 281 | Ga0501068_0008263 | 3300049584 | Bacteria | 5785 |
| 282 | Ga0501069_0001060 | 3300049585 | Bacteria | 13174 |
| 283 | Ga0501070_0001145 | 3300049586 | Bacteria | 23776 |
| 284 | Ga0501070_0007717 | 3300049586 | Bacteria | 9123 |
| 285 | Ga0501070_0016647 | 3300049586 | Bacteria | 6175 |
| 286 | Ga0501071_0025120 | 3300049587 | Bacteria | 4172 |
| 287 | Ga0501072_0011727 | 3300049588 | Bacteria | 6696 |
| 288 | Ga0501073_0004754 | 3300049589 | Bacteria | 10195 |
| 289 | Ga0501073_0014765 | 3300049589 | Bacteria | 5671 |
| 290 | Ga0501073_0024036 | 3300049589 | Bacteria | 4376 |
| 291 | Ga0501073_0127498 | 3300049589 | Bacteria | 1764 |
| 292 | Ga0501074_0003522 | 3300049590 | Bacteria | 11113 |
| 293 | Ga0501074_0009511 | 3300049590 | Bacteria | 7059 |
| 294 | Ga0501074_0093635 | 3300049590 | Bacteria | 2152 |
| 295 | Ga0501074_0344739 | 3300049590 | Bacteria | 1057 |
| 296 | Ga0501076_0012676 | 3300049592 | Bacteria | 6311 |
| 297 | Ga0501077_0001000 | 3300049593 | Bacteria | 17040 |
| 298 | Ga0501079_0001647 | 3300049741 | Bacteria | 15901 |
| 299 | Ga0501079_0015777 | 3300049741 | Bacteria | 5771 |
| 300 | Ga0501079_0133547 | 3300049741 | Unclassified | 1932 |
| 301 | Ga0501080_0001970 | 3300049742 | Bacteria | 17726 |
| 302 | Ga0501080_0002886 | 3300049742 | Bacteria | 15116 |
| 303 | Ga0501080_0010825 | 3300049742 | Bacteria | 8345 |
| 304 | Ga0501080_0041628 | 3300049742 | Bacteria | 4279 |
| 305 | Ga0501080_0056242 | 3300049742 | Bacteria | 3665 |
| 306 | Ga0501083_0034156 | 3300049744 | Bacteria | 3479 |
| 307 | Ga0501035_0001106 | 3300049822 | Bacteria | 28263 |
| 308 | Ga0501035_0005635 | 3300049822 | Bacteria | 11824 |
| 309 | Ga0501035_0125154 | 3300049822 | Bacteria | 2244 |
| 310 | Ga0501044_0001448 | 3300049823 | Bacteria | 27879 |
| 311 | Ga0501044_0014583 | 3300049823 | Bacteria | 8476 |
| 312 | Ga0501044_0117981 | 3300049823 | Bacteria | 2657 |
| 313 | Ga0501044_0181758 | 3300049823 | Bacteria | 2069 |
| 314 | Ga0501044_0293895 | 3300049823 | Bacteria | 1555 |
| 315 | nmdc:mga0n895_125415_c1 | 3300050512 | Bacteria | 2591 |
| 316 | nmdc:mga0n895_79713_c1 | 3300050512 | Bacteria | 3261 |
| 317 | nmdc:mga0rr50_80846_c1 | 3300050513 | Bacteria | 2506 |
| 318 | nmdc:mga0rr50_87258_c1 | 3300050513 | Bacteria | 2422 |
| 319 | nmdc:mga08x19_19516_c1 | 3300050514 | Bacteria | 4161 |
| 320 | nmdc:mga08x19_54_c1 | 3300050514 | Bacteria | 121662 |
| 321 | Ga0501084_0001715 | 3300054114 | Bacteria | 17404 |
| 322 | Ga0501084_0003677 | 3300054114 | Bacteria | 12445 |
| 323 | Ga0501084_0012747 | 3300054114 | Bacteria | 6963 |
| 324 | Ga0501082_0007852 | 3300060353 | Bacteria | 9205 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025906 | Ga0207699_10058775 | Ga0207699_100587754 | 246 |
| 2 | 3300035170 | Ga0373943_0328953 | Ga0373943_0328953_37_825 | 261 |
| 3 | 3300025907 | Ga0207645_10189927 | Ga0207645_101899271 | 268 |
| 4 | 3300028577 | Ga0265318_10000172 | Ga0265318_1000017253 | 274 |
| 5 | 3300028800 | Ga0265338_10049968 | Ga0265338_100499684 | 276 |
| 6 | 3300048909 | Ga0496106_0407006 | Ga0496106_0407006_234_1067 | 276 |
| 7 | 3300032139 | Ga0316580_10040098 | Ga0316580_100400981 | 278 |
| 8 | 3300036712 | Ga0316584_0055993 | Ga0316584_0055993_828_1670 | 278 |
| 9 | 3300031456 | Ga0307513_10011270 | Ga0307513_100112707 | 282 |
| 10 | 3300031456 | Ga0307513_10029194 | Ga0307513_100291942 | 282 |
| 11 | 3300031727 | Ga0316576_10057231 | Ga0316576_100572313 | 282 |
| 12 | 3300005333 | Ga0070677_10000714 | Ga0070677_1000071411 | 284 |
| 13 | 3300005334 | Ga0068869_100094071 | Ga0068869_1000940712 | 284 |
| 14 | 3300005337 | Ga0070682_100106333 | Ga0070682_1001063332 | 284 |
| 15 | 3300005347 | Ga0070668_100443755 | Ga0070668_1004437551 | 284 |
| 16 | 3300005354 | Ga0070675_100001032 | Ga0070675_10000103211 | 284 |
| 17 | 3300005355 | Ga0070671_100245470 | Ga0070671_1002454702 | 284 |
| 18 | 3300005356 | Ga0070674_100085534 | Ga0070674_1000855342 | 284 |
| 19 | 3300005364 | Ga0070673_100021761 | Ga0070673_1000217611 | 284 |
| 20 | 3300005364 | Ga0070673_100048600 | Ga0070673_1000486001 | 284 |
| 21 | 3300005367 | Ga0070667_100262502 | Ga0070667_1002625022 | 284 |
| 22 | 3300005441 | Ga0070700_100119033 | Ga0070700_1001190332 | 284 |
| 23 | 3300005456 | Ga0070678_100076910 | Ga0070678_1000769102 | 284 |
| 24 | 3300005548 | Ga0070665_100273482 | Ga0070665_1002734822 | 284 |
| 25 | 3300005564 | Ga0070664_100267900 | Ga0070664_1002679002 | 284 |
| 26 | 3300005617 | Ga0068859_100639512 | Ga0068859_1006395121 | 284 |
| 27 | 3300005719 | Ga0068861_100043324 | Ga0068861_1000433243 | 284 |
| 28 | 3300005840 | Ga0068870_10010870 | Ga0068870_100108702 | 284 |
| 29 | 3300005841 | Ga0068863_100124652 | Ga0068863_1001246522 | 284 |
| 30 | 3300006237 | Ga0097621_100123233 | Ga0097621_1001232332 | 284 |
| 31 | 3300006931 | Ga0097620_100639547 | Ga0097620_1006395471 | 284 |
| 32 | 3300009176 | Ga0105242_10041936 | Ga0105242_100419363 | 284 |
| 33 | 3300009177 | Ga0105248_10087663 | Ga0105248_100876633 | 284 |
| 34 | 3300013296 | Ga0157374_10377520 | Ga0157374_103775202 | 284 |
| 35 | 3300013306 | Ga0163162_10051325 | Ga0163162_100513253 | 284 |
| 36 | 3300014325 | Ga0163163_10237668 | Ga0163163_102376682 | 284 |
| 37 | 3300017792 | Ga0163161_10324223 | Ga0163161_103242231 | 284 |
| 38 | 3300025893 | Ga0207682_10001837 | Ga0207682_100018373 | 284 |
| 39 | 3300025893 | Ga0207682_10002748 | Ga0207682_100027485 | 284 |
| 40 | 3300025908 | Ga0207643_10002188 | Ga0207643_1000218810 | 284 |
| 41 | 3300025925 | Ga0207650_10020067 | Ga0207650_100200675 | 284 |
| 42 | 3300025926 | Ga0207659_10028208 | Ga0207659_100282083 | 284 |
| 43 | 3300025931 | Ga0207644_10441770 | Ga0207644_104417702 | 284 |
| 44 | 3300025934 | Ga0207686_10065982 | Ga0207686_100659822 | 284 |
| 45 | 3300025936 | Ga0207670_10220790 | Ga0207670_102207901 | 284 |
| 46 | 3300025937 | Ga0207669_10014672 | Ga0207669_100146722 | 284 |
| 47 | 3300025937 | Ga0207669_10064541 | Ga0207669_100645412 | 284 |
| 48 | 3300025938 | Ga0207704_10026074 | Ga0207704_100260741 | 284 |
| 49 | 3300025940 | Ga0207691_10004516 | Ga0207691_100045167 | 284 |
| 50 | 3300025960 | Ga0207651_10005462 | Ga0207651_100054622 | 284 |
| 51 | 3300025972 | Ga0207668_10047647 | Ga0207668_100476473 | 284 |
| 52 | 3300025986 | Ga0207658_10440142 | Ga0207658_104401422 | 284 |
| 53 | 3300026075 | Ga0207708_10044875 | Ga0207708_100448753 | 284 |
| 54 | 3300026118 | Ga0207675_100035623 | Ga0207675_1000356232 | 284 |
| 55 | 3300026121 | Ga0207683_10008135 | Ga0207683_100081356 | 284 |
| 56 | 3300031727 | Ga0316576_10055491 | Ga0316576_100554912 | 284 |
| 57 | 3300046694 | Ga0495649_0163966 | Ga0495649_0163966_94_978 | 284 |
| 58 | 3300049583 | Ga0501067_0007292 | Ga0501067_0007292_726_1625 | 284 |
| 59 | 3300049584 | Ga0501068_0008263 | Ga0501068_0008263_3764_4663 | 284 |
| 60 | 3300049587 | Ga0501071_0025120 | Ga0501071_0025120_2345_3244 | 284 |
| 61 | 3300049589 | Ga0501073_0014765 | Ga0501073_0014765_3778_4677 | 284 |
| 62 | 3300049590 | Ga0501074_0003522 | Ga0501074_0003522_1904_2803 | 284 |
| 63 | 3300049592 | Ga0501076_0012676 | Ga0501076_0012676_143_1042 | 284 |
| 64 | 3300049593 | Ga0501077_0001000 | Ga0501077_0001000_6429_7328 | 284 |
| 65 | 3300049741 | Ga0501079_0015777 | Ga0501079_0015777_1187_2086 | 284 |
| 66 | 3300049742 | Ga0501080_0010825 | Ga0501080_0010825_5577_6476 | 284 |
| 67 | 3300054114 | Ga0501084_0012747 | Ga0501084_0012747_4356_5255 | 284 |
| 68 | 3300060353 | Ga0501082_0007852 | Ga0501082_0007852_259_1158 | 284 |
| 69 | 3300031249 | Ga0265339_10026769 | Ga0265339_100267694 | 285 |
| 70 | 3300031344 | Ga0265316_10042693 | Ga0265316_100426932 | 285 |
| 71 | 3300031824 | Ga0307413_10020616 | Ga0307413_100206162 | 285 |
| 72 | 3300031852 | Ga0307410_10031414 | Ga0307410_100314142 | 285 |
| 73 | 3300031903 | Ga0307407_10015415 | Ga0307407_100154153 | 285 |
| 74 | 3300031995 | Ga0307409_100277738 | Ga0307409_1002777382 | 285 |
| 75 | 3300006028 | Ga0070717_10260550 | Ga0070717_102605502 | 286 |
| 76 | 3300035398 | Ga0316574_0251967 | Ga0316574_0251967_204_1079 | 286 |
| 77 | 3300035724 | Ga0373933_0055321 | Ga0373933_0055321_627_1490 | 286 |
| 78 | 3300036401 | Ga0373937_0137436 | Ga0373937_0137436_1032_1895 | 286 |
| 79 | 3300036401 | Ga0373937_0196048 | Ga0373937_0196048_863_1726 | 286 |
| 80 | 3300003320 | rootH2_10208059 | rootH2_102080592 | 288 |
| 81 | 3300005367 | Ga0070667_100030619 | Ga0070667_1000306195 | 288 |
| 82 | 3300025986 | Ga0207658_10068961 | Ga0207658_100689612 | 288 |
| 83 | 3300031242 | Ga0265329_10046668 | Ga0265329_100466682 | 288 |
| 84 | 3300031712 | Ga0265342_10016420 | Ga0265342_100164203 | 288 |
| 85 | 3300035172 | Ga0373955_0298725 | Ga0373955_0298725_73_942 | 288 |
| 86 | 3300036401 | Ga0373937_0003753 | Ga0373937_0003753_11836_12705 | 288 |
| 87 | 3300039437 | Ga0436365_1115723 | Ga0436365_1115723_422_1291 | 288 |
| 88 | 3300005344 | Ga0070661_100103926 | Ga0070661_1001039262 | 289 |
| 89 | 3300005335 | Ga0070666_10000309 | Ga0070666_100003097 | 290 |
| 90 | 3300005434 | Ga0070709_10000179 | Ga0070709_1000017934 | 290 |
| 91 | 3300005435 | Ga0070714_100016053 | Ga0070714_1000160532 | 290 |
| 92 | 3300005435 | Ga0070714_100045963 | Ga0070714_1000459632 | 290 |
| 93 | 3300005436 | Ga0070713_100000011 | Ga0070713_10000001111 | 290 |
| 94 | 3300005539 | Ga0068853_100001110 | Ga0068853_1000011104 | 290 |
| 95 | 3300005614 | Ga0068856_100001593 | Ga0068856_10000159311 | 290 |
| 96 | 3300005616 | Ga0068852_100087431 | Ga0068852_1000874314 | 290 |
| 97 | 3300005618 | Ga0068864_100202946 | Ga0068864_1002029462 | 290 |
| 98 | 3300005841 | Ga0068863_100122730 | Ga0068863_1001227304 | 290 |
| 99 | 3300006175 | Ga0070712_100000023 | Ga0070712_10000002342 | 290 |
| 100 | 3300006914 | Ga0075436_100000276 | Ga0075436_10000027611 | 290 |
| 101 | 3300007076 | Ga0075435_100031595 | Ga0075435_1000315952 | 290 |
| 102 | 3300009093 | Ga0105240_10129331 | Ga0105240_101293314 | 290 |
| 103 | 3300009101 | Ga0105247_10266998 | Ga0105247_102669982 | 290 |
| 104 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011688 | 290 |
| 105 | 3300013297 | Ga0157378_10690481 | Ga0157378_106904811 | 290 |
| 106 | 3300014968 | Ga0157379_10036941 | Ga0157379_100369415 | 290 |
| 107 | 3300025903 | Ga0207680_10001895 | Ga0207680_100018956 | 290 |
| 108 | 3300025906 | Ga0207699_10000758 | Ga0207699_1000075815 | 290 |
| 109 | 3300025915 | Ga0207693_10000018 | Ga0207693_10000018105 | 290 |
| 110 | 3300025928 | Ga0207700_10000026 | Ga0207700_1000002626 | 290 |
| 111 | 3300025929 | Ga0207664_10005160 | Ga0207664_100051605 | 290 |
| 112 | 3300025929 | Ga0207664_10072706 | Ga0207664_100727062 | 290 |
| 113 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001184 | 290 |
| 114 | 3300026041 | Ga0207639_10001144 | Ga0207639_100011443 | 290 |
| 115 | 3300026078 | Ga0207702_10000592 | Ga0207702_1000059220 | 290 |
| 116 | 3300026088 | Ga0207641_10069386 | Ga0207641_100693865 | 290 |
| 117 | 3300028573 | Ga0265334_10007944 | Ga0265334_100079443 | 290 |
| 118 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011318 | 290 |
| 119 | 3300031238 | Ga0265332_10029435 | Ga0265332_100294352 | 290 |
| 120 | 3300031241 | Ga0265325_10000009 | Ga0265325_10000009197 | 290 |
| 121 | 3300031247 | Ga0265340_10000261 | Ga0265340_100002615 | 290 |
| 122 | 3300031249 | Ga0265339_10000271 | Ga0265339_1000027142 | 290 |
| 123 | 3300031250 | Ga0265331_10000722 | Ga0265331_100007221 | 290 |
| 124 | 3300031595 | Ga0265313_10000620 | Ga0265313_1000062046 | 290 |
| 125 | 3300031595 | Ga0265313_10089783 | Ga0265313_100897832 | 290 |
| 126 | 3300031711 | Ga0265314_10004079 | Ga0265314_100040793 | 290 |
| 127 | 3300031711 | Ga0265314_10051534 | Ga0265314_100515343 | 290 |
| 128 | 3300031712 | Ga0265342_10002698 | Ga0265342_100026984 | 290 |
| 129 | 3300035086 | Ga0373934_0050746 | Ga0373934_0050746_217_1152 | 290 |
| 130 | 3300035691 | Ga0373931_0007350 | Ga0373931_0007350_3337_4209 | 290 |
| 131 | 3300035692 | Ga0373935_0449846 | Ga0373935_0449846_28_900 | 290 |
| 132 | 3300036401 | Ga0373937_0064903 | Ga0373937_0064903_467_1402 | 290 |
| 133 | 3300037068 | Ga0373925_0136792 | Ga0373925_0136792_23_895 | 290 |
| 134 | 3300049742 | Ga0501080_0001970 | Ga0501080_0001970_6523_7431 | 290 |
| 135 | 3300050512 | nmdc:mga0n895_125415_c1 | nmdc:mga0n895_125415_c1_698_1570 | 290 |
| 136 | 3300050513 | nmdc:mga0rr50_87258_c1 | nmdc:mga0rr50_87258_c1_1321_2262 | 290 |
| 137 | 3300050514 | nmdc:mga08x19_54_c1 | nmdc:mga08x19_54_c1_95963_96904 | 290 |
| 138 | 3300005336 | Ga0070680_100000317 | Ga0070680_10000031712 | 291 |
| 139 | 3300005341 | Ga0070691_10000033 | Ga0070691_1000003324 | 291 |
| 140 | 3300005434 | Ga0070709_10056457 | Ga0070709_100564572 | 291 |
| 141 | 3300005439 | Ga0070711_100152296 | Ga0070711_1001522962 | 291 |
| 142 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002624 | 291 |
| 143 | 3300005458 | Ga0070681_10132265 | Ga0070681_101322654 | 291 |
| 144 | 3300005530 | Ga0070679_100001275 | Ga0070679_10000127512 | 291 |
| 145 | 3300005539 | Ga0068853_100001647 | Ga0068853_10000164717 | 291 |
| 146 | 3300005545 | Ga0070695_100008582 | Ga0070695_1000085823 | 291 |
| 147 | 3300005547 | Ga0070693_100098657 | Ga0070693_1000986572 | 291 |
| 148 | 3300005577 | Ga0068857_100002650 | Ga0068857_10000265012 | 291 |
| 149 | 3300005614 | Ga0068856_100001370 | Ga0068856_1000013707 | 291 |
| 150 | 3300005616 | Ga0068852_100008577 | Ga0068852_1000085772 | 291 |
| 151 | 3300006237 | Ga0097621_100282710 | Ga0097621_1002827102 | 291 |
| 152 | 3300006871 | Ga0075434_100040351 | Ga0075434_1000403515 | 291 |
| 153 | 3300006914 | Ga0075436_100005635 | Ga0075436_1000056358 | 291 |
| 154 | 3300007076 | Ga0075435_100060033 | Ga0075435_1000600333 | 291 |
| 155 | 3300009093 | Ga0105240_10001363 | Ga0105240_1000136328 | 291 |
| 156 | 3300009174 | Ga0105241_10002297 | Ga0105241_1000229715 | 291 |
| 157 | 3300009545 | Ga0105237_10000746 | Ga0105237_1000074624 | 291 |
| 158 | 3300009551 | Ga0105238_10007767 | Ga0105238_1000776711 | 291 |
| 159 | 3300010375 | Ga0105239_10002420 | Ga0105239_1000242022 | 291 |
| 160 | 3300010375 | Ga0105239_10069089 | Ga0105239_100690893 | 291 |
| 161 | 3300013100 | Ga0157373_10001483 | Ga0157373_100014836 | 291 |
| 162 | 3300013104 | Ga0157370_10000753 | Ga0157370_1000075330 | 291 |
| 163 | 3300013105 | Ga0157369_10002018 | Ga0157369_1000201813 | 291 |
| 164 | 3300013105 | Ga0157369_10202507 | Ga0157369_102025073 | 291 |
| 165 | 3300013296 | Ga0157374_10055603 | Ga0157374_100556033 | 291 |
| 166 | 3300013307 | Ga0157372_10007018 | Ga0157372_100070182 | 291 |
| 167 | 3300014968 | Ga0157379_10002050 | Ga0157379_100020503 | 291 |
| 168 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002334 | 291 |
| 169 | 3300025912 | Ga0207707_10511061 | Ga0207707_105110612 | 291 |
| 170 | 3300025913 | Ga0207695_10016474 | Ga0207695_100164746 | 291 |
| 171 | 3300025914 | Ga0207671_10019446 | Ga0207671_100194466 | 291 |
| 172 | 3300025917 | Ga0207660_10001134 | Ga0207660_100011346 | 291 |
| 173 | 3300025921 | Ga0207652_10003391 | Ga0207652_1000339116 | 291 |
| 174 | 3300025924 | Ga0207694_10040540 | Ga0207694_100405404 | 291 |
| 175 | 3300025949 | Ga0207667_10004609 | Ga0207667_1000460916 | 291 |
| 176 | 3300025981 | Ga0207640_10022564 | Ga0207640_100225642 | 291 |
| 177 | 3300026078 | Ga0207702_10002168 | Ga0207702_1000216818 | 291 |
| 178 | 3300026116 | Ga0207674_10000134 | Ga0207674_1000013463 | 291 |
| 179 | 3300026142 | Ga0207698_10424764 | Ga0207698_104247642 | 291 |
| 180 | 3300028800 | Ga0265338_10009825 | Ga0265338_100098254 | 291 |
| 181 | 3300031247 | Ga0265340_10003329 | Ga0265340_100033299 | 291 |
| 182 | 3300031711 | Ga0265314_10060222 | Ga0265314_100602224 | 291 |
| 183 | 3300046477 | Ga0495664_0010262 | Ga0495664_0010262_3747_4622 | 291 |
| 184 | 3300046543 | Ga0495645_0061987 | Ga0495645_0061987_1085_1960 | 291 |
| 185 | 3300048918 | Ga0496115_0098501 | Ga0496115_0098501_998_1873 | 291 |
| 186 | 3300049568 | Ga0501031_0035735 | Ga0501031_0035735_1217_2092 | 291 |
| 187 | 3300049569 | Ga0501032_0023810 | Ga0501032_0023810_2623_3498 | 291 |
| 188 | 3300049571 | Ga0501034_0012731 | Ga0501034_0012731_4730_5605 | 291 |
| 189 | 3300049573 | Ga0501037_0109240 | Ga0501037_0109240_571_1446 | 291 |
| 190 | 3300049581 | Ga0501047_0002217 | Ga0501047_0002217_4912_5787 | 291 |
| 191 | 3300049582 | Ga0501048_0048231 | Ga0501048_0048231_1200_2075 | 291 |
| 192 | 3300049583 | Ga0501067_0000181 | Ga0501067_0000181_10604_11479 | 291 |
| 193 | 3300049585 | Ga0501069_0001060 | Ga0501069_0001060_4185_5060 | 291 |
| 194 | 3300049586 | Ga0501070_0007717 | Ga0501070_0007717_2681_3556 | 291 |
| 195 | 3300049588 | Ga0501072_0011727 | Ga0501072_0011727_5541_6416 | 291 |
| 196 | 3300049589 | Ga0501073_0004754 | Ga0501073_0004754_1186_2061 | 291 |
| 197 | 3300049589 | Ga0501073_0024036 | Ga0501073_0024036_715_1590 | 291 |
| 198 | 3300049589 | Ga0501073_0127498 | Ga0501073_0127498_495_1370 | 291 |
| 199 | 3300049590 | Ga0501074_0009511 | Ga0501074_0009511_1150_2025 | 291 |
| 200 | 3300049741 | Ga0501079_0001647 | Ga0501079_0001647_12540_13415 | 291 |
| 201 | 3300049741 | Ga0501079_0133547 | Ga0501079_0133547_851_1726 | 291 |
| 202 | 3300049742 | Ga0501080_0041628 | Ga0501080_0041628_232_1107 | 291 |
| 203 | 3300049744 | Ga0501083_0034156 | Ga0501083_0034156_1833_2708 | 291 |
| 204 | 3300049822 | Ga0501035_0005635 | Ga0501035_0005635_1329_2204 | 291 |
| 205 | 3300049823 | Ga0501044_0014583 | Ga0501044_0014583_6887_7762 | 291 |
| 206 | 3300050512 | nmdc:mga0n895_79713_c1 | nmdc:mga0n895_79713_c1_2168_3043 | 291 |
| 207 | 3300050513 | nmdc:mga0rr50_80846_c1 | nmdc:mga0rr50_80846_c1_870_1745 | 291 |
| 208 | 3300050514 | nmdc:mga08x19_19516_c1 | nmdc:mga08x19_19516_c1_2323_3198 | 291 |
| 209 | 3300054114 | Ga0501084_0001715 | Ga0501084_0001715_11255_12130 | 291 |
| 210 | 3300054114 | Ga0501084_0003677 | Ga0501084_0003677_483_1358 | 291 |
| 211 | 3300005436 | Ga0070713_100049354 | Ga0070713_1000493543 | 292 |
| 212 | 3300005439 | Ga0070711_100007954 | Ga0070711_1000079546 | 292 |
| 213 | 3300006175 | Ga0070712_100001086 | Ga0070712_10000108616 | 292 |
| 214 | 3300009177 | Ga0105248_10049367 | Ga0105248_100493674 | 292 |
| 215 | 3300014968 | Ga0157379_10016532 | Ga0157379_100165323 | 292 |
| 216 | 3300025915 | Ga0207693_10000534 | Ga0207693_1000053434 | 292 |
| 217 | 3300025941 | Ga0207711_10008576 | Ga0207711_100085765 | 292 |
| 218 | 3300031240 | Ga0265320_10000628 | Ga0265320_1000062813 | 292 |
| 219 | 3300031241 | Ga0265325_10000365 | Ga0265325_1000036532 | 292 |
| 220 | 3300031241 | Ga0265325_10001964 | Ga0265325_100019642 | 292 |
| 221 | 3300031247 | Ga0265340_10012272 | Ga0265340_100122723 | 292 |
| 222 | 3300031249 | Ga0265339_10003492 | Ga0265339_100034925 | 292 |
| 223 | 3300031344 | Ga0265316_10061901 | Ga0265316_100619011 | 292 |
| 224 | 3300031595 | Ga0265313_10002198 | Ga0265313_1000219810 | 292 |
| 225 | 3300031595 | Ga0265313_10107214 | Ga0265313_101072142 | 292 |
| 226 | 3300031712 | Ga0265342_10038097 | Ga0265342_100380973 | 292 |
| 227 | 3300035083 | Ga0373926_0062835 | Ga0373926_0062835_229_1110 | 292 |
| 228 | 3300035724 | Ga0373933_0030310 | Ga0373933_0030310_2133_3014 | 292 |
| 229 | 3300036401 | Ga0373937_0000880 | Ga0373937_0000880_24780_25661 | 292 |
| 230 | 3300048904 | Ga0496101_0093498 | Ga0496101_0093498_131_1012 | 292 |
| 231 | 3300048913 | Ga0496110_0284859 | Ga0496110_0284859_379_1260 | 292 |
| 232 | 3300048915 | Ga0496112_0311512 | Ga0496112_0311512_123_1004 | 292 |
| 233 | 3300005344 | Ga0070661_100020592 | Ga0070661_1000205927 | 293 |
| 234 | 3300005539 | Ga0068853_100102006 | Ga0068853_1001020064 | 293 |
| 235 | 3300005563 | Ga0068855_100000069 | Ga0068855_10000006985 | 293 |
| 236 | 3300005616 | Ga0068852_100036719 | Ga0068852_1000367192 | 293 |
| 237 | 3300009093 | Ga0105240_10000055 | Ga0105240_10000055128 | 293 |
| 238 | 3300009176 | Ga0105242_10144458 | Ga0105242_101444582 | 293 |
| 239 | 3300009545 | Ga0105237_10600465 | Ga0105237_106004651 | 293 |
| 240 | 3300009551 | Ga0105238_10040779 | Ga0105238_100407794 | 293 |
| 241 | 3300010375 | Ga0105239_10000716 | Ga0105239_1000071624 | 293 |
| 242 | 3300013105 | Ga0157369_10005371 | Ga0157369_100053719 | 293 |
| 243 | 3300013105 | Ga0157369_10129518 | Ga0157369_101295183 | 293 |
| 244 | 3300014968 | Ga0157379_10001588 | Ga0157379_1000158813 | 293 |
| 245 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012209 | 293 |
| 246 | 3300025920 | Ga0207649_10012415 | Ga0207649_100124151 | 293 |
| 247 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006454 | 293 |
| 248 | 3300025934 | Ga0207686_10151528 | Ga0207686_101515283 | 293 |
| 249 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026183 | 293 |
| 250 | 3300026041 | Ga0207639_10054118 | Ga0207639_100541184 | 293 |
| 251 | 3300026142 | Ga0207698_10062058 | Ga0207698_100620583 | 293 |
| 252 | 3300026142 | Ga0207698_10523754 | Ga0207698_105237542 | 293 |
| 253 | 3300031250 | Ga0265331_10000008 | Ga0265331_10000008157 | 293 |
| 254 | 3300031251 | Ga0265327_10000036 | Ga0265327_1000003637 | 293 |
| 255 | 3300031711 | Ga0265314_10172134 | Ga0265314_101721342 | 293 |
| 256 | 3300031730 | Ga0307516_10129045 | Ga0307516_101290452 | 293 |
| 257 | 3300046477 | Ga0495664_0059660 | Ga0495664_0059660_639_1520 | 293 |
| 258 | 3300049460 | Ga0495682_0002321 | Ga0495682_0002321_7570_8538 | 293 |
| 259 | 3300049571 | Ga0501034_0136942 | Ga0501034_0136942_1498_2385 | 293 |
| 260 | 3300049574 | Ga0501038_0029315 | Ga0501038_0029315_925_1812 | 293 |
| 261 | 3300049575 | Ga0501039_0069971 | Ga0501039_0069971_1353_2297 | 293 |
| 262 | 3300049579 | Ga0501043_0029940 | Ga0501043_0029940_698_1585 | 293 |
| 263 | 3300049581 | Ga0501047_0151084 | Ga0501047_0151084_1035_1922 | 293 |
| 264 | 3300049581 | Ga0501047_0252795 | Ga0501047_0252795_712_1599 | 293 |
| 265 | 3300049583 | Ga0501067_0153990 | Ga0501067_0153990_367_1254 | 293 |
| 266 | 3300049586 | Ga0501070_0016647 | Ga0501070_0016647_4137_5081 | 293 |
| 267 | 3300049590 | Ga0501074_0093635 | Ga0501074_0093635_1197_2141 | 293 |
| 268 | 3300049742 | Ga0501080_0056242 | Ga0501080_0056242_711_1598 | 293 |
| 269 | 3300049822 | Ga0501035_0125154 | Ga0501035_0125154_1136_2023 | 293 |
| 270 | 3300049823 | Ga0501044_0181758 | Ga0501044_0181758_954_1841 | 293 |
| 271 | 3300005344 | Ga0070661_100000254 | Ga0070661_10000025416 | 294 |
| 272 | 3300013104 | Ga0157370_10096241 | Ga0157370_100962412 | 294 |
| 273 | 3300025920 | Ga0207649_10000026 | Ga0207649_1000002636 | 294 |
| 274 | 3300031241 | Ga0265325_10023697 | Ga0265325_100236972 | 294 |
| 275 | 3300031249 | Ga0265339_10013804 | Ga0265339_100138047 | 294 |
| 276 | 3300031250 | Ga0265331_10000067 | Ga0265331_1000006719 | 294 |
| 277 | 3300031711 | Ga0265314_10002040 | Ga0265314_1000204011 | 294 |
| 278 | 3300031711 | Ga0265314_10047212 | Ga0265314_100472122 | 294 |
| 279 | 3300039437 | Ga0436365_1513507 | Ga0436365_1513507_3167_4051 | 294 |
| 280 | 3300049580 | Ga0501046_0056903 | Ga0501046_0056903_1592_2533 | 294 |
| 281 | 3300003320 | rootH2_10001888 | rootH2_100018886 | 296 |
| 282 | 3300005327 | Ga0070658_10038887 | Ga0070658_100388872 | 296 |
| 283 | 3300005341 | Ga0070691_10003543 | Ga0070691_100035434 | 296 |
| 284 | 3300005366 | Ga0070659_100023118 | Ga0070659_1000231184 | 296 |
| 285 | 3300005563 | Ga0068855_100005915 | Ga0068855_10000591517 | 296 |
| 286 | 3300005578 | Ga0068854_100143734 | Ga0068854_1001437342 | 296 |
| 287 | 3300009551 | Ga0105238_10049009 | Ga0105238_100490092 | 296 |
| 288 | 3300013100 | Ga0157373_10086632 | Ga0157373_100866322 | 296 |
| 289 | 3300013104 | Ga0157370_10011069 | Ga0157370_100110698 | 296 |
| 290 | 3300013307 | Ga0157372_10048709 | Ga0157372_100487092 | 296 |
| 291 | 3300025909 | Ga0207705_10000105 | Ga0207705_100001058 | 296 |
| 292 | 3300025912 | Ga0207707_10002912 | Ga0207707_100029126 | 296 |
| 293 | 3300025917 | Ga0207660_10000814 | Ga0207660_1000081417 | 296 |
| 294 | 3300025919 | Ga0207657_10000154 | Ga0207657_1000015452 | 296 |
| 295 | 3300025921 | Ga0207652_10001371 | Ga0207652_1000137113 | 296 |
| 296 | 3300025932 | Ga0207690_10035537 | Ga0207690_100355372 | 296 |
| 297 | 3300025949 | Ga0207667_10031722 | Ga0207667_100317225 | 296 |
| 298 | 3300025981 | Ga0207640_10062830 | Ga0207640_100628303 | 296 |
| 299 | 3300031235 | Ga0265330_10008539 | Ga0265330_100085396 | 296 |
| 300 | 3300031235 | Ga0265330_10060847 | Ga0265330_100608472 | 296 |
| 301 | 3300031247 | Ga0265340_10000018 | Ga0265340_1000001841 | 296 |
| 302 | 3300031249 | Ga0265339_10055941 | Ga0265339_100559412 | 296 |
| 303 | 3300031344 | Ga0265316_10003597 | Ga0265316_1000359719 | 296 |
| 304 | 3300031344 | Ga0265316_10020000 | Ga0265316_100200008 | 296 |
| 305 | 3300031344 | Ga0265316_10212093 | Ga0265316_102120932 | 296 |
| 306 | 3300031595 | Ga0265313_10057555 | Ga0265313_100575552 | 296 |
| 307 | 3300031711 | Ga0265314_10155204 | Ga0265314_101552042 | 296 |
| 308 | 3300031712 | Ga0265342_10023816 | Ga0265342_100238163 | 296 |
| 309 | 3300031712 | Ga0265342_10101755 | Ga0265342_101017552 | 296 |
| 310 | 3300049568 | Ga0501031_0007007 | Ga0501031_0007007_2719_3609 | 296 |
| 311 | 3300049569 | Ga0501032_0291400 | Ga0501032_0291400_136_1026 | 296 |
| 312 | 3300049573 | Ga0501037_0022800 | Ga0501037_0022800_3387_4277 | 296 |
| 313 | 3300049573 | Ga0501037_0092295 | Ga0501037_0092295_504_1394 | 296 |
| 314 | 3300049574 | Ga0501038_0063322 | Ga0501038_0063322_207_1097 | 296 |
| 315 | 3300049574 | Ga0501038_0358617 | Ga0501038_0358617_205_1095 | 296 |
| 316 | 3300049579 | Ga0501043_0134575 | Ga0501043_0134575_955_1845 | 296 |
| 317 | 3300049581 | Ga0501047_0258583 | Ga0501047_0258583_512_1402 | 296 |
| 318 | 3300049586 | Ga0501070_0001145 | Ga0501070_0001145_14340_15230 | 296 |
| 319 | 3300049590 | Ga0501074_0344739 | Ga0501074_0344739_130_1020 | 296 |
| 320 | 3300049742 | Ga0501080_0002886 | Ga0501080_0002886_7246_8136 | 296 |
| 321 | 3300049822 | Ga0501035_0001106 | Ga0501035_0001106_12485_13375 | 296 |
| 322 | 3300049823 | Ga0501044_0001448 | Ga0501044_0001448_3775_4665 | 296 |
| 323 | 3300049823 | Ga0501044_0117981 | Ga0501044_0117981_828_1718 | 296 |
| 324 | 3300049823 | Ga0501044_0293895 | Ga0501044_0293895_268_1158 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar