F407201

General Info

Members Datasets Scaffolds Average Seq Length
324 167 648 263

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10299852|Ga0070658_102998521
Length 306
Sequence MSSLCVSQRPLCLCVIRVSTLPRRFLLFKSSSAGTLNCVKLLFIGDIVGQPGRRAVRDLLPKLRERHALDFVIANGENSAGGSGITPKTAEEIFAAGVDVITSGDHLWDQKDVMELLENEKRFLRPLNYPASTPGRGSGVFTVQAVKFGVLNSVTVGVLNLQGRTFMPALENPFQLGLEEVKKLVEQTKVIFVDFHAEATSEKIAFARMLDGQVSAVVGTHTHVQTADEQVFPGGTAYLTDAGFTGPHESVIGREIAPVVQRFLTNMPQRFEVAKDRVILNGAVVEIDETTGKAMGIQRVAEAWSA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
82 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
106 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.93
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 1.23
Rhizosphere 95.68
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10299852 3300005327 Bacteria 1370
2 rootH2_10043340 3300003320 Bacteria 6688
3 rootH2_10047699 3300003320 Bacteria 8252
4 rootH2_10233256 3300003320 Unclassified 1842
5 rootH1_10025398 3300003323 Bacteria 5221
6 Ga0070683_100553266 3300005329 Bacteria 1100
7 Ga0070690_100005984 3300005330 Bacteria 6872
8 Ga0070690_100106691 3300005330 Bacteria 1864
9 Ga0070689_100090707 3300005340 Bacteria 2408
10 Ga0070689_100224306 3300005340 Bacteria 1543
11 Ga0070689_100616736 3300005340 Unclassified 941
12 Ga0070691_10123678 3300005341 Bacteria 1305
13 Ga0070691_10199543 3300005341 Bacteria 1050
14 Ga0070675_100720724 3300005354 Bacteria 909
15 Ga0070673_100289019 3300005364 Bacteria 1440
16 Ga0070688_100014704 3300005365 Bacteria 4439
17 Ga0070688_100020794 3300005365 Bacteria 3823
18 Ga0070688_100209631 3300005365 Bacteria 1367
19 Ga0070714_100008424 3300005435 Bacteria 8051
20 Ga0070713_100155932 3300005436 Unclassified 2035
21 Ga0070713_100192585 3300005436 Bacteria 1838
22 Ga0070713_100535188 3300005436 Bacteria 1108
23 Ga0070711_100016415 3300005439 Bacteria 4703
24 Ga0070694_100122453 3300005444 Unclassified 1868
25 Ga0070681_10071382 3300005458 Bacteria 3437
26 Ga0070685_10051561 3300005466 Bacteria 2379
27 Ga0070685_10140395 3300005466 Bacteria 1520
28 Ga0070686_100002925 3300005544 Bacteria 9377
29 Ga0070686_100278851 3300005544 Bacteria 1232
30 Ga0070695_100234074 3300005545 Bacteria 1329
31 Ga0070693_100342164 3300005547 Bacteria 1021
32 Ga0070665_100000045 3300005548 Bacteria 275023
33 Ga0070704_100028338 3300005549 Bacteria 3724
34 Ga0068855_100090431 3300005563 Bacteria 3533
35 Ga0068855_100360018 3300005563 Bacteria 1601
36 Ga0068857_100057737 3300005577 Unclassified 3445
37 Ga0068856_100008205 3300005614 Bacteria 10185
38 Ga0068856_100123997 3300005614 Bacteria 2586
39 Ga0070702_100198386 3300005615 Unclassified 1326
40 Ga0068859_100007658 3300005617 Bacteria 10977
41 Ga0068859_100505454 3300005617 Bacteria 1304
42 Ga0068859_100811063 3300005617 Bacteria 1023
43 Ga0068861_100279013 3300005719 Unclassified 1438
44 Ga0068863_100000460 3300005841 Bacteria 41486
45 Ga0068863_100353311 3300005841 Bacteria 1432
46 Ga0068858_100127168 3300005842 Bacteria 2387
47 Ga0068858_100140459 3300005842 Bacteria 2267
48 Ga0068858_100371140 3300005842 Bacteria 1372
49 Ga0070717_10348124 3300006028 Unclassified 1324
50 Ga0070712_100611501 3300006175 Bacteria 923
51 Ga0097621_100082623 3300006237 Bacteria 2675
52 Ga0097621_100095302 3300006237 Bacteria 2496
53 Ga0068871_100118662 3300006358 Bacteria 2232
54 Ga0068871_100608440 3300006358 Bacteria 994
55 Ga0075428_100036034 3300006844 Bacteria 5452
56 Ga0075429_100044838 3300006880 Bacteria 3846
57 Ga0068865_100390293 3300006881 Bacteria 1138
58 Ga0097620_100007658 3300006931 Bacteria 10977
59 Ga0097620_100505450 3300006931 Bacteria 1304
60 Ga0097620_100811131 3300006931 Bacteria 1023
61 Ga0105240_10039556 3300009093 Bacteria 6038
62 Ga0105240_10111003 3300009093 Bacteria 3318
63 Ga0105240_10127186 3300009093 Bacteria 3061
64 Ga0105240_10222141 3300009093 Bacteria 2200
65 Ga0105240_10275214 3300009093 Bacteria 1937
66 Ga0111539_10032019 3300009094 Bacteria 6388
67 Ga0105245_10144564 3300009098 Bacteria 2243
68 Ga0105245_10178147 3300009098 Bacteria 2029
69 Ga0105247_10144263 3300009101 Bacteria 1563
70 Ga0114129_10179559 3300009147 Bacteria 2882
71 Ga0114129_10239806 3300009147 Bacteria 2437
72 Ga0114129_10438526 3300009147 Bacteria 1715
73 Ga0105242_10564565 3300009176 Unclassified 1093
74 Ga0105248_10223820 3300009177 Bacteria 2118
75 Ga0105248_10253781 3300009177 Bacteria 1979
76 Ga0105248_10270052 3300009177 Bacteria 1915
77 Ga0105237_10009874 3300009545 Bacteria 10199
78 Ga0105237_10054266 3300009545 Bacteria 4016
79 Ga0105238_10025438 3300009551 Bacteria 6034
80 Ga0105238_10137820 3300009551 Bacteria 2418
81 Ga0105238_10255076 3300009551 Bacteria 1733
82 Ga0099796_10147580 3300010159 Unclassified 924
83 Ga0105239_10652511 3300010375 Bacteria 1202
84 Ga0105246_10379671 3300011119 Unclassified 1167
85 Ga0157370_10046345 3300013104 Bacteria 4168
86 Ga0157374_10375511 3300013296 Bacteria 1416
87 Ga0157372_10092105 3300013307 Bacteria 3448
88 Ga0163163_10282836 3300014325 Bacteria 1710
89 Ga0213873_10001301 3300021358 Bacteria 4114
90 Ga0213876_10049981 3300021384 Bacteria 2209
91 Ga0207707_10136850 3300025912 Bacteria 2142
92 Ga0207707_10174836 3300025912 Bacteria 1876
93 Ga0207695_10055613 3300025913 Bacteria 4122
94 Ga0207695_10112818 3300025913 Bacteria 2695
95 Ga0207671_10014496 3300025914 Bacteria 6225
96 Ga0207660_10310620 3300025917 Bacteria 1257
97 Ga0207694_10032305 3300025924 Bacteria 4005
98 Ga0207694_10098708 3300025924 Unclassified 2313
99 Ga0207694_10178341 3300025924 Bacteria 1722
100 Ga0207687_10345425 3300025927 Unclassified 1211
101 Ga0207700_10140181 3300025928 Unclassified 1986
102 Ga0207664_10031199 3300025929 Bacteria 4076
103 Ga0207670_10072399 3300025936 Bacteria 2386
104 Ga0207670_10150070 3300025936 Bacteria 1728
105 Ga0207661_10398909 3300025944 Bacteria 1247
106 Ga0207667_10214569 3300025949 Bacteria 1972
107 Ga0207667_10258776 3300025949 Bacteria 1780
108 Ga0207712_10710893 3300025961 Bacteria 878
109 Ga0207703_10059294 3300026035 Bacteria 3126
110 Ga0207703_10141163 3300026035 Bacteria 2091
111 Ga0207703_10157748 3300026035 Bacteria 1985
112 Ga0207702_10004630 3300026078 Bacteria 12184
113 Ga0207702_10265170 3300026078 Bacteria 1618
114 Ga0207641_10007414 3300026088 Bacteria 9124
115 Ga0207641_10339870 3300026088 Bacteria 1428
116 Ga0207641_10667202 3300026088 Bacteria 1022
117 Ga0207674_10056684 3300026116 Unclassified 3977
118 Ga0265356_1000072 3300028017 Bacteria 16574
119 Ga0265337_1000957 3300028556 Bacteria 15125
120 Ga0265337_1001167 3300028556 Bacteria 13397
121 Ga0265337_1003483 3300028556 Bacteria 6800
122 Ga0265337_1004874 3300028556 Bacteria 5477
123 Ga0265337_1008353 3300028556 Bacteria 3771
124 Ga0265326_10003963 3300028558 Bacteria 4802
125 Ga0265326_10005324 3300028558 Bacteria 4057
126 Ga0265326_10023401 3300028558 Bacteria 1766
127 Ga0265326_10048089 3300028558 Bacteria 1210
128 Ga0265319_1000001 3300028563 Bacteria 549513
129 Ga0265334_10004885 3300028573 Bacteria 5894
130 Ga0265334_10031629 3300028573 Bacteria 2114
131 Ga0265334_10097635 3300028573 Bacteria 1066
132 Ga0265323_10000128 3300028653 Bacteria 43496
133 Ga0265323_10003093 3300028653 Bacteria 7401
134 Ga0265323_10057563 3300028653 Bacteria 1360
135 Ga0265323_10067605 3300028653 Bacteria 1229
136 Ga0265336_10000446 3300028666 Bacteria 25246
137 Ga0265336_10016130 3300028666 Bacteria 2445
138 Ga0265336_10027010 3300028666 Bacteria 1800
139 Ga0265338_10000196 3300028800 Bacteria 114348
140 Ga0265338_10000305 3300028800 Bacteria 88659
141 Ga0265338_10000995 3300028800 Bacteria 47741
142 Ga0265338_10001096 3300028800 Bacteria 45062
143 Ga0265338_10001337 3300028800 Bacteria 40213
144 Ga0265338_10002530 3300028800 Bacteria 27106
145 Ga0265338_10003915 3300028800 Bacteria 20550
146 Ga0265338_10004165 3300028800 Bacteria 19735
147 Ga0265338_10004677 3300028800 Bacteria 18362
148 Ga0265338_10010268 3300028800 Bacteria 11019
149 Ga0265338_10012627 3300028800 Bacteria 9618
150 Ga0265338_10019054 3300028800 Bacteria 7306
151 Ga0265338_10031959 3300028800 Bacteria 5148
152 Ga0265338_10054943 3300028800 Bacteria 3547
153 Ga0265338_10061078 3300028800 Bacteria 3305
154 Ga0265338_10081879 3300028800 Bacteria 2704
155 Ga0265338_10082640 3300028800 Bacteria 2689
156 Ga0265338_10127604 3300028800 Bacteria 2015
157 Ga0265338_10132400 3300028800 Bacteria 1966
158 Ga0265338_10145085 3300028800 Bacteria 1853
159 Ga0265338_10229536 3300028800 Bacteria 1381
160 Ga0265338_10234777 3300028800 Bacteria 1362
161 Ga0265338_10273057 3300028800 Bacteria 1238
162 Ga0265338_10296662 3300028800 Bacteria 1176
163 Ga0265338_10344043 3300028800 Bacteria 1074
164 Ga0265324_10000716 3300029957 Bacteria 22045
165 Ga0265324_10001077 3300029957 Bacteria 16437
166 Ga0265324_10005122 3300029957 Bacteria 5728
167 Ga0265324_10005424 3300029957 Bacteria 5512
168 Ga0265324_10012134 3300029957 Bacteria 3260
169 Ga0265324_10012788 3300029957 Bacteria 3153
170 Ga0265324_10017838 3300029957 Bacteria 2578
171 Ga0265324_10026622 3300029957 Bacteria 2046
172 Ga0307511_10000016 3300030521 Bacteria 124318
173 Ga0265762_1017801 3300030760 Unclassified 1295
174 Ga0265777_100958 3300030877 Unclassified 1463
175 Ga0265760_10000084 3300031090 Bacteria 24153
176 Ga0265332_10063772 3300031238 Bacteria 1574
177 Ga0265320_10000574 3300031240 Bacteria 28256
178 Ga0265320_10000581 3300031240 Bacteria 28135
179 Ga0265320_10009149 3300031240 Bacteria 5997
180 Ga0265320_10018287 3300031240 Bacteria 3864
181 Ga0265325_10010927 3300031241 Bacteria 5229
182 Ga0265325_10038035 3300031241 Bacteria 2541
183 Ga0265325_10106804 3300031241 Bacteria 1364
184 Ga0265325_10112163 3300031241 Bacteria 1324
185 Ga0265329_10071123 3300031242 Bacteria 1101
186 Ga0265340_10002642 3300031247 Bacteria 10184
187 Ga0265340_10008302 3300031247 Bacteria 5613
188 Ga0265340_10026482 3300031247 Bacteria 2931
189 Ga0265340_10053164 3300031247 Bacteria 1956
190 Ga0265339_10002164 3300031249 Bacteria 14256
191 Ga0265339_10069525 3300031249 Bacteria 1879
192 Ga0265339_10073860 3300031249 Bacteria 1813
193 Ga0265339_10091202 3300031249 Bacteria 1597
194 Ga0265331_10148212 3300031250 Bacteria 1066
195 Ga0265327_10000705 3300031251 Bacteria 52883
196 Ga0265327_10001892 3300031251 Bacteria 24226
197 Ga0265327_10007528 3300031251 Bacteria 8383
198 Ga0265316_10000659 3300031344 Bacteria 38376
199 Ga0265316_10003620 3300031344 Bacteria 15574
200 Ga0265316_10005203 3300031344 Bacteria 12723
201 Ga0265316_10008109 3300031344 Bacteria 9787
202 Ga0265316_10094383 3300031344 Bacteria 2279
203 Ga0265316_10139735 3300031344 Bacteria 1820
204 Ga0265316_10143026 3300031344 Bacteria 1795
205 Ga0265316_10147165 3300031344 Bacteria 1766
206 Ga0265316_10175086 3300031344 Bacteria 1599
207 Ga0265313_10000053 3300031595 Bacteria 110362
208 Ga0265313_10001830 3300031595 Bacteria 19415
209 Ga0265313_10040932 3300031595 Bacteria 2286
210 Ga0316579_10186062 3300031691 Bacteria 1004
211 Ga0265314_10024746 3300031711 Bacteria 4545
212 Ga0265314_10040148 3300031711 Unclassified 3362
213 Ga0265342_10003993 3300031712 Bacteria 11812
214 Ga0265342_10007192 3300031712 Bacteria 8189
215 Ga0265342_10051583 3300031712 Bacteria 2454
216 Ga0265342_10105156 3300031712 Bacteria 1604
217 Ga0316583_10006371 3300032133 Bacteria 4236
218 Ga0316583_10090652 3300032133 Unclassified 1066
219 Ga0316585_10042196 3300032137 Bacteria 1455
220 Ga0373930_0002292 3300034816 Bacteria 2953
221 Ga0373926_0064258 3300035083 Bacteria 1341
222 Ga0373928_0000079 3300035084 Bacteria 16546
223 Ga0373929_0000755 3300035085 Bacteria 6286
224 Ga0373944_0000496 3300035089 Bacteria 9155
225 Ga0373944_0013350 3300035089 Bacteria 2277
226 Ga0373951_0002072 3300035091 Bacteria 5141
227 Ga0373951_0062112 3300035091 Bacteria 937
228 Ga0373932_0000003 3300035112 Bacteria 459351
229 Ga0373945_0010816 3300035116 Bacteria 3008
230 Ga0373954_0000157 3300035118 Bacteria 24231
231 Ga0373956_0001486 3300035119 Bacteria 9694
232 Ga0373943_0274674 3300035170 Bacteria 951
233 Ga0373962_0000373 3300035242 Bacteria 9814
234 Ga0316574_0226565 3300035398 Bacteria 1197
235 Ga0373931_0000017 3300035691 Bacteria 207733
236 Ga0373935_0020029 3300035692 Bacteria 4084
237 Ga0373935_0042814 3300035692 Bacteria 2848
238 Ga0373927_0069865 3300035695 Bacteria 2273
239 Ga0373927_0088418 3300035695 Bacteria 2011
240 Ga0373947_0218643 3300035725 Bacteria 1252
241 Ga0373937_0002220 3300036401 Bacteria 16226
242 Ga0373937_0163842 3300036401 Bacteria 2085
243 Ga0373937_0178675 3300036401 Bacteria 1993
244 Ga0373937_0529199 3300036401 Bacteria 1120
245 Ga0316584_0069538 3300036712 Bacteria 2639
246 Ga0373925_0001223 3300037068 Bacteria 22690
247 Ga0436365_0965649 3300039437 Bacteria 2462
248 Ga0436360_0845839 3300039438 Unclassified 1319
249 Ga0436363_1645912 3300039450 Bacteria 3307
250 Ga0436362_0223899 3300039453 Bacteria 1438
251 Ga0436362_0728543 3300039453 Bacteria 7776
252 Ga0451577_0028241 3300042876 Bacteria 5076
253 Ga0451577_0363905 3300042876 Bacteria 1312
254 Ga0451577_0474699 3300042876 Bacteria 1135
255 Ga0453683_0013649 3300044673 Bacteria 5292
256 Ga0453684_0040610 3300044712 Bacteria 6313
257 Ga0453684_0044374 3300044712 Bacteria 5950
258 Ga0453684_0141756 3300044712 Bacteria 2869
259 Ga0451576_0037949 3300045051 Bacteria 5101
260 Ga0451576_0081293 3300045051 Bacteria 3370
261 Ga0451576_0083325 3300045051 Bacteria 3327
262 Ga0451576_0124024 3300045051 Bacteria 2691
263 Ga0451576_0125465 3300045051 Bacteria 2675
264 Ga0451576_0148562 3300045051 Unclassified 2444
265 Ga0495651_0131684 3300046462 Bacteria 1825
266 Ga0495651_0147884 3300046462 Bacteria 1697
267 Ga0495580_0151447 3300046472 Bacteria 1607
268 Ga0495662_0120250 3300046476 Bacteria 1289
269 Ga0495618_0001049 3300046514 Bacteria 18859
270 Ga0495630_0112210 3300046517 Bacteria 2065
271 Ga0495630_0134388 3300046517 Bacteria 1879
272 Ga0495630_0210905 3300046517 Bacteria 1482
273 Ga0495630_0340203 3300046517 Bacteria 1148
274 Ga0495630_0408723 3300046517 Bacteria 1040
275 Ga0495640_0088317 3300046533 Bacteria 2049
276 Ga0495586_0000121 3300046535 Bacteria 47320
277 Ga0495634_0000333 3300046642 Bacteria 45524
278 Ga0495657_0101799 3300046675 Bacteria 1829
279 Ga0495599_0011113 3300046678 Bacteria 5524
280 Ga0495647_0009309 3300046681 Bacteria 3324
281 Ga0495658_0004454 3300046683 Bacteria 6896
282 Ga0495613_0000939 3300046689 Bacteria 22337
283 Ga0495613_0283694 3300046689 Bacteria 1149
284 Ga0495604_0106081 3300047317 Bacteria 2056
285 Ga0495674_0058399 3300047319 Bacteria 3373
286 Ga0495680_0002012 3300047322 Bacteria 21331
287 Ga0495675_0023187 3300047444 Unclassified 3956
288 Ga0496106_0354635 3300048909 Bacteria 1178
289 Ga0496107_0048424 3300048910 Bacteria 3062
290 Ga0496115_0003613 3300048918 Bacteria 11124
291 Ga0496118_0151940 3300048921 Bacteria 1448
292 Ga0501031_0000012 3300049568 Bacteria 137943
293 Ga0501031_0078104 3300049568 Bacteria 2157
294 Ga0501032_0028481 3300049569 Bacteria 3839
295 Ga0501032_0033554 3300049569 Bacteria 3516
296 Ga0501033_0001607 3300049570 Bacteria 19842
297 Ga0501033_0032888 3300049570 Bacteria 3894
298 Ga0501034_0088390 3300049571 Bacteria 3097
299 Ga0501034_0263248 3300049571 Bacteria 1667
300 Ga0501037_0308750 3300049573 Bacteria 1097
301 Ga0501039_0366317 3300049575 Bacteria 1132
302 Ga0501039_0565152 3300049575 Bacteria 892
303 Ga0501043_0261412 3300049579 Bacteria 1331
304 Ga0501043_0358485 3300049579 Bacteria 1107
305 Ga0501070_0250129 3300049586 Bacteria 1450
306 Ga0501079_0458055 3300049741 Bacteria 1002
307 Ga0501079_0517693 3300049741 Bacteria 938
308 Ga0501035_0007661 3300049822 Bacteria 10086
309 Ga0501035_0008625 3300049822 Bacteria 9485
310 Ga0501044_0000024 3300049823 Bacteria 194302
311 Ga0501044_0031577 3300049823 Bacteria 5574
312 Ga0501044_0138552 3300049823 Unclassified 2423
313 Ga0501044_0142365 3300049823 Bacteria 2386
314 nmdc:mga00v17_34518_c2 3300050491 Bacteria 2262
315 nmdc:mga05p37_288625_c1 3300050507 Unclassified 1953
316 nmdc:mga05p37_717138_c1 3300050507 Bacteria 1108
317 nmdc:mga08y16_580768_c1 3300050511 Bacteria 1131
318 nmdc:mga08y16_717242_c1 3300050511 Bacteria 998
319 nmdc:mga08y16_9818_c1 3300050511 Bacteria 10046
320 nmdc:mga0n895_209796_c1 3300050512 Bacteria 1978
321 nmdc:mga0rr50_275158_c1 3300050513 Bacteria 1063
322 Ga0495601_0285806 3300053077 Bacteria 1075
323 Ga0530510_0121457 3300061734 Unclassified 1918
324 2787436765 2786546517 Bacteria 6614109
325 Ga0070658_10299852
326 rootH2_10043340
327 rootH2_10047699
328 rootH2_10233256
329 rootH1_10025398
330 Ga0070683_100553266
331 Ga0070690_100005984
332 Ga0070690_100106691
333 Ga0070689_100090707
334 Ga0070689_100224306
335 Ga0070689_100616736
336 Ga0070691_10123678
337 Ga0070691_10199543
338 Ga0070675_100720724
339 Ga0070673_100289019
340 Ga0070688_100014704
341 Ga0070688_100020794
342 Ga0070688_100209631
343 Ga0070714_100008424
344 Ga0070713_100155932
345 Ga0070713_100192585
346 Ga0070713_100535188
347 Ga0070711_100016415
348 Ga0070694_100122453
349 Ga0070681_10071382
350 Ga0070685_10051561
351 Ga0070685_10140395
352 Ga0070686_100002925
353 Ga0070686_100278851
354 Ga0070695_100234074
355 Ga0070693_100342164
356 Ga0070665_100000045
357 Ga0070704_100028338
358 Ga0068855_100090431
359 Ga0068855_100360018
360 Ga0068857_100057737
361 Ga0068856_100008205
362 Ga0068856_100123997
363 Ga0070702_100198386
364 Ga0068859_100007658
365 Ga0068859_100505454
366 Ga0068859_100811063
367 Ga0068861_100279013
368 Ga0068863_100000460
369 Ga0068863_100353311
370 Ga0068858_100127168
371 Ga0068858_100140459
372 Ga0068858_100371140
373 Ga0070717_10348124
374 Ga0070712_100611501
375 Ga0097621_100082623
376 Ga0097621_100095302
377 Ga0068871_100118662
378 Ga0068871_100608440
379 Ga0075428_100036034
380 Ga0075429_100044838
381 Ga0068865_100390293
382 Ga0097620_100007658
383 Ga0097620_100505450
384 Ga0097620_100811131
385 Ga0105240_10039556
386 Ga0105240_10111003
387 Ga0105240_10127186
388 Ga0105240_10222141
389 Ga0105240_10275214
390 Ga0111539_10032019
391 Ga0105245_10144564
392 Ga0105245_10178147
393 Ga0105247_10144263
394 Ga0114129_10179559
395 Ga0114129_10239806
396 Ga0114129_10438526
397 Ga0105242_10564565
398 Ga0105248_10223820
399 Ga0105248_10253781
400 Ga0105248_10270052
401 Ga0105237_10009874
402 Ga0105237_10054266
403 Ga0105238_10025438
404 Ga0105238_10137820
405 Ga0105238_10255076
406 Ga0099796_10147580
407 Ga0105239_10652511
408 Ga0105246_10379671
409 Ga0157370_10046345
410 Ga0157374_10375511
411 Ga0157372_10092105
412 Ga0163163_10282836
413 Ga0213873_10001301
414 Ga0213876_10049981
415 Ga0207707_10136850
416 Ga0207707_10174836
417 Ga0207695_10055613
418 Ga0207695_10112818
419 Ga0207671_10014496
420 Ga0207660_10310620
421 Ga0207694_10032305
422 Ga0207694_10098708
423 Ga0207694_10178341
424 Ga0207687_10345425
425 Ga0207700_10140181
426 Ga0207664_10031199
427 Ga0207670_10072399
428 Ga0207670_10150070
429 Ga0207661_10398909
430 Ga0207667_10214569
431 Ga0207667_10258776
432 Ga0207712_10710893
433 Ga0207703_10059294
434 Ga0207703_10141163
435 Ga0207703_10157748
436 Ga0207702_10004630
437 Ga0207702_10265170
438 Ga0207641_10007414
439 Ga0207641_10339870
440 Ga0207641_10667202
441 Ga0207674_10056684
442 Ga0265356_1000072
443 Ga0265337_1000957
444 Ga0265337_1001167
445 Ga0265337_1003483
446 Ga0265337_1004874
447 Ga0265337_1008353
448 Ga0265326_10003963
449 Ga0265326_10005324
450 Ga0265326_10023401
451 Ga0265326_10048089
452 Ga0265319_1000001
453 Ga0265334_10004885
454 Ga0265334_10031629
455 Ga0265334_10097635
456 Ga0265323_10000128
457 Ga0265323_10003093
458 Ga0265323_10057563
459 Ga0265323_10067605
460 Ga0265336_10000446
461 Ga0265336_10016130
462 Ga0265336_10027010
463 Ga0265338_10000196
464 Ga0265338_10000305
465 Ga0265338_10000995
466 Ga0265338_10001096
467 Ga0265338_10001337
468 Ga0265338_10002530
469 Ga0265338_10003915
470 Ga0265338_10004165
471 Ga0265338_10004677
472 Ga0265338_10010268
473 Ga0265338_10012627
474 Ga0265338_10019054
475 Ga0265338_10031959
476 Ga0265338_10054943
477 Ga0265338_10061078
478 Ga0265338_10081879
479 Ga0265338_10082640
480 Ga0265338_10127604
481 Ga0265338_10132400
482 Ga0265338_10145085
483 Ga0265338_10229536
484 Ga0265338_10234777
485 Ga0265338_10273057
486 Ga0265338_10296662
487 Ga0265338_10344043
488 Ga0265324_10000716
489 Ga0265324_10001077
490 Ga0265324_10005122
491 Ga0265324_10005424
492 Ga0265324_10012134
493 Ga0265324_10012788
494 Ga0265324_10017838
495 Ga0265324_10026622
496 Ga0307511_10000016
497 Ga0265762_1017801
498 Ga0265777_100958
499 Ga0265760_10000084
500 Ga0265332_10063772
501 Ga0265320_10000574
502 Ga0265320_10000581
503 Ga0265320_10009149
504 Ga0265320_10018287
505 Ga0265325_10010927
506 Ga0265325_10038035
507 Ga0265325_10106804
508 Ga0265325_10112163
509 Ga0265329_10071123
510 Ga0265340_10002642
511 Ga0265340_10008302
512 Ga0265340_10026482
513 Ga0265340_10053164
514 Ga0265339_10002164
515 Ga0265339_10069525
516 Ga0265339_10073860
517 Ga0265339_10091202
518 Ga0265331_10148212
519 Ga0265327_10000705
520 Ga0265327_10001892
521 Ga0265327_10007528
522 Ga0265316_10000659
523 Ga0265316_10003620
524 Ga0265316_10005203
525 Ga0265316_10008109
526 Ga0265316_10094383
527 Ga0265316_10139735
528 Ga0265316_10143026
529 Ga0265316_10147165
530 Ga0265316_10175086
531 Ga0265313_10000053
532 Ga0265313_10001830
533 Ga0265313_10040932
534 Ga0316579_10186062
535 Ga0265314_10024746
536 Ga0265314_10040148
537 Ga0265342_10003993
538 Ga0265342_10007192
539 Ga0265342_10051583
540 Ga0265342_10105156
541 Ga0316583_10006371
542 Ga0316583_10090652
543 Ga0316585_10042196
544 Ga0373930_0002292
545 Ga0373926_0064258
546 Ga0373928_0000079
547 Ga0373929_0000755
548 Ga0373944_0000496
549 Ga0373944_0013350
550 Ga0373951_0002072
551 Ga0373951_0062112
552 Ga0373932_0000003
553 Ga0373945_0010816
554 Ga0373954_0000157
555 Ga0373956_0001486
556 Ga0373943_0274674
557 Ga0373962_0000373
558 Ga0316574_0226565
559 Ga0373931_0000017
560 Ga0373935_0020029
561 Ga0373935_0042814
562 Ga0373927_0069865
563 Ga0373927_0088418
564 Ga0373947_0218643
565 Ga0373937_0002220
566 Ga0373937_0163842
567 Ga0373937_0178675
568 Ga0373937_0529199
569 Ga0316584_0069538
570 Ga0373925_0001223
571 Ga0436365_0965649
572 Ga0436360_0845839
573 Ga0436363_1645912
574 Ga0436362_0223899
575 Ga0436362_0728543
576 Ga0451577_0028241
577 Ga0451577_0363905
578 Ga0451577_0474699
579 Ga0453683_0013649
580 Ga0453684_0040610
581 Ga0453684_0044374
582 Ga0453684_0141756
583 Ga0451576_0037949
584 Ga0451576_0081293
585 Ga0451576_0083325
586 Ga0451576_0124024
587 Ga0451576_0125465
588 Ga0451576_0148562
589 Ga0495651_0131684
590 Ga0495651_0147884
591 Ga0495580_0151447
592 Ga0495662_0120250
593 Ga0495618_0001049
594 Ga0495630_0112210
595 Ga0495630_0134388
596 Ga0495630_0210905
597 Ga0495630_0340203
598 Ga0495630_0408723
599 Ga0495640_0088317
600 Ga0495586_0000121
601 Ga0495634_0000333
602 Ga0495657_0101799
603 Ga0495599_0011113
604 Ga0495647_0009309
605 Ga0495658_0004454
606 Ga0495613_0000939
607 Ga0495613_0283694
608 Ga0495604_0106081
609 Ga0495674_0058399
610 Ga0495680_0002012
611 Ga0495675_0023187
612 Ga0496106_0354635
613 Ga0496107_0048424
614 Ga0496115_0003613
615 Ga0496118_0151940
616 Ga0501031_0000012
617 Ga0501031_0078104
618 Ga0501032_0028481
619 Ga0501032_0033554
620 Ga0501033_0001607
621 Ga0501033_0032888
622 Ga0501034_0088390
623 Ga0501034_0263248
624 Ga0501037_0308750
625 Ga0501039_0366317
626 Ga0501039_0565152
627 Ga0501043_0261412
628 Ga0501043_0358485
629 Ga0501070_0250129
630 Ga0501079_0458055
631 Ga0501079_0517693
632 Ga0501035_0007661
633 Ga0501035_0008625
634 Ga0501044_0000024
635 Ga0501044_0031577
636 Ga0501044_0138552
637 Ga0501044_0142365
638 nmdc:mga00v17_34518_c2
639 nmdc:mga05p37_288625_c1
640 nmdc:mga05p37_717138_c1
641 nmdc:mga08y16_580768_c1
642 nmdc:mga08y16_717242_c1
643 nmdc:mga08y16_9818_c1
644 nmdc:mga0n895_209796_c1
645 nmdc:mga0rr50_275158_c1
646 Ga0495601_0285806
647 Ga0530510_0121457
648 2787436765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

42

300

0.98

PF00149

Metallophos

Calcineurin-like phosphoesterase

39

225

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9797 2 259
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9577 2 259
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9551 2 259
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9545 2 261
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9508 2 261
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9797 2 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9607 2 261 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9577 2 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.957 2 261 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9266 2 259 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1L8ZBL7-F1-model_v4 Phosphoesterase 0.9964 1 61 GO:0004113
AF-A0A3C0WKN2-F1-model_v4 Metallophosphoesterase 0.9959 161 259 GO:0004113
AF-A0A3B0PD68-F1-model_v4 Metallophosphoesterase YmdB 0.9932 2 71 GO:0004113
AF-A0A661BEZ6-F1-model_v4 Metallophosphoesterase 0.993 144 260 GO:0004113
AF-A0A2V5MUN4-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9921 2 260 GO:0004113
GO:0046872

Map