F407344

General Info

Members Datasets Scaffolds Average Seq Length
324 201 648 163

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10223845|Ga0105241_102238452
Length 180
Sequence VLKAKNYKPKNKRRGYFMKNTGTLKVTTPSDREITLTRVFDAPRKLVYDAFTKPELLKRWFGPRGWSLVVCDIDLKVGGGFRFVMRGPDGKDMGMRGVYRELVPPDRSVHMESFDDFPGEAQVTAVFVEQSGKTTMTATVLYPSKEVRDAVIQSSMEHGAAESYDKLAELLNQTSSQEVA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 0
Rhizoplane 0.31
Rhizosphere 90.43
Stem 0
Stem Tuber 0
Unclassified 26.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10223845 3300009174 Unclassified 1583
2 MRS1b_contig_9068021 2162886011 Unclassified 976
3 Ga0065712_10290218 3300005290 Unclassified 879
4 Ga0070658_10889101 3300005327 Unclassified 774
5 Ga0070676_10240229 3300005328 Bacteria 1204
6 Ga0070676_10251888 3300005328 Unclassified 1179
7 Ga0070676_10336822 3300005328 Unclassified 1033
8 Ga0070683_100000032 3300005329 Bacteria 148421
9 Ga0070683_101544927 3300005329 Unclassified 638
10 Ga0070690_100000902 3300005330 Bacteria 15119
11 Ga0070670_100656855 3300005331 Bacteria 941
12 Ga0068869_100019251 3300005334 Unclassified 4659
13 Ga0068869_100140530 3300005334 Unclassified 1864
14 Ga0068869_100592764 3300005334 Unclassified 935
15 Ga0070666_10186466 3300005335 Bacteria 1456
16 Ga0070680_100075366 3300005336 Unclassified 2777
17 Ga0068868_100000808 3300005338 Bacteria 21230
18 Ga0068868_100119795 3300005338 Bacteria 2146
19 Ga0070660_100049755 3300005339 Bacteria 3223
20 Ga0070660_101055390 3300005339 Unclassified 687
21 Ga0070689_100328944 3300005340 Bacteria 1278
22 Ga0070661_100738327 3300005344 Bacteria 804
23 Ga0070661_101596965 3300005344 Unclassified 551
24 Ga0070669_100335636 3300005353 Bacteria 1224
25 Ga0070675_100161912 3300005354 Bacteria 1924
26 Ga0070671_100292796 3300005355 Bacteria 1385
27 Ga0070671_100426081 3300005355 Bacteria 1137
28 Ga0070673_101065060 3300005364 Bacteria 754
29 Ga0070688_100037285 3300005365 Bacteria 2961
30 Ga0070688_100710319 3300005365 Unclassified 779
31 Ga0070659_100002176 3300005366 Bacteria 13963
32 Ga0070667_100164956 3300005367 Bacteria 1953
33 Ga0070667_100310473 3300005367 Unclassified 1421
34 Ga0070709_10340629 3300005434 Bacteria 1105
35 Ga0070714_100473729 3300005435 Bacteria 1192
36 Ga0070701_10012203 3300005438 Bacteria 3868
37 Ga0070694_100036750 3300005444 Bacteria 3246
38 Ga0070694_100719353 3300005444 Bacteria 813
39 Ga0070708_100003900 3300005445 Bacteria 11706
40 Ga0070708_100491727 3300005445 Bacteria 1157
41 Ga0070678_100314306 3300005456 Bacteria 1336
42 Ga0070678_101401997 3300005456 Unclassified 652
43 Ga0070662_100183654 3300005457 Bacteria 1650
44 Ga0070681_10002672 3300005458 Bacteria 16373
45 Ga0070681_10635576 3300005458 Bacteria 982
46 Ga0070685_10002796 3300005466 Bacteria 8917
47 Ga0070685_10274600 3300005466 Unclassified 1126
48 Ga0070685_11242118 3300005466 Unclassified 567
49 Ga0070706_100000257 3300005467 Bacteria 64534
50 Ga0070699_100146711 3300005518 Bacteria 2085
51 Ga0070699_100193339 3300005518 Bacteria 1808
52 Ga0070679_100009414 3300005530 Bacteria 9240
53 Ga0070684_100000422 3300005535 Bacteria 29069
54 Ga0070697_100014325 3300005536 Bacteria 6230
55 Ga0070697_100136325 3300005536 Bacteria 2061
56 Ga0068853_100029715 3300005539 Bacteria 4610
57 Ga0070686_100007068 3300005544 Bacteria 6259
58 Ga0070686_100009760 3300005544 Bacteria 5393
59 Ga0070695_100234397 3300005545 Bacteria 1328
60 Ga0070693_100020692 3300005547 Bacteria 3475
61 Ga0070665_100014398 3300005548 Bacteria 7938
62 Ga0070665_100228440 3300005548 Unclassified 1861
63 Ga0070704_100810731 3300005549 Bacteria 837
64 Ga0068855_100071139 3300005563 Bacteria 4046
65 Ga0068855_100119746 3300005563 Bacteria 3014
66 Ga0068855_100467232 3300005563 Unclassified 1375
67 Ga0070664_100019900 3300005564 Bacteria 5524
68 Ga0068857_100015864 3300005577 Bacteria 6593
69 Ga0068854_100246607 3300005578 Unclassified 1424
70 Ga0068852_100138641 3300005616 Bacteria 2249
71 Ga0068859_100186969 3300005617 Bacteria 2155
72 Ga0068859_100351230 3300005617 Bacteria 1569
73 Ga0068859_100452112 3300005617 Unclassified 1381
74 Ga0068859_101494132 3300005617 Bacteria 746
75 Ga0068864_100126768 3300005618 Bacteria 2288
76 Ga0068864_100227786 3300005618 Bacteria 1722
77 Ga0068864_100242572 3300005618 Bacteria 1670
78 Ga0068864_100660406 3300005618 Bacteria 1019
79 Ga0068864_100969178 3300005618 Unclassified 842
80 Ga0068866_10084446 3300005718 Unclassified 1713
81 Ga0068851_10132232 3300005834 Unclassified 1350
82 Ga0068863_100032098 3300005841 Bacteria 5008
83 Ga0068863_100465794 3300005841 Bacteria 1241
84 Ga0068863_100862005 3300005841 Unclassified 905
85 Ga0068858_100124716 3300005842 Unclassified 2410
86 Ga0068858_100257970 3300005842 Bacteria 1657
87 Ga0068858_100369453 3300005842 Bacteria 1375
88 Ga0068860_100024688 3300005843 Bacteria 5805
89 Ga0068860_100026071 3300005843 Bacteria 5638
90 Ga0068862_100236357 3300005844 Bacteria 1659
91 Ga0081540_1015752 3300005983 Bacteria 4770
92 Ga0081539_10053771 3300005985 Bacteria 2252
93 Ga0075365_10099883 3300006038 Bacteria 1986
94 Ga0075368_10000977 3300006042 Bacteria 8925
95 Ga0075363_100009990 3300006048 Bacteria 4483
96 Ga0075364_10003535 3300006051 Bacteria 8892
97 Ga0070715_10029544 3300006163 Bacteria 2208
98 Ga0070716_100000345 3300006173 Bacteria 18865
99 Ga0070712_100001029 3300006175 Bacteria 16833
100 Ga0075362_10002996 3300006177 Bacteria 5814
101 Ga0075367_10007626 3300006178 Bacteria 5555
102 Ga0075369_10002489 3300006186 Bacteria 6578
103 Ga0075366_10004131 3300006195 Bacteria 7769
104 Ga0097621_100002240 3300006237 Bacteria 13247
105 Ga0097621_101099385 3300006237 Bacteria 746
106 Ga0075370_10479727 3300006353 Bacteria 749
107 Ga0068871_100001868 3300006358 Bacteria 14246
108 Ga0068871_100207993 3300006358 Bacteria 1692
109 Ga0068871_100438115 3300006358 Unclassified 1169
110 Ga0068871_100925086 3300006358 Unclassified 809
111 Ga0075430_100037135 3300006846 Bacteria 4130
112 Ga0075430_101110050 3300006846 Bacteria 651
113 Ga0075431_100012081 3300006847 Bacteria 8715
114 Ga0075431_100081329 3300006847 Bacteria 3345
115 Ga0075429_100257138 3300006880 Bacteria 1529
116 Ga0075429_101576356 3300006880 Bacteria 571
117 Ga0097620_100186949 3300006931 Bacteria 2155
118 Ga0097620_100351230 3300006931 Bacteria 1569
119 Ga0097620_100452099 3300006931 Unclassified 1381
120 Ga0097620_101494025 3300006931 Bacteria 746
121 Ga0105240_10227841 3300009093 Bacteria 2167
122 Ga0105240_10230045 3300009093 Bacteria 2155
123 Ga0105245_10424672 3300009098 Unclassified 1333
124 Ga0105245_12204150 3300009098 Unclassified 605
125 Ga0105247_10004309 3300009101 Bacteria 9096
126 Ga0105247_10005843 3300009101 Bacteria 7693
127 Ga0114129_10299396 3300009147 Unclassified 2144
128 Ga0114129_11778263 3300009147 Unclassified 750
129 Ga0105243_10144374 3300009148 Bacteria 2034
130 Ga0105243_10366602 3300009148 Bacteria 1328
131 Ga0105243_11034001 3300009148 Bacteria 826
132 Ga0105241_10067199 3300009174 Bacteria 2774
133 Ga0105242_10011273 3300009176 Bacteria 6869
134 Ga0105242_10277193 3300009176 Bacteria 1521
135 Ga0105248_10159419 3300009177 Unclassified 2545
136 Ga0105248_10215806 3300009177 Bacteria 2161
137 Ga0105248_10345491 3300009177 Bacteria 1675
138 Ga0105248_12007215 3300009177 Bacteria 657
139 Ga0105238_11727461 3300009551 Bacteria 657
140 Ga0105249_10231235 3300009553 Bacteria 1824
141 Ga0105249_10549797 3300009553 Bacteria 1205
142 Ga0105249_10686236 3300009553 Bacteria 1083
143 Ga0105239_10017843 3300010375 Bacteria 7849
144 Ga0105239_10160443 3300010375 Bacteria 2512
145 Ga0105239_10372204 3300010375 Bacteria 1615
146 Ga0105239_10510748 3300010375 Bacteria 1367
147 Ga0105239_11447488 3300010375 Bacteria 793
148 Ga0105246_10735394 3300011119 Bacteria 868
149 Ga0105246_11000473 3300011119 Unclassified 757
150 Ga0157373_10003721 3300013100 Bacteria 11536
151 Ga0157371_10050805 3300013102 Unclassified 2947
152 Ga0157370_10127442 3300013104 Bacteria 2376
153 Ga0157370_10551550 3300013104 Bacteria 1056
154 Ga0157370_10553349 3300013104 Bacteria 1055
155 Ga0157369_10058630 3300013105 Bacteria 4153
156 Ga0157374_10109127 3300013296 Bacteria 2660
157 Ga0157374_10266433 3300013296 Bacteria 1689
158 Ga0157374_12034446 3300013296 Bacteria 601
159 Ga0157378_10000925 3300013297 Bacteria 27033
160 Ga0157378_10338646 3300013297 Bacteria 1466
161 Ga0157378_10372259 3300013297 Unclassified 1401
162 Ga0163162_10158057 3300013306 Unclassified 2388
163 Ga0163162_10271614 3300013306 Bacteria 1827
164 Ga0163162_10440754 3300013306 Bacteria 1435
165 Ga0163162_10457321 3300013306 Bacteria 1408
166 Ga0163162_11343945 3300013306 Unclassified 812
167 Ga0157375_10580491 3300013308 Bacteria 1281
168 Ga0157375_10735486 3300013308 Bacteria 1139
169 Ga0157375_12233491 3300013308 Unclassified 652
170 Ga0157375_12264425 3300013308 Unclassified 648
171 Ga0163163_10004824 3300014325 Bacteria 11583
172 Ga0163163_10408055 3300014325 Bacteria 1417
173 Ga0163163_10520282 3300014325 Bacteria 1252
174 Ga0163163_10559221 3300014325 Bacteria 1207
175 Ga0163163_11081674 3300014325 Bacteria 865
176 Ga0163163_11088715 3300014325 Unclassified 862
177 Ga0163163_11239914 3300014325 Bacteria 808
178 Ga0157380_10002895 3300014326 Bacteria 11664
179 Ga0157380_10083471 3300014326 Unclassified 2617
180 Ga0157377_10044636 3300014745 Bacteria 2472
181 Ga0157379_10795334 3300014968 Bacteria 892
182 Ga0157379_10897737 3300014968 Unclassified 840
183 Ga0157376_10029797 3300014969 Bacteria 4351
184 Ga0157376_10297806 3300014969 Bacteria 1526
185 Ga0157376_10356243 3300014969 Bacteria 1402
186 Ga0157376_10461765 3300014969 Bacteria 1241
187 Ga0182007_10107353 3300015262 Bacteria 927
188 Ga0163161_10543901 3300017792 Bacteria 951
189 Ga0224712_10103613 3300022467 Bacteria 1210
190 Ga0207656_10163787 3300025321 Unclassified 1060
191 Ga0207710_10005986 3300025900 Bacteria 5216
192 Ga0207710_10249201 3300025900 Unclassified 888
193 Ga0207685_10007373 3300025905 Bacteria 3061
194 Ga0207645_10034465 3300025907 Bacteria 3253
195 Ga0207645_10200214 3300025907 Bacteria 1314
196 Ga0207643_10065757 3300025908 Unclassified 2078
197 Ga0207684_10002463 3300025910 Bacteria 18645
198 Ga0207654_10060999 3300025911 Bacteria 2205
199 Ga0207654_10409782 3300025911 Bacteria 944
200 Ga0207654_10555491 3300025911 Unclassified 816
201 Ga0207707_10078152 3300025912 Unclassified 2889
202 Ga0207695_11238575 3300025913 Unclassified 626
203 Ga0207693_10008428 3300025915 Bacteria 8433
204 Ga0207663_10062629 3300025916 Bacteria 2365
205 Ga0207660_10101527 3300025917 Bacteria 2149
206 Ga0207662_10367379 3300025918 Unclassified 969
207 Ga0207657_10033281 3300025919 Bacteria 4648
208 Ga0207649_11351376 3300025920 Unclassified 564
209 Ga0207652_10079180 3300025921 Bacteria 2870
210 Ga0207652_10562153 3300025921 Bacteria 1024
211 Ga0207681_10573744 3300025923 Bacteria 930
212 Ga0207650_10271284 3300025925 Bacteria 1379
213 Ga0207659_10627759 3300025926 Unclassified 917
214 Ga0207687_10080433 3300025927 Unclassified 2352
215 Ga0207664_10595887 3300025929 Bacteria 992
216 Ga0207644_10461122 3300025931 Bacteria 1045
217 Ga0207706_10217084 3300025933 Unclassified 1675
218 Ga0207706_10502339 3300025933 Unclassified 1047
219 Ga0207686_10009640 3300025934 Bacteria 5243
220 Ga0207670_10174241 3300025936 Bacteria 1615
221 Ga0207704_10856190 3300025938 Bacteria 762
222 Ga0207665_10000147 3300025939 Bacteria 47628
223 Ga0207691_10015153 3300025940 Bacteria 7336
224 Ga0207691_10380516 3300025940 Bacteria 1205
225 Ga0207711_10054654 3300025941 Unclassified 3427
226 Ga0207711_10946286 3300025941 Unclassified 800
227 Ga0207711_11412166 3300025941 Unclassified 639
228 Ga0207689_10004427 3300025942 Bacteria 12744
229 Ga0207689_10114690 3300025942 Bacteria 2215
230 Ga0207661_10000020 3300025944 Bacteria 216011
231 Ga0207667_10069136 3300025949 Bacteria 3676
232 Ga0207667_10174676 3300025949 Bacteria 2208
233 Ga0207651_10635840 3300025960 Unclassified 936
234 Ga0207712_10032263 3300025961 Bacteria 3535
235 Ga0207668_10112074 3300025972 Bacteria 2049
236 Ga0207640_10320587 3300025981 Unclassified 1234
237 Ga0207658_10528370 3300025986 Bacteria 1053
238 Ga0207677_10029359 3300026023 Bacteria 3494
239 Ga0207703_10102325 3300026035 Bacteria 2430
240 Ga0207703_10103063 3300026035 Unclassified 2422
241 Ga0207703_10147273 3300026035 Bacteria 2049
242 Ga0207703_10900494 3300026035 Unclassified 847
243 Ga0207703_11185299 3300026035 Bacteria 734
244 Ga0207703_11909245 3300026035 Unclassified 570
245 Ga0207639_10009859 3300026041 Bacteria 6597
246 Ga0207641_10421946 3300026088 Bacteria 1284
247 Ga0207641_11786003 3300026088 Bacteria 617
248 Ga0207676_10171973 3300026095 Bacteria 1888
249 Ga0207676_10280512 3300026095 Bacteria 1512
250 Ga0207676_11613578 3300026095 Bacteria 646
251 Ga0207674_10001245 3300026116 Bacteria 33264
252 Ga0207683_10034974 3300026121 Unclassified 4370
253 Ga0207683_10360078 3300026121 Bacteria 1336
254 Ga0207683_10635007 3300026121 Unclassified 989
255 Ga0207698_10104123 3300026142 Bacteria 2360
256 Ga0207698_10253193 3300026142 Bacteria 1613
257 Ga0209813_10001113 3300027866 Bacteria 5991
258 Ga0268266_10001953 3300028379 Bacteria 23179
259 Ga0268266_10262580 3300028379 Bacteria 1601
260 Ga0268266_10418772 3300028379 Unclassified 1269
261 Ga0268265_11270825 3300028380 Bacteria 735
262 Ga0268264_10026105 3300028381 Unclassified 4770
263 Ga0268264_10171147 3300028381 Bacteria 1964
264 Ga0268264_10938457 3300028381 Unclassified 870
265 Ga0268264_11110809 3300028381 Bacteria 799
266 Ga0307515_10239118 3300028794 Bacteria 1591
267 Ga0265327_10004481 3300031251 Bacteria 12344
268 Ga0307513_10077808 3300031456 Bacteria 3433
269 Ga0307410_11806475 3300031852 Bacteria 543
270 Ga0373934_0066386 3300035086 Unclassified 1441
271 Ga0373934_0125258 3300035086 Bacteria 1046
272 Ga0373939_0021572 3300035114 Bacteria 1765
273 Ga0373946_0407659 3300035171 Unclassified 687
274 Ga0373935_0225284 3300035692 Bacteria 1304
275 Ga0373933_0372488 3300035724 Unclassified 929
276 Ga0373937_0002838 3300036401 Bacteria 14483
277 Ga0373937_0655383 3300036401 Unclassified 995
278 Ga0373925_0200232 3300037068 Bacteria 1588
279 Ga0373925_0723843 3300037068 Bacteria 820
280 Ga0395900_0337295 3300037418 Bacteria 1484
281 Ga0395898_0116536 3300037466 Unclassified 2560
282 Ga0466967_0303650 3300045976 Bacteria 1536
283 Ga0495580_0040288 3300046472 Bacteria 3338
284 Ga0495580_0360768 3300046472 Bacteria 983
285 Ga0495630_0611935 3300046517 Unclassified 835
286 Ga0495665_0154515 3300046531 Bacteria 1197
287 Ga0495640_0054520 3300046533 Unclassified 2738
288 Ga0495645_0202581 3300046543 Bacteria 1345
289 Ga0495635_0608683 3300046663 Unclassified 713
290 Ga0495657_0263539 3300046675 Unclassified 1035
291 Ga0495674_0061443 3300047319 Bacteria 3274
292 Ga0495675_0520771 3300047444 Unclassified 681
293 Ga0495684_0017921 3300047471 Bacteria 5456
294 Ga0495602_0310739 3300048088 Unclassified 1150
295 Ga0496115_0869736 3300048918 Unclassified 697
296 Ga0501034_0170649 3300049571 Bacteria 2143
297 Ga0501034_0425857 3300049571 Unclassified 1248
298 Ga0501043_0106157 3300049579 Bacteria 2206
299 nmdc:mga03683_2495_c1 3300050489 Bacteria 5726
300 nmdc:mga03n38_6537_c1 3300050490 Bacteria 4059
301 nmdc:mga00v17_53257_c1 3300050491 Bacteria 2466
302 nmdc:mga0yw44_7999_c1 3300050492 Bacteria 5242
303 nmdc:mga0k408_68787_c1 3300050493 Bacteria 2066
304 nmdc:mga06z11_6196_c1 3300050494 Bacteria 4848
305 nmdc:mga04h51_1388_c1 3300050495 Bacteria 5588
306 nmdc:mga07m45_217713_c1 3300050496 Bacteria 1111
307 nmdc:mga07m45_30488_c1 3300050496 Bacteria 2987
308 nmdc:mga09592_1240432_c1 3300050508 Bacteria 615
309 nmdc:mga09592_360038_c1 3300050508 Bacteria 1259
310 nmdc:mga0qj67_97958_c1 3300050509 Bacteria 2362
311 nmdc:mga06r32_108094_c1 3300050510 Bacteria 2734
312 nmdc:mga06r32_97146_c1 3300050510 Bacteria 2886
313 nmdc:mga0rr50_433725_c1 3300050513 Bacteria 1112
314 nmdc:mga0a205_331894_c1 3300050515 Unclassified 1390
315 nmdc:mga0sz30_12396_c1 3300050516 Bacteria 3317
316 Ga0495612_0105451 3300053078 Unclassified 1203
317 Ga0500583_0087106 3300053092 Bacteria 1516
318 Ga0500641_0023161 3300053096 Bacteria 2386
319 Ga0500641_0135652 3300053096 Bacteria 1062
320 Ga0500556_0035412 3300053104 Bacteria 1724
321 Ga0500594_0006130 3300053118 Unclassified 2692
322 Ga0500617_041198 3300053124 Bacteria 2065
323 Ga0500588_0199907 3300053146 Bacteria 740
324 Ga0500656_011053 3300053732 Unclassified 998
325 Ga0105241_10223845
326 MRS1b_contig_9068021
327 Ga0065712_10290218
328 Ga0070658_10889101
329 Ga0070676_10240229
330 Ga0070676_10251888
331 Ga0070676_10336822
332 Ga0070683_100000032
333 Ga0070683_101544927
334 Ga0070690_100000902
335 Ga0070670_100656855
336 Ga0068869_100019251
337 Ga0068869_100140530
338 Ga0068869_100592764
339 Ga0070666_10186466
340 Ga0070680_100075366
341 Ga0068868_100000808
342 Ga0068868_100119795
343 Ga0070660_100049755
344 Ga0070660_101055390
345 Ga0070689_100328944
346 Ga0070661_100738327
347 Ga0070661_101596965
348 Ga0070669_100335636
349 Ga0070675_100161912
350 Ga0070671_100292796
351 Ga0070671_100426081
352 Ga0070673_101065060
353 Ga0070688_100037285
354 Ga0070688_100710319
355 Ga0070659_100002176
356 Ga0070667_100164956
357 Ga0070667_100310473
358 Ga0070709_10340629
359 Ga0070714_100473729
360 Ga0070701_10012203
361 Ga0070694_100036750
362 Ga0070694_100719353
363 Ga0070708_100003900
364 Ga0070708_100491727
365 Ga0070678_100314306
366 Ga0070678_101401997
367 Ga0070662_100183654
368 Ga0070681_10002672
369 Ga0070681_10635576
370 Ga0070685_10002796
371 Ga0070685_10274600
372 Ga0070685_11242118
373 Ga0070706_100000257
374 Ga0070699_100146711
375 Ga0070699_100193339
376 Ga0070679_100009414
377 Ga0070684_100000422
378 Ga0070697_100014325
379 Ga0070697_100136325
380 Ga0068853_100029715
381 Ga0070686_100007068
382 Ga0070686_100009760
383 Ga0070695_100234397
384 Ga0070693_100020692
385 Ga0070665_100014398
386 Ga0070665_100228440
387 Ga0070704_100810731
388 Ga0068855_100071139
389 Ga0068855_100119746
390 Ga0068855_100467232
391 Ga0070664_100019900
392 Ga0068857_100015864
393 Ga0068854_100246607
394 Ga0068852_100138641
395 Ga0068859_100186969
396 Ga0068859_100351230
397 Ga0068859_100452112
398 Ga0068859_101494132
399 Ga0068864_100126768
400 Ga0068864_100227786
401 Ga0068864_100242572
402 Ga0068864_100660406
403 Ga0068864_100969178
404 Ga0068866_10084446
405 Ga0068851_10132232
406 Ga0068863_100032098
407 Ga0068863_100465794
408 Ga0068863_100862005
409 Ga0068858_100124716
410 Ga0068858_100257970
411 Ga0068858_100369453
412 Ga0068860_100024688
413 Ga0068860_100026071
414 Ga0068862_100236357
415 Ga0081540_1015752
416 Ga0081539_10053771
417 Ga0075365_10099883
418 Ga0075368_10000977
419 Ga0075363_100009990
420 Ga0075364_10003535
421 Ga0070715_10029544
422 Ga0070716_100000345
423 Ga0070712_100001029
424 Ga0075362_10002996
425 Ga0075367_10007626
426 Ga0075369_10002489
427 Ga0075366_10004131
428 Ga0097621_100002240
429 Ga0097621_101099385
430 Ga0075370_10479727
431 Ga0068871_100001868
432 Ga0068871_100207993
433 Ga0068871_100438115
434 Ga0068871_100925086
435 Ga0075430_100037135
436 Ga0075430_101110050
437 Ga0075431_100012081
438 Ga0075431_100081329
439 Ga0075429_100257138
440 Ga0075429_101576356
441 Ga0097620_100186949
442 Ga0097620_100351230
443 Ga0097620_100452099
444 Ga0097620_101494025
445 Ga0105240_10227841
446 Ga0105240_10230045
447 Ga0105245_10424672
448 Ga0105245_12204150
449 Ga0105247_10004309
450 Ga0105247_10005843
451 Ga0114129_10299396
452 Ga0114129_11778263
453 Ga0105243_10144374
454 Ga0105243_10366602
455 Ga0105243_11034001
456 Ga0105241_10067199
457 Ga0105242_10011273
458 Ga0105242_10277193
459 Ga0105248_10159419
460 Ga0105248_10215806
461 Ga0105248_10345491
462 Ga0105248_12007215
463 Ga0105238_11727461
464 Ga0105249_10231235
465 Ga0105249_10549797
466 Ga0105249_10686236
467 Ga0105239_10017843
468 Ga0105239_10160443
469 Ga0105239_10372204
470 Ga0105239_10510748
471 Ga0105239_11447488
472 Ga0105246_10735394
473 Ga0105246_11000473
474 Ga0157373_10003721
475 Ga0157371_10050805
476 Ga0157370_10127442
477 Ga0157370_10551550
478 Ga0157370_10553349
479 Ga0157369_10058630
480 Ga0157374_10109127
481 Ga0157374_10266433
482 Ga0157374_12034446
483 Ga0157378_10000925
484 Ga0157378_10338646
485 Ga0157378_10372259
486 Ga0163162_10158057
487 Ga0163162_10271614
488 Ga0163162_10440754
489 Ga0163162_10457321
490 Ga0163162_11343945
491 Ga0157375_10580491
492 Ga0157375_10735486
493 Ga0157375_12233491
494 Ga0157375_12264425
495 Ga0163163_10004824
496 Ga0163163_10408055
497 Ga0163163_10520282
498 Ga0163163_10559221
499 Ga0163163_11081674
500 Ga0163163_11088715
501 Ga0163163_11239914
502 Ga0157380_10002895
503 Ga0157380_10083471
504 Ga0157377_10044636
505 Ga0157379_10795334
506 Ga0157379_10897737
507 Ga0157376_10029797
508 Ga0157376_10297806
509 Ga0157376_10356243
510 Ga0157376_10461765
511 Ga0182007_10107353
512 Ga0163161_10543901
513 Ga0224712_10103613
514 Ga0207656_10163787
515 Ga0207710_10005986
516 Ga0207710_10249201
517 Ga0207685_10007373
518 Ga0207645_10034465
519 Ga0207645_10200214
520 Ga0207643_10065757
521 Ga0207684_10002463
522 Ga0207654_10060999
523 Ga0207654_10409782
524 Ga0207654_10555491
525 Ga0207707_10078152
526 Ga0207695_11238575
527 Ga0207693_10008428
528 Ga0207663_10062629
529 Ga0207660_10101527
530 Ga0207662_10367379
531 Ga0207657_10033281
532 Ga0207649_11351376
533 Ga0207652_10079180
534 Ga0207652_10562153
535 Ga0207681_10573744
536 Ga0207650_10271284
537 Ga0207659_10627759
538 Ga0207687_10080433
539 Ga0207664_10595887
540 Ga0207644_10461122
541 Ga0207706_10217084
542 Ga0207706_10502339
543 Ga0207686_10009640
544 Ga0207670_10174241
545 Ga0207704_10856190
546 Ga0207665_10000147
547 Ga0207691_10015153
548 Ga0207691_10380516
549 Ga0207711_10054654
550 Ga0207711_10946286
551 Ga0207711_11412166
552 Ga0207689_10004427
553 Ga0207689_10114690
554 Ga0207661_10000020
555 Ga0207667_10069136
556 Ga0207667_10174676
557 Ga0207651_10635840
558 Ga0207712_10032263
559 Ga0207668_10112074
560 Ga0207640_10320587
561 Ga0207658_10528370
562 Ga0207677_10029359
563 Ga0207703_10102325
564 Ga0207703_10103063
565 Ga0207703_10147273
566 Ga0207703_10900494
567 Ga0207703_11185299
568 Ga0207703_11909245
569 Ga0207639_10009859
570 Ga0207641_10421946
571 Ga0207641_11786003
572 Ga0207676_10171973
573 Ga0207676_10280512
574 Ga0207676_11613578
575 Ga0207674_10001245
576 Ga0207683_10034974
577 Ga0207683_10360078
578 Ga0207683_10635007
579 Ga0207698_10104123
580 Ga0207698_10253193
581 Ga0209813_10001113
582 Ga0268266_10001953
583 Ga0268266_10262580
584 Ga0268266_10418772
585 Ga0268265_11270825
586 Ga0268264_10026105
587 Ga0268264_10171147
588 Ga0268264_10938457
589 Ga0268264_11110809
590 Ga0307515_10239118
591 Ga0265327_10004481
592 Ga0307513_10077808
593 Ga0307410_11806475
594 Ga0373934_0066386
595 Ga0373934_0125258
596 Ga0373939_0021572
597 Ga0373946_0407659
598 Ga0373935_0225284
599 Ga0373933_0372488
600 Ga0373937_0002838
601 Ga0373937_0655383
602 Ga0373925_0200232
603 Ga0373925_0723843
604 Ga0395900_0337295
605 Ga0395898_0116536
606 Ga0466967_0303650
607 Ga0495580_0040288
608 Ga0495580_0360768
609 Ga0495630_0611935
610 Ga0495665_0154515
611 Ga0495640_0054520
612 Ga0495645_0202581
613 Ga0495635_0608683
614 Ga0495657_0263539
615 Ga0495674_0061443
616 Ga0495675_0520771
617 Ga0495684_0017921
618 Ga0495602_0310739
619 Ga0496115_0869736
620 Ga0501034_0170649
621 Ga0501034_0425857
622 Ga0501043_0106157
623 nmdc:mga03683_2495_c1
624 nmdc:mga03n38_6537_c1
625 nmdc:mga00v17_53257_c1
626 nmdc:mga0yw44_7999_c1
627 nmdc:mga0k408_68787_c1
628 nmdc:mga06z11_6196_c1
629 nmdc:mga04h51_1388_c1
630 nmdc:mga07m45_217713_c1
631 nmdc:mga07m45_30488_c1
632 nmdc:mga09592_1240432_c1
633 nmdc:mga09592_360038_c1
634 nmdc:mga0qj67_97958_c1
635 nmdc:mga06r32_108094_c1
636 nmdc:mga06r32_97146_c1
637 nmdc:mga0rr50_433725_c1
638 nmdc:mga0a205_331894_c1
639 nmdc:mga0sz30_12396_c1
640 Ga0495612_0105451
641 Ga0500583_0087106
642 Ga0500641_0023161
643 Ga0500641_0135652
644 Ga0500556_0035412
645 Ga0500594_0006130
646 Ga0500617_041198
647 Ga0500588_0199907
648 Ga0500656_011053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

41

172

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9596 5 157
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9577 7 157
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9545 5 156
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9543 5 156
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9531 4 156
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9484 5 153 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9386 7 154 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.928 4 160 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9166 5 153 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9162 15 154 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A193CCJ2-F1-model_v4 ATPase 0.9861 7 161
AF-A0A4Q3GJY7-F1-model_v4 deleted 0.9844 19 157
AF-A0A2R4FE92-F1-model_v4 ATPase 0.9821 2 157
AF-A0A4Q3JIB1-F1-model_v4 ATPase 0.9808 6 159
AF-A0A0N9I7Y6-F1-model_v4 ATPase 0.9803 7 161

Map