F407421

General Info

Members Datasets Scaffolds Average Seq Length
324 161 648 168

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10187107|Ga0207708_101871073
Length 195
Sequence MNFPPNVTVLWLVQLKSSTTRGFMYCPNCGQQQISGEMKFCSRCGLALTGLAEWLAGGSVPARQTEQAEIPVTSPRRKHIRRAAKLMFSSGVLFVIFLAISIAVEEGGPMFIPFFVFFVSLVWLLYARLFMDNTARVNYQAPQSAVSGSIPARGSLPAANTTSIPNVGRQQVRTNELAQPPSVTEHTTRFFDNEQ

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
138 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
141 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
142 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
147 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
148 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
149 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
150 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
151 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
152 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
153 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
154 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
155 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
156 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
157 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 33.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10187107 3300026075 Bacteria 1646
2 JGI24751J29686_10000007 3300002459 Bacteria 129562
3 rootH2_10227174 3300003320 Bacteria 1914
4 rootL2_10152885 3300003322 Bacteria 3370
5 Ga0065715_10027722 3300005293 Bacteria 1431
6 Ga0070690_100212228 3300005330 Bacteria 1352
7 Ga0070670_100000043 3300005331 Bacteria 141622
8 Ga0070670_100046131 3300005331 Bacteria 3747
9 Ga0070670_100457509 3300005331 Unclassified 1131
10 Ga0070670_100522691 3300005331 Unclassified 1057
11 Ga0068869_100309948 3300005334 Unclassified 1277
12 Ga0068869_100468756 3300005334 Unclassified 1047
13 Ga0068869_100898506 3300005334 Unclassified 766
14 Ga0070666_10197115 3300005335 Bacteria 1416
15 Ga0070680_100033862 3300005336 Bacteria 4119
16 Ga0070680_100753905 3300005336 Unclassified 838
17 Ga0070660_100027614 3300005339 Bacteria 4237
18 Ga0070660_100195805 3300005339 Bacteria 1638
19 Ga0070689_100004774 3300005340 Bacteria 9189
20 Ga0070689_100879388 3300005340 Unclassified 792
21 Ga0070661_100050027 3300005344 Bacteria 3059
22 Ga0070692_10022568 3300005345 Bacteria 3075
23 Ga0070692_10038251 3300005345 Bacteria 2444
24 Ga0070669_100077686 3300005353 Bacteria 2466
25 Ga0070669_100400750 3300005353 Bacteria 1122
26 Ga0070669_100816680 3300005353 Unclassified 793
27 Ga0070675_100145482 3300005354 Bacteria 2029
28 Ga0070671_100028267 3300005355 Bacteria 4617
29 Ga0070673_100104590 3300005364 Unclassified 2338
30 Ga0070673_100299306 3300005364 Bacteria 1416
31 Ga0070673_101499540 3300005364 Unclassified 636
32 Ga0070659_100087556 3300005366 Bacteria 2493
33 Ga0070659_100113559 3300005366 Unclassified 2188
34 Ga0070701_10231027 3300005438 Unclassified 1108
35 Ga0070701_10357909 3300005438 Unclassified 914
36 Ga0070705_100016825 3300005440 Bacteria 3807
37 Ga0070705_100160580 3300005440 Bacteria 1502
38 Ga0070705_100398977 3300005440 Unclassified 1018
39 Ga0070705_101377353 3300005440 Unclassified 587
40 Ga0070700_100019680 3300005441 Bacteria 3900
41 Ga0070700_100910756 3300005441 Bacteria 717
42 Ga0070694_100588621 3300005444 Bacteria 895
43 Ga0070694_100863518 3300005444 Unclassified 745
44 Ga0070694_101397134 3300005444 Unclassified 591
45 Ga0070708_101059966 3300005445 Bacteria 760
46 Ga0070678_100751412 3300005456 Bacteria 882
47 Ga0070681_10023175 3300005458 Bacteria 6245
48 Ga0070681_10122933 3300005458 Bacteria 2528
49 Ga0068867_100082559 3300005459 Unclassified 2424
50 Ga0070706_100000031 3300005467 Bacteria 153504
51 Ga0070707_100049626 3300005468 Unclassified 4023
52 Ga0070707_100795251 3300005468 Unclassified 910
53 Ga0070698_100089118 3300005471 Unclassified 3069
54 Ga0070698_100404503 3300005471 Bacteria 1298
55 Ga0070699_100295300 3300005518 Bacteria 1453
56 Ga0070684_100215904 3300005535 Bacteria 1749
57 Ga0068853_100051487 3300005539 Bacteria 3544
58 Ga0068853_100068580 3300005539 Bacteria 3083
59 Ga0070695_100108000 3300005545 Bacteria 1884
60 Ga0070695_100346497 3300005545 Bacteria 1112
61 Ga0070695_100583776 3300005545 Unclassified 875
62 Ga0070695_100625046 3300005545 Unclassified 848
63 Ga0070696_100038479 3300005546 Bacteria 3302
64 Ga0070696_100114641 3300005546 Bacteria 1944
65 Ga0070696_101563506 3300005546 Unclassified 566
66 Ga0070693_100031197 3300005547 Bacteria 2919
67 Ga0070693_100055306 3300005547 Unclassified 2286
68 Ga0070693_100188320 3300005547 Bacteria 1333
69 Ga0070693_100378511 3300005547 Bacteria 976
70 Ga0070704_100044920 3300005549 Bacteria 3073
71 Ga0070704_100085609 3300005549 Bacteria 2333
72 Ga0070704_100144026 3300005549 Bacteria 1865
73 Ga0070704_100369738 3300005549 Bacteria 1215
74 Ga0068855_100574821 3300005563 Unclassified 1218
75 Ga0070664_100165169 3300005564 Bacteria 1961
76 Ga0070664_100409088 3300005564 Unclassified 1241
77 Ga0070664_100502922 3300005564 Bacteria 1117
78 Ga0068857_100002653 3300005577 Bacteria 14677
79 Ga0068857_100221365 3300005577 Unclassified 1729
80 Ga0068857_100230298 3300005577 Bacteria 1694
81 Ga0068857_100265627 3300005577 Unclassified 1576
82 Ga0068857_100587451 3300005577 Unclassified 1052
83 Ga0068857_100679715 3300005577 Bacteria 977
84 Ga0068857_100832112 3300005577 Bacteria 882
85 Ga0068857_101401941 3300005577 Unclassified 680
86 Ga0068856_100016162 3300005614 Bacteria 7218
87 Ga0070702_100021407 3300005615 Unclassified 3402
88 Ga0070702_100061491 3300005615 Bacteria 2187
89 Ga0070702_101095517 3300005615 Unclassified 636
90 Ga0068852_100693469 3300005616 Bacteria 1028
91 Ga0068859_100005802 3300005617 Bacteria 12538
92 Ga0068859_100043647 3300005617 Bacteria 4506
93 Ga0068859_100121450 3300005617 Bacteria 2679
94 Ga0068859_100147946 3300005617 Bacteria 2424
95 Ga0068859_100201643 3300005617 Bacteria 2074
96 Ga0068859_100234946 3300005617 Bacteria 1922
97 Ga0068859_100386932 3300005617 Bacteria 1494
98 Ga0068859_102514651 3300005617 Unclassified 567
99 Ga0068864_100039963 3300005618 Bacteria 4011
100 Ga0068864_100113755 3300005618 Bacteria 2413
101 Ga0068864_100222330 3300005618 Bacteria 1743
102 Ga0068864_100228836 3300005618 Bacteria 1719
103 Ga0068864_101125699 3300005618 Bacteria 782
104 Ga0068861_100003435 3300005719 Bacteria 10519
105 Ga0068870_10002974 3300005840 Bacteria 7150
106 Ga0068870_10476206 3300005840 Bacteria 828
107 Ga0068863_100099075 3300005841 Bacteria 2769
108 Ga0068863_100115061 3300005841 Bacteria 2563
109 Ga0068863_100295102 3300005841 Unclassified 1572
110 Ga0068863_100296658 3300005841 Unclassified 1567
111 Ga0068858_100070949 3300005842 Bacteria 3229
112 Ga0068858_100285970 3300005842 Bacteria 1571
113 Ga0068858_101001203 3300005842 Unclassified 819
114 Ga0068858_101228778 3300005842 Unclassified 737
115 Ga0068860_100230248 3300005843 Unclassified 1801
116 Ga0068862_100029656 3300005844 Bacteria 4610
117 Ga0097621_100236218 3300006237 Bacteria 1597
118 Ga0097621_101248500 3300006237 Unclassified 701
119 Ga0068871_100157598 3300006358 Bacteria 1940
120 Ga0075428_100905594 3300006844 Unclassified 935
121 Ga0075430_100201277 3300006846 Bacteria 1653
122 Ga0075430_100719898 3300006846 Unclassified 823
123 Ga0075433_10640483 3300006852 Unclassified 932
124 Ga0075434_100079237 3300006871 Bacteria 3281
125 Ga0075434_100892595 3300006871 Unclassified 904
126 Ga0075429_100494437 3300006880 Bacteria 1072
127 Ga0068865_100350610 3300006881 Bacteria 1196
128 Ga0097620_100005803 3300006931 Bacteria 12538
129 Ga0097620_100032105 3300006931 Bacteria 5274
130 Ga0097620_100043646 3300006931 Bacteria 4506
131 Ga0097620_100121436 3300006931 Bacteria 2679
132 Ga0097620_100147950 3300006931 Bacteria 2424
133 Ga0097620_100201638 3300006931 Bacteria 2074
134 Ga0097620_100234966 3300006931 Bacteria 1922
135 Ga0097620_100386922 3300006931 Bacteria 1494
136 Ga0097620_102513570 3300006931 Unclassified 567
137 Ga0105240_10643293 3300009093 Bacteria 1163
138 Ga0105240_11684519 3300009093 Unclassified 662
139 Ga0111539_10280814 3300009094 Unclassified 1938
140 Ga0105245_11847554 3300009098 Unclassified 657
141 Ga0105247_10003912 3300009101 Bacteria 9614
142 Ga0105247_10812882 3300009101 Unclassified 714
143 Ga0114129_10046507 3300009147 Bacteria 6098
144 Ga0105243_10039486 3300009148 Bacteria 3680
145 Ga0105243_10075687 3300009148 Bacteria 2733
146 Ga0105243_10184693 3300009148 Unclassified 1816
147 Ga0105243_11314459 3300009148 Unclassified 741
148 Ga0105241_10016849 3300009174 Bacteria 5364
149 Ga0105241_10029110 3300009174 Bacteria 4118
150 Ga0105241_10253744 3300009174 Bacteria 1492
151 Ga0105241_10271280 3300009174 Bacteria 1445
152 Ga0105241_11052617 3300009174 Unclassified 764
153 Ga0105248_10088843 3300009177 Bacteria 3478
154 Ga0105248_10115942 3300009177 Bacteria 3021
155 Ga0105248_10438018 3300009177 Bacteria 1472
156 Ga0105237_10035578 3300009545 Bacteria 5039
157 Ga0105237_10285367 3300009545 Bacteria 1653
158 Ga0105238_10291958 3300009551 Bacteria 1613
159 Ga0105238_10921013 3300009551 Unclassified 893
160 Ga0105249_10280139 3300009553 Bacteria 1665
161 Ga0105249_10449062 3300009553 Bacteria 1328
162 Ga0105249_10494478 3300009553 Bacteria 1267
163 Ga0105249_11680510 3300009553 Unclassified 707
164 Ga0105239_10281088 3300010375 Unclassified 1874
165 Ga0105239_10360584 3300010375 Unclassified 1642
166 Ga0105246_10042173 3300011119 Bacteria 3090
167 Ga0105246_10335971 3300011119 Bacteria 1233
168 Ga0157373_10011634 3300013100 Bacteria 6464
169 Ga0157373_10060001 3300013100 Bacteria 2695
170 Ga0157373_10216901 3300013100 Unclassified 1349
171 Ga0157378_11081969 3300013297 Unclassified 838
172 Ga0157378_11244022 3300013297 Unclassified 785
173 Ga0157378_11321032 3300013297 Unclassified 763
174 Ga0163162_10113520 3300013306 Bacteria 2808
175 Ga0163162_10529297 3300013306 Bacteria 1308
176 Ga0157372_10421489 3300013307 Bacteria 1555
177 Ga0157372_10954367 3300013307 Unclassified 994
178 Ga0157375_10059954 3300013308 Unclassified 3772
179 Ga0157375_10065295 3300013308 Bacteria 3628
180 Ga0157375_10171349 3300013308 Bacteria 2318
181 Ga0157375_10233386 3300013308 Bacteria 1999
182 Ga0163163_10000559 3300014325 Bacteria 32681
183 Ga0163163_10507285 3300014325 Bacteria 1268
184 Ga0163163_11178646 3300014325 Unclassified 829
185 Ga0157380_10598409 3300014326 Unclassified 1090
186 Ga0157380_10748895 3300014326 Unclassified 988
187 Ga0157377_10009620 3300014745 Bacteria 4753
188 Ga0157377_10411087 3300014745 Unclassified 924
189 Ga0207643_10013282 3300025908 Bacteria 4457
190 Ga0207643_10068668 3300025908 Unclassified 2036
191 Ga0207643_10120197 3300025908 Bacteria 1555
192 Ga0207684_10000110 3300025910 Bacteria 153722
193 Ga0207684_10360266 3300025910 Bacteria 1251
194 Ga0207654_10058982 3300025911 Bacteria 2236
195 Ga0207654_10246411 3300025911 Bacteria 1196
196 Ga0207654_10496666 3300025911 Unclassified 861
197 Ga0207707_10007941 3300025912 Bacteria 9229
198 Ga0207707_10112822 3300025912 Bacteria 2376
199 Ga0207695_10170069 3300025913 Unclassified 2105
200 Ga0207695_10454920 3300025913 Bacteria 1163
201 Ga0207657_10283438 3300025919 Bacteria 1315
202 Ga0207649_10816730 3300025920 Unclassified 728
203 Ga0207646_10078683 3300025922 Bacteria 2947
204 Ga0207681_10069515 3300025923 Bacteria 2449
205 Ga0207694_10655667 3300025924 Bacteria 884
206 Ga0207650_10000009 3300025925 Bacteria 483583
207 Ga0207650_10034364 3300025925 Bacteria 3676
208 Ga0207650_10205790 3300025925 Bacteria 1578
209 Ga0207650_10591147 3300025925 Bacteria 933
210 Ga0207650_10594799 3300025925 Unclassified 930
211 Ga0207650_10633824 3300025925 Unclassified 900
212 Ga0207659_10331631 3300025926 Bacteria 1258
213 Ga0207687_11331504 3300025927 Unclassified 617
214 Ga0207690_10104515 3300025932 Bacteria 2029
215 Ga0207690_10168064 3300025932 Bacteria 1641
216 Ga0207709_10001174 3300025935 Bacteria 18974
217 Ga0207709_10435758 3300025935 Unclassified 1010
218 Ga0207670_10002181 3300025936 Bacteria 10235
219 Ga0207704_10485729 3300025938 Bacteria 992
220 Ga0207665_10317771 3300025939 Bacteria 1168
221 Ga0207711_10242008 3300025941 Bacteria 1654
222 Ga0207711_10475827 3300025941 Bacteria 1163
223 Ga0207689_10665367 3300025942 Unclassified 878
224 Ga0207679_10117777 3300025945 Bacteria 2108
225 Ga0207679_10296528 3300025945 Bacteria 1392
226 Ga0207667_10534727 3300025949 Unclassified 1186
227 Ga0207651_11138000 3300025960 Bacteria 700
228 Ga0207712_10010694 3300025961 Bacteria 5828
229 Ga0207640_10206160 3300025981 Bacteria 1494
230 Ga0207640_10302511 3300025981 Unclassified 1266
231 Ga0207677_10238515 3300026023 Bacteria 1469
232 Ga0207703_10184897 3300026035 Unclassified 1841
233 Ga0207703_11324061 3300026035 Unclassified 693
234 Ga0207639_10782906 3300026041 Unclassified 888
235 Ga0207639_11238724 3300026041 Unclassified 700
236 Ga0207708_10047434 3300026075 Bacteria 3270
237 Ga0207708_10450802 3300026075 Bacteria 1071
238 Ga0207641_10028015 3300026088 Bacteria 4653
239 Ga0207641_10092162 3300026088 Bacteria 2654
240 Ga0207641_10856890 3300026088 Unclassified 901
241 Ga0207648_10086267 3300026089 Bacteria 2739
242 Ga0207648_10734315 3300026089 Unclassified 916
243 Ga0207676_10002901 3300026095 Bacteria 12223
244 Ga0207676_10306864 3300026095 Unclassified 1451
245 Ga0207676_10404672 3300026095 Bacteria 1276
246 Ga0207676_10901675 3300026095 Unclassified 867
247 Ga0207676_11562569 3300026095 Unclassified 657
248 Ga0207674_10005703 3300026116 Bacteria 14765
249 Ga0207674_10053757 3300026116 Bacteria 4103
250 Ga0207674_10225407 3300026116 Bacteria 1823
251 Ga0207674_10524785 3300026116 Bacteria 1144
252 Ga0207674_10534541 3300026116 Unclassified 1132
253 Ga0207674_10550895 3300026116 Unclassified 1114
254 Ga0207674_10737896 3300026116 Unclassified 950
255 Ga0207674_11132059 3300026116 Bacteria 752
256 Ga0207674_11168252 3300026116 Unclassified 739
257 Ga0207675_100018694 3300026118 Bacteria 6468
258 Ga0207675_100568350 3300026118 Bacteria 1134
259 Ga0207675_100586114 3300026118 Bacteria 1117
260 Ga0207675_101249586 3300026118 Bacteria 763
261 Ga0207698_10126463 3300026142 Bacteria 2175
262 Ga0268265_10039214 3300028380 Bacteria 3490
263 Ga0268265_10103050 3300028380 Bacteria 2310
264 Ga0268265_10198579 3300028380 Unclassified 1738
265 Ga0268264_10107557 3300028381 Bacteria 2436
266 Ga0268264_10443181 3300028381 Bacteria 1257
267 Ga0268264_11095646 3300028381 Unclassified 805
268 Ga0307408_100075871 3300031548 Bacteria 2499
269 Ga0307408_100488712 3300031548 Bacteria 1075
270 Ga0307408_101744083 3300031548 Bacteria 594
271 Ga0307405_10197712 3300031731 Bacteria 1457
272 Ga0307410_10876471 3300031852 Unclassified 768
273 Ga0307412_10106385 3300031911 Bacteria 1994
274 Ga0307409_100009651 3300031995 Bacteria 5946
275 Ga0307416_101610325 3300032002 Bacteria 754
276 Ga0307414_10039196 3300032004 Bacteria 3190
277 Ga0307414_10398481 3300032004 Bacteria 1195
278 Ga0307411_10011087 3300032005 Bacteria 4843
279 Ga0373929_0057731 3300035085 Unclassified 902
280 Ga0373951_0020496 3300035091 Unclassified 1514
281 Ga0373942_0009849 3300035207 Bacteria 2238
282 Ga0395899_0476183 3300037312 Unclassified 814
283 Ga0395899_0551510 3300037312 Unclassified 741
284 Ga0395900_0103642 3300037418 Bacteria 2922
285 Ga0395900_1294906 3300037418 Bacteria 643
286 Ga0395898_0111606 3300037466 Unclassified 2621
287 Ga0395898_0284497 3300037466 Bacteria 1577
288 Ga0395905_1486789 3300037471 Bacteria 582
289 Ga0495643_0108999 3300046522 Bacteria 1410
290 Ga0496104_0409204 3300048907 Bacteria 1269
291 Ga0496112_0519069 3300048915 Bacteria 1126
292 Ga0496113_0164198 3300048916 Unclassified 1757
293 Ga0501296_001379 3300049519 Bacteria 2457
294 Ga0501300_052246 3300049523 Unclassified 633
295 Ga0501038_0009938 3300049574 Bacteria 8712
296 Ga0501198_019762 3300049649 Unclassified 1064
297 Ga0501198_046138 3300049649 Bacteria 766
298 Ga0501201_002870 3300049651 Bacteria 1577
299 Ga0501217_006638 3300049661 Bacteria 2465
300 Ga0501223_016592 3300049663 Bacteria 1455
301 Ga0501224_008281 3300049664 Unclassified 1516
302 Ga0501224_020099 3300049664 Bacteria 995
303 Ga0501227_042880 3300049665 Bacteria 1123
304 Ga0501228_059856 3300049666 Bacteria 537
305 Ga0501230_038532 3300049667 Bacteria 919
306 Ga0501233_001478 3300049668 Bacteria 4009
307 Ga0501233_005586 3300049668 Unclassified 2337
308 Ga0501235_043700 3300049669 Bacteria 1028
309 Ga0501235_098236 3300049669 Bacteria 713
310 Ga0501259_008595 3300049688 Bacteria 1647
311 Ga0501221_005760 3300049704 Bacteria 2079
312 Ga0501234_002930 3300049707 Bacteria 2684
313 Ga0501264_015686 3300049761 Bacteria 766
314 Ga0501279_003746 3300049775 Bacteria 1989
315 Ga0501280_085415 3300049776 Unclassified 587
316 Ga0501282_035728 3300049778 Bacteria 581
317 Ga0501283_058738 3300049779 Unclassified 692
318 nmdc:mga05p37_153839_c1 3300050507 Bacteria 2812
319 nmdc:mga05p37_309241_c1 3300050507 Bacteria 1874
320 nmdc:mga0qj67_153096_c1 3300050509 Bacteria 1871
321 nmdc:mga0n895_108330_c1 3300050512 Bacteria 2792
322 nmdc:mga0n895_471304_c1 3300050512 Bacteria 1267
323 nmdc:mga0a205_243942_c1 3300050515 Unclassified 1677
324 nmdc:mga0a205_60429_c1 3300050515 Unclassified 3660
325 Ga0207708_10187107
326 JGI24751J29686_10000007
327 rootH2_10227174
328 rootL2_10152885
329 Ga0065715_10027722
330 Ga0070690_100212228
331 Ga0070670_100000043
332 Ga0070670_100046131
333 Ga0070670_100457509
334 Ga0070670_100522691
335 Ga0068869_100309948
336 Ga0068869_100468756
337 Ga0068869_100898506
338 Ga0070666_10197115
339 Ga0070680_100033862
340 Ga0070680_100753905
341 Ga0070660_100027614
342 Ga0070660_100195805
343 Ga0070689_100004774
344 Ga0070689_100879388
345 Ga0070661_100050027
346 Ga0070692_10022568
347 Ga0070692_10038251
348 Ga0070669_100077686
349 Ga0070669_100400750
350 Ga0070669_100816680
351 Ga0070675_100145482
352 Ga0070671_100028267
353 Ga0070673_100104590
354 Ga0070673_100299306
355 Ga0070673_101499540
356 Ga0070659_100087556
357 Ga0070659_100113559
358 Ga0070701_10231027
359 Ga0070701_10357909
360 Ga0070705_100016825
361 Ga0070705_100160580
362 Ga0070705_100398977
363 Ga0070705_101377353
364 Ga0070700_100019680
365 Ga0070700_100910756
366 Ga0070694_100588621
367 Ga0070694_100863518
368 Ga0070694_101397134
369 Ga0070708_101059966
370 Ga0070678_100751412
371 Ga0070681_10023175
372 Ga0070681_10122933
373 Ga0068867_100082559
374 Ga0070706_100000031
375 Ga0070707_100049626
376 Ga0070707_100795251
377 Ga0070698_100089118
378 Ga0070698_100404503
379 Ga0070699_100295300
380 Ga0070684_100215904
381 Ga0068853_100051487
382 Ga0068853_100068580
383 Ga0070695_100108000
384 Ga0070695_100346497
385 Ga0070695_100583776
386 Ga0070695_100625046
387 Ga0070696_100038479
388 Ga0070696_100114641
389 Ga0070696_101563506
390 Ga0070693_100031197
391 Ga0070693_100055306
392 Ga0070693_100188320
393 Ga0070693_100378511
394 Ga0070704_100044920
395 Ga0070704_100085609
396 Ga0070704_100144026
397 Ga0070704_100369738
398 Ga0068855_100574821
399 Ga0070664_100165169
400 Ga0070664_100409088
401 Ga0070664_100502922
402 Ga0068857_100002653
403 Ga0068857_100221365
404 Ga0068857_100230298
405 Ga0068857_100265627
406 Ga0068857_100587451
407 Ga0068857_100679715
408 Ga0068857_100832112
409 Ga0068857_101401941
410 Ga0068856_100016162
411 Ga0070702_100021407
412 Ga0070702_100061491
413 Ga0070702_101095517
414 Ga0068852_100693469
415 Ga0068859_100005802
416 Ga0068859_100043647
417 Ga0068859_100121450
418 Ga0068859_100147946
419 Ga0068859_100201643
420 Ga0068859_100234946
421 Ga0068859_100386932
422 Ga0068859_102514651
423 Ga0068864_100039963
424 Ga0068864_100113755
425 Ga0068864_100222330
426 Ga0068864_100228836
427 Ga0068864_101125699
428 Ga0068861_100003435
429 Ga0068870_10002974
430 Ga0068870_10476206
431 Ga0068863_100099075
432 Ga0068863_100115061
433 Ga0068863_100295102
434 Ga0068863_100296658
435 Ga0068858_100070949
436 Ga0068858_100285970
437 Ga0068858_101001203
438 Ga0068858_101228778
439 Ga0068860_100230248
440 Ga0068862_100029656
441 Ga0097621_100236218
442 Ga0097621_101248500
443 Ga0068871_100157598
444 Ga0075428_100905594
445 Ga0075430_100201277
446 Ga0075430_100719898
447 Ga0075433_10640483
448 Ga0075434_100079237
449 Ga0075434_100892595
450 Ga0075429_100494437
451 Ga0068865_100350610
452 Ga0097620_100005803
453 Ga0097620_100032105
454 Ga0097620_100043646
455 Ga0097620_100121436
456 Ga0097620_100147950
457 Ga0097620_100201638
458 Ga0097620_100234966
459 Ga0097620_100386922
460 Ga0097620_102513570
461 Ga0105240_10643293
462 Ga0105240_11684519
463 Ga0111539_10280814
464 Ga0105245_11847554
465 Ga0105247_10003912
466 Ga0105247_10812882
467 Ga0114129_10046507
468 Ga0105243_10039486
469 Ga0105243_10075687
470 Ga0105243_10184693
471 Ga0105243_11314459
472 Ga0105241_10016849
473 Ga0105241_10029110
474 Ga0105241_10253744
475 Ga0105241_10271280
476 Ga0105241_11052617
477 Ga0105248_10088843
478 Ga0105248_10115942
479 Ga0105248_10438018
480 Ga0105237_10035578
481 Ga0105237_10285367
482 Ga0105238_10291958
483 Ga0105238_10921013
484 Ga0105249_10280139
485 Ga0105249_10449062
486 Ga0105249_10494478
487 Ga0105249_11680510
488 Ga0105239_10281088
489 Ga0105239_10360584
490 Ga0105246_10042173
491 Ga0105246_10335971
492 Ga0157373_10011634
493 Ga0157373_10060001
494 Ga0157373_10216901
495 Ga0157378_11081969
496 Ga0157378_11244022
497 Ga0157378_11321032
498 Ga0163162_10113520
499 Ga0163162_10529297
500 Ga0157372_10421489
501 Ga0157372_10954367
502 Ga0157375_10059954
503 Ga0157375_10065295
504 Ga0157375_10171349
505 Ga0157375_10233386
506 Ga0163163_10000559
507 Ga0163163_10507285
508 Ga0163163_11178646
509 Ga0157380_10598409
510 Ga0157380_10748895
511 Ga0157377_10009620
512 Ga0157377_10411087
513 Ga0207643_10013282
514 Ga0207643_10068668
515 Ga0207643_10120197
516 Ga0207684_10000110
517 Ga0207684_10360266
518 Ga0207654_10058982
519 Ga0207654_10246411
520 Ga0207654_10496666
521 Ga0207707_10007941
522 Ga0207707_10112822
523 Ga0207695_10170069
524 Ga0207695_10454920
525 Ga0207657_10283438
526 Ga0207649_10816730
527 Ga0207646_10078683
528 Ga0207681_10069515
529 Ga0207694_10655667
530 Ga0207650_10000009
531 Ga0207650_10034364
532 Ga0207650_10205790
533 Ga0207650_10591147
534 Ga0207650_10594799
535 Ga0207650_10633824
536 Ga0207659_10331631
537 Ga0207687_11331504
538 Ga0207690_10104515
539 Ga0207690_10168064
540 Ga0207709_10001174
541 Ga0207709_10435758
542 Ga0207670_10002181
543 Ga0207704_10485729
544 Ga0207665_10317771
545 Ga0207711_10242008
546 Ga0207711_10475827
547 Ga0207689_10665367
548 Ga0207679_10117777
549 Ga0207679_10296528
550 Ga0207667_10534727
551 Ga0207651_11138000
552 Ga0207712_10010694
553 Ga0207640_10206160
554 Ga0207640_10302511
555 Ga0207677_10238515
556 Ga0207703_10184897
557 Ga0207703_11324061
558 Ga0207639_10782906
559 Ga0207639_11238724
560 Ga0207708_10047434
561 Ga0207708_10450802
562 Ga0207641_10028015
563 Ga0207641_10092162
564 Ga0207641_10856890
565 Ga0207648_10086267
566 Ga0207648_10734315
567 Ga0207676_10002901
568 Ga0207676_10306864
569 Ga0207676_10404672
570 Ga0207676_10901675
571 Ga0207676_11562569
572 Ga0207674_10005703
573 Ga0207674_10053757
574 Ga0207674_10225407
575 Ga0207674_10524785
576 Ga0207674_10534541
577 Ga0207674_10550895
578 Ga0207674_10737896
579 Ga0207674_11132059
580 Ga0207674_11168252
581 Ga0207675_100018694
582 Ga0207675_100568350
583 Ga0207675_100586114
584 Ga0207675_101249586
585 Ga0207698_10126463
586 Ga0268265_10039214
587 Ga0268265_10103050
588 Ga0268265_10198579
589 Ga0268264_10107557
590 Ga0268264_10443181
591 Ga0268264_11095646
592 Ga0307408_100075871
593 Ga0307408_100488712
594 Ga0307408_101744083
595 Ga0307405_10197712
596 Ga0307410_10876471
597 Ga0307412_10106385
598 Ga0307409_100009651
599 Ga0307416_101610325
600 Ga0307414_10039196
601 Ga0307414_10398481
602 Ga0307411_10011087
603 Ga0373929_0057731
604 Ga0373951_0020496
605 Ga0373942_0009849
606 Ga0395899_0476183
607 Ga0395899_0551510
608 Ga0395900_0103642
609 Ga0395900_1294906
610 Ga0395898_0111606
611 Ga0395898_0284497
612 Ga0395905_1486789
613 Ga0495643_0108999
614 Ga0496104_0409204
615 Ga0496112_0519069
616 Ga0496113_0164198
617 Ga0501296_001379
618 Ga0501300_052246
619 Ga0501038_0009938
620 Ga0501198_019762
621 Ga0501198_046138
622 Ga0501201_002870
623 Ga0501217_006638
624 Ga0501223_016592
625 Ga0501224_008281
626 Ga0501224_020099
627 Ga0501227_042880
628 Ga0501228_059856
629 Ga0501230_038532
630 Ga0501233_001478
631 Ga0501233_005586
632 Ga0501235_043700
633 Ga0501235_098236
634 Ga0501259_008595
635 Ga0501221_005760
636 Ga0501234_002930
637 Ga0501264_015686
638 Ga0501279_003746
639 Ga0501280_085415
640 Ga0501282_035728
641 Ga0501283_058738
642 nmdc:mga05p37_153839_c1
643 nmdc:mga05p37_309241_c1
644 nmdc:mga0qj67_153096_c1
645 nmdc:mga0n895_108330_c1
646 nmdc:mga0n895_471304_c1
647 nmdc:mga0a205_243942_c1
648 nmdc:mga0a205_60429_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map